F452232

General Info

Members Datasets Scaffolds Average Seq Length
480 229 480 172

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10689991|Ga0157376_106899911
Length 176
Sequence MFMKTLEEKWTAWLDDQLGGRELSEFEASLPDKAAAQAEKAEAKKLGKLLKRELSAHPLKNEEFFSHQLRERIVQESGEQPRERARRNPTSNWWTIPRLLWAGTGSLAVFLICTVLVMHQERPGEESQYLTQILNARVDPVVSPNGTVSIFEVKQDRVTVLWTEGLQTLPADYAAK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.08
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2070193 2162886007 Bacteria 920
2 JGI24737J22298_10012645 3300001990 Bacteria 2751
3 JGI24035J26624_1000141 3300002126 Bacteria 6413
4 JGI24035J26624_1003257 3300002126 Unclassified 1525
5 JGI25404J52841_10004829 3300003659 Unclassified 2760
6 JGI25405J52794_10000412 3300003911 Bacteria 6018
7 JGI25405J52794_10002813 3300003911 Bacteria 3019
8 JGI25405J52794_10024888 3300003911 Bacteria 1224
9 Ga0065714_10094929 3300005288 Bacteria 1801
10 Ga0065704_10004850 3300005289 Bacteria 3990
11 Ga0065704_10027173 3300005289 Bacteria 1245
12 Ga0065704_10073950 3300005289 Bacteria 6644
13 Ga0065704_10091739 3300005289 Bacteria 2696
14 Ga0065704_10438568 3300005289 Unclassified 701
15 Ga0065712_10001692 3300005290 Bacteria 6372
16 Ga0065712_10004664 3300005290 Bacteria 5980
17 Ga0065712_10016478 3300005290 Unclassified 1439
18 Ga0065712_10019107 3300005290 Unclassified 1834
19 Ga0065712_10026984 3300005290 Unclassified 1111
20 Ga0065712_10116148 3300005290 Bacteria 1740
21 Ga0065712_10180216 3300005290 Bacteria 1196
22 Ga0065715_10001727 3300005293 Bacteria 5692
23 Ga0065715_10089933 3300005293 Bacteria 8092
24 Ga0065715_10119901 3300005293 Unclassified 2274
25 Ga0065715_10167516 3300005293 Bacteria 1574
26 Ga0065715_10174334 3300005293 Unclassified 1523
27 Ga0065715_10340754 3300005293 Unclassified 886
28 Ga0065707_10013106 3300005295 Unclassified 2268
29 Ga0065707_10024750 3300005295 Unclassified 1842
30 Ga0065707_10118992 3300005295 Bacteria 2171
31 Ga0070658_10136660 3300005327 Bacteria 2046
32 Ga0070676_10494148 3300005328 Bacteria 867
33 Ga0070683_100041590 3300005329 Unclassified 4229
34 Ga0070683_100114079 3300005329 Bacteria 2550
35 Ga0070690_100070824 3300005330 Unclassified 2265
36 Ga0070666_10223058 3300005335 Bacteria 1330
37 Ga0070680_100026698 3300005336 Bacteria 4619
38 Ga0070680_100905527 3300005336 Unclassified 761
39 Ga0070660_100319905 3300005339 Bacteria 1274
40 Ga0070689_100000978 3300005340 Bacteria 17870
41 Ga0070689_100128485 3300005340 Bacteria 2031
42 Ga0070687_100068392 3300005343 Bacteria 1899
43 Ga0070661_100192774 3300005344 Bacteria 1555
44 Ga0070692_10116733 3300005345 Bacteria 1483
45 Ga0070668_100031417 3300005347 Bacteria 4040
46 Ga0070668_100178032 3300005347 Bacteria 1735
47 Ga0070668_100707515 3300005347 Unclassified 889
48 Ga0070669_100327219 3300005353 Bacteria 1239
49 Ga0070669_101690418 3300005353 Unclassified 552
50 Ga0070675_100003712 3300005354 Bacteria 11603
51 Ga0070675_100009595 3300005354 Bacteria 7533
52 Ga0070675_100063293 3300005354 Bacteria 3058
53 Ga0070675_100333325 3300005354 Bacteria 1342
54 Ga0070675_100574665 3300005354 Bacteria 1021
55 Ga0070671_100214076 3300005355 Bacteria 1634
56 Ga0070671_100619828 3300005355 Bacteria 935
57 Ga0070674_100337668 3300005356 Unclassified 1213
58 Ga0070674_100523768 3300005356 Unclassified 991
59 Ga0070674_100653919 3300005356 Bacteria 894
60 Ga0070673_100003140 3300005364 Bacteria 10230
61 Ga0070673_100016374 3300005364 Bacteria 5240
62 Ga0070688_100007537 3300005365 Bacteria 5872
63 Ga0070688_100076237 3300005365 Bacteria 2157
64 Ga0070688_100615751 3300005365 Bacteria 833
65 Ga0070659_100000971 3300005366 Bacteria 21095
66 Ga0070667_100281625 3300005367 Bacteria 1493
67 Ga0070667_100697066 3300005367 Bacteria 939
68 Ga0070709_10335287 3300005434 Bacteria 1114
69 Ga0070714_100022318 3300005435 Bacteria 5190
70 Ga0070714_100050890 3300005435 Bacteria 3531
71 Ga0070714_100132998 3300005435 Bacteria 2224
72 Ga0070714_100754987 3300005435 Bacteria 940
73 Ga0070713_100115542 3300005436 Unclassified 2346
74 Ga0070713_100226852 3300005436 Bacteria 1696
75 Ga0070713_100508376 3300005436 Unclassified 1137
76 Ga0070713_100791398 3300005436 Unclassified 909
77 Ga0070710_10169400 3300005437 Unclassified 1360
78 Ga0070710_10290018 3300005437 Bacteria 1065
79 Ga0070711_100012799 3300005439 Bacteria 5254
80 Ga0070711_100020670 3300005439 Unclassified 4247
81 Ga0070711_100114073 3300005439 Bacteria 1988
82 Ga0070705_100035698 3300005440 Bacteria 2789
83 Ga0070705_100128756 3300005440 Bacteria 1648
84 Ga0070705_100146728 3300005440 Bacteria 1560
85 Ga0070705_100229032 3300005440 Bacteria 1292
86 Ga0070700_100039609 3300005441 Bacteria 2880
87 Ga0070694_100024137 3300005444 Bacteria 3922
88 Ga0070708_100047427 3300005445 Bacteria 3795
89 Ga0070708_100085529 3300005445 Bacteria 2862
90 Ga0070708_100090982 3300005445 Unclassified 2778
91 Ga0070708_100117242 3300005445 Unclassified 2452
92 Ga0070708_100251169 3300005445 Bacteria 1661
93 Ga0070708_100549179 3300005445 Unclassified 1090
94 Ga0070678_100195049 3300005456 Unclassified 1667
95 Ga0070662_100097269 3300005457 Bacteria 2222
96 Ga0070662_100131592 3300005457 Bacteria 1930
97 Ga0070662_100496470 3300005457 Bacteria 1017
98 Ga0070662_100897270 3300005457 Bacteria 756
99 Ga0070681_10047861 3300005458 Bacteria 4274
100 Ga0070685_10004903 3300005466 Bacteria 6769
101 Ga0070685_10067747 3300005466 Unclassified 2106
102 Ga0070706_100018474 3300005467 Bacteria 6428
103 Ga0070706_100042062 3300005467 Bacteria 4220
104 Ga0070706_100132337 3300005467 Bacteria 2328
105 Ga0070706_100306393 3300005467 Bacteria 1482
106 Ga0070706_100430716 3300005467 Bacteria 1228
107 Ga0070706_100881451 3300005467 Unclassified 827
108 Ga0070707_100039255 3300005468 Bacteria 4524
109 Ga0070707_100052961 3300005468 Bacteria 3891
110 Ga0070707_100162077 3300005468 Bacteria 2179
111 Ga0070707_100230858 3300005468 Unclassified 1801
112 Ga0070707_101540367 3300005468 Unclassified 632
113 Ga0070698_100028712 3300005471 Bacteria 5775
114 Ga0070698_100234901 3300005471 Bacteria 1766
115 Ga0070698_100258988 3300005471 Unclassified 1672
116 Ga0070699_100208581 3300005518 Bacteria 1739
117 Ga0070699_100242601 3300005518 Unclassified 1609
118 Ga0070699_100267075 3300005518 Bacteria 1531
119 Ga0070699_100731637 3300005518 Unclassified 904
120 Ga0070679_100043747 3300005530 Bacteria 4459
121 Ga0070684_100006663 3300005535 Bacteria 8952
122 Ga0070684_100041434 3300005535 Bacteria 3970
123 Ga0070684_100099186 3300005535 Unclassified 2599
124 Ga0070684_100144234 3300005535 Bacteria 2155
125 Ga0070684_100160218 3300005535 Bacteria 2041
126 Ga0070684_100399990 3300005535 Unclassified 1266
127 Ga0070697_100002917 3300005536 Bacteria 13156
128 Ga0070697_100012443 3300005536 Bacteria 6668
129 Ga0070697_100018284 3300005536 Bacteria 5524
130 Ga0070697_100019422 3300005536 Bacteria 5369
131 Ga0070697_100074750 3300005536 Bacteria 2784
132 Ga0070697_100383910 3300005536 Unclassified 1217
133 Ga0070697_100390410 3300005536 Unclassified 1207
134 Ga0070697_100412577 3300005536 Bacteria 1173
135 Ga0070697_100457155 3300005536 Bacteria 1113
136 Ga0070672_100495084 3300005543 Bacteria 1057
137 Ga0070665_100048215 3300005548 Bacteria 4277
138 Ga0070665_101206620 3300005548 Bacteria 767
139 Ga0070704_100002924 3300005549 Bacteria 9704
140 Ga0068855_101989899 3300005563 Bacteria 587
141 Ga0070664_100523318 3300005564 Bacteria 1095
142 Ga0070664_100596767 3300005564 Bacteria 1024
143 Ga0068856_100246292 3300005614 Bacteria 1802
144 Ga0068864_100578497 3300005618 Bacteria 1088
145 Ga0068861_100130976 3300005719 Bacteria 2036
146 Ga0068861_100907316 3300005719 Bacteria 835
147 Ga0068863_100003600 3300005841 Bacteria 15293
148 Ga0068858_100068419 3300005842 Bacteria 3291
149 Ga0068858_100320271 3300005842 Bacteria 1482
150 Ga0068860_100037757 3300005843 Bacteria 4622
151 Ga0081455_10001872 3300005937 Bacteria 25307
152 Ga0081455_10016809 3300005937 Bacteria 7039
153 Ga0081455_10016935 3300005937 Bacteria 7007
154 Ga0081455_10030722 3300005937 Bacteria 4875
155 Ga0081455_10044602 3300005937 Bacteria 3866
156 Ga0081455_10049102 3300005937 Unclassified 3640
157 Ga0081455_10134780 3300005937 Unclassified 1926
158 Ga0081455_10398506 3300005937 Bacteria 956
159 Ga0081540_1000036 3300005983 Bacteria 140805
160 Ga0081540_1034481 3300005983 Bacteria 2728
161 Ga0081539_10040243 3300005985 Bacteria 2746
162 Ga0070717_10093046 3300006028 Unclassified 2547
163 Ga0070717_10119455 3300006028 Bacteria 2256
164 Ga0070717_10150132 3300006028 Bacteria 2015
165 Ga0070717_10443304 3300006028 Bacteria 1169
166 Ga0070715_10047133 3300006163 Bacteria 1835
167 Ga0070715_10052209 3300006163 Bacteria 1762
168 Ga0070716_100016121 3300006173 Unclassified 3852
169 Ga0070716_100184230 3300006173 Bacteria 1374
170 Ga0070716_100261807 3300006173 Unclassified 1184
171 Ga0070712_100103973 3300006175 Unclassified 2106
172 Ga0070712_100122575 3300006175 Bacteria 1958
173 Ga0070712_100217983 3300006175 Bacteria 1509
174 Ga0070712_100289267 3300006175 Bacteria 1322
175 Ga0070712_100314383 3300006175 Unclassified 1272
176 Ga0070712_100393349 3300006175 Bacteria 1143
177 Ga0070712_100462086 3300006175 Bacteria 1059
178 Ga0070712_100660903 3300006175 Bacteria 889
179 Ga0070712_101030841 3300006175 Unclassified 713
180 Ga0097621_100195024 3300006237 Unclassified 1756
181 Ga0097621_101126170 3300006237 Bacteria 737
182 Ga0068871_100257457 3300006358 Unclassified 1521
183 Ga0068871_100363983 3300006358 Bacteria 1282
184 Ga0075428_100342689 3300006844 Bacteria 1605
185 Ga0075428_100766644 3300006844 Bacteria 1026
186 Ga0075433_10434038 3300006852 Bacteria 1158
187 Ga0075434_100206361 3300006871 Bacteria 1985
188 Ga0075434_100315267 3300006871 Bacteria 1584
189 Ga0068865_100307578 3300006881 Unclassified 1271
190 Ga0099794_10285779 3300007265 Bacteria 853
191 Ga0099794_10299269 3300007265 Unclassified 833
192 Ga0111539_10818175 3300009094 Unclassified 1084
193 Ga0111539_11255332 3300009094 Bacteria 860
194 Ga0105245_10442326 3300009098 Bacteria 1307
195 Ga0105245_11141640 3300009098 Bacteria 826
196 Ga0105245_11154743 3300009098 Unclassified 821
197 Ga0105245_11651040 3300009098 Bacteria 693
198 Ga0105247_10138968 3300009101 Bacteria 1590
199 Ga0105247_10593969 3300009101 Bacteria 820
200 Ga0114129_10007418 3300009147 Bacteria 15610
201 Ga0114129_10244078 3300009147 Bacteria 2413
202 Ga0114129_10265958 3300009147 Bacteria 2296
203 Ga0114129_10598948 3300009147 Unclassified 1428
204 Ga0105243_10127504 3300009148 Bacteria 2155
205 Ga0105241_10118065 3300009174 Bacteria 2132
206 Ga0105241_10872656 3300009174 Unclassified 834
207 Ga0105241_10893821 3300009174 Bacteria 824
208 Ga0105242_10368511 3300009176 Unclassified 1331
209 Ga0105248_11312752 3300009177 Bacteria 818
210 Ga0105249_10021762 3300009553 Bacteria 5741
211 Ga0105249_10122059 3300009553 Bacteria 2477
212 Ga0105249_10625246 3300009553 Unclassified 1133
213 Ga0099796_10029945 3300010159 Bacteria 1761
214 Ga0105239_10155992 3300010375 Bacteria 2549
215 Ga0105239_10217548 3300010375 Bacteria 2142
216 Ga0105239_10505219 3300010375 Bacteria 1375
217 Ga0105239_11481934 3300010375 Bacteria 784
218 Ga0105246_10408075 3300011119 Bacteria 1130
219 Ga0157371_10227161 3300013102 Bacteria 1341
220 Ga0157369_10607696 3300013105 Bacteria 1129
221 Ga0157374_10111000 3300013296 Bacteria 2637
222 Ga0157374_10383692 3300013296 Bacteria 1400
223 Ga0157374_10484372 3300013296 Bacteria 1240
224 Ga0157374_10688677 3300013296 Bacteria 1035
225 Ga0157374_11863618 3300013296 Unclassified 627
226 Ga0157378_10013099 3300013297 Bacteria 7254
227 Ga0157378_10023174 3300013297 Bacteria 5464
228 Ga0157378_10033296 3300013297 Unclassified 4555
229 Ga0157378_10366754 3300013297 Bacteria 1411
230 Ga0157378_10738567 3300013297 Bacteria 1006
231 Ga0157378_12411931 3300013297 Bacteria 578
232 Ga0157378_12419876 3300013297 Bacteria 577
233 Ga0163162_10224840 3300013306 Bacteria 2006
234 Ga0163162_10351894 3300013306 Unclassified 1606
235 Ga0163162_10444203 3300013306 Bacteria 1429
236 Ga0163162_10498761 3300013306 Bacteria 1348
237 Ga0163162_10718145 3300013306 Unclassified 1120
238 Ga0157372_10492839 3300013307 Unclassified 1429
239 Ga0157375_10115628 3300013308 Bacteria 2786
240 Ga0157375_10220135 3300013308 Bacteria 2056
241 Ga0157375_10488812 3300013308 Unclassified 1395
242 Ga0157375_10536949 3300013308 Unclassified 1332
243 Ga0157375_11879119 3300013308 Unclassified 711
244 Ga0163163_10119296 3300014325 Unclassified 2671
245 Ga0163163_10441232 3300014325 Bacteria 1361
246 Ga0163163_10550772 3300014325 Unclassified 1216
247 Ga0163163_10716924 3300014325 Unclassified 1064
248 Ga0182008_10064976 3300014497 Bacteria 1796
249 Ga0157377_10048614 3300014745 Bacteria 2381
250 Ga0157377_10603953 3300014745 Bacteria 783
251 Ga0157379_10100892 3300014968 Unclassified 2591
252 Ga0157379_11452792 3300014968 Bacteria 666
253 Ga0157376_10094594 3300014969 Bacteria 2597
254 Ga0157376_10135143 3300014969 Bacteria 2206
255 Ga0157376_10454591 3300014969 Bacteria 1250
256 Ga0157376_10689991 3300014969 Bacteria 1025
257 Ga0182006_1020264 3300015261 Bacteria 2787
258 Ga0163161_10203079 3300017792 Unclassified 1528
259 Ga0206355_1145327 3300020076 Unclassified 762
260 Ga0207666_1001627 3300025271 Unclassified 2662
261 Ga0207697_10001294 3300025315 Bacteria 13739
262 Ga0207697_10001403 3300025315 Bacteria 13181
263 Ga0207697_10012438 3300025315 Bacteria 3567
264 Ga0207697_10025316 3300025315 Unclassified 2426
265 Ga0207697_10034103 3300025315 Bacteria 2084
266 Ga0207697_10093717 3300025315 Bacteria 1274
267 Ga0207692_10606353 3300025898 Unclassified 704
268 Ga0207680_10257224 3300025903 Bacteria 1207
269 Ga0207647_10004861 3300025904 Bacteria 9931
270 Ga0207685_10022911 3300025905 Bacteria 2118
271 Ga0207685_10199033 3300025905 Bacteria 940
272 Ga0207699_10119319 3300025906 Unclassified 1703
273 Ga0207699_10367150 3300025906 Bacteria 1019
274 Ga0207699_10670631 3300025906 Bacteria 758
275 Ga0207645_10293934 3300025907 Bacteria 1081
276 Ga0207705_10348965 3300025909 Unclassified 1140
277 Ga0207684_10024895 3300025910 Bacteria 5100
278 Ga0207684_10104691 3300025910 Unclassified 2420
279 Ga0207684_10107589 3300025910 Bacteria 2386
280 Ga0207684_10149719 3300025910 Bacteria 2008
281 Ga0207684_10682131 3300025910 Unclassified 874
282 Ga0207684_10839176 3300025910 Unclassified 775
283 Ga0207654_10538338 3300025911 Bacteria 828
284 Ga0207693_10035674 3300025915 Bacteria 3921
285 Ga0207693_10063349 3300025915 Bacteria 2896
286 Ga0207693_10084225 3300025915 Unclassified 2491
287 Ga0207693_10100253 3300025915 Unclassified 2270
288 Ga0207693_10515591 3300025915 Unclassified 933
289 Ga0207663_10055206 3300025916 Bacteria 2491
290 Ga0207663_10077235 3300025916 Bacteria 2167
291 Ga0207663_10177341 3300025916 Bacteria 1519
292 Ga0207663_10237294 3300025916 Unclassified 1335
293 Ga0207663_10362952 3300025916 Bacteria 1099
294 Ga0207660_10022146 3300025917 Bacteria 4280
295 Ga0207662_10047832 3300025918 Bacteria 2533
296 Ga0207657_10100597 3300025919 Bacteria 2400
297 Ga0207649_10113401 3300025920 Bacteria 1815
298 Ga0207652_10068891 3300025921 Unclassified 3071
299 Ga0207652_10805224 3300025921 Bacteria 834
300 Ga0207646_10076725 3300025922 Bacteria 2987
301 Ga0207646_10113228 3300025922 Bacteria 2435
302 Ga0207646_10384124 3300025922 Unclassified 1268
303 Ga0207646_11420269 3300025922 Unclassified 603
304 Ga0207681_10624154 3300025923 Bacteria 892
305 Ga0207659_10003753 3300025926 Bacteria 9156
306 Ga0207659_10028169 3300025926 Bacteria 3815
307 Ga0207659_10633215 3300025926 Bacteria 913
308 Ga0207687_11049905 3300025927 Unclassified 699
309 Ga0207700_10039447 3300025928 Unclassified 3438
310 Ga0207700_10290012 3300025928 Bacteria 1410
311 Ga0207700_10412209 3300025928 Unclassified 1185
312 Ga0207700_11080412 3300025928 Bacteria 717
313 Ga0207664_10085388 3300025929 Bacteria 2576
314 Ga0207664_10121339 3300025929 Bacteria 2187
315 Ga0207644_10213289 3300025931 Bacteria 1527
316 Ga0207644_10475179 3300025931 Bacteria 1029
317 Ga0207690_10001481 3300025932 Bacteria 14676
318 Ga0207690_10905866 3300025932 Unclassified 732
319 Ga0207706_10162413 3300025933 Bacteria 1963
320 Ga0207706_10993595 3300025933 Bacteria 705
321 Ga0207686_10213234 3300025934 Bacteria 1389
322 Ga0207709_10305429 3300025935 Bacteria 1185
323 Ga0207670_10003100 3300025936 Bacteria 8793
324 Ga0207670_10097423 3300025936 Bacteria 2094
325 Ga0207665_10026896 3300025939 Unclassified 3800
326 Ga0207665_10318360 3300025939 Bacteria 1167
327 Ga0207691_10100551 3300025940 Unclassified 2581
328 Ga0207711_10496751 3300025941 Bacteria 1137
329 Ga0207679_10325844 3300025945 Bacteria 1332
330 Ga0207679_10525205 3300025945 Bacteria 1059
331 Ga0207651_10714929 3300025960 Bacteria 883
332 Ga0207712_10092201 3300025961 Bacteria 2233
333 Ga0207712_10163457 3300025961 Bacteria 1733
334 Ga0207668_10056103 3300025972 Bacteria 2742
335 Ga0207668_10527304 3300025972 Unclassified 1020
336 Ga0207668_11010348 3300025972 Bacteria 743
337 Ga0207658_10067376 3300025986 Bacteria 2696
338 Ga0207658_10490577 3300025986 Bacteria 1093
339 Ga0207677_10475463 3300026023 Bacteria 1075
340 Ga0207703_10009368 3300026035 Bacteria 7696
341 Ga0207703_10200678 3300026035 Bacteria 1772
342 Ga0207678_10001585 3300026067 Bacteria 20917
343 Ga0207708_10038619 3300026075 Bacteria 3637
344 Ga0207702_10128811 3300026078 Unclassified 2275
345 Ga0207641_10012427 3300026088 Bacteria 6981
346 Ga0207641_10084465 3300026088 Bacteria 2764
347 Ga0207676_10592417 3300026095 Bacteria 1064
348 Ga0207676_10633153 3300026095 Bacteria 1030
349 Ga0207675_100154766 3300026118 Bacteria 2184
350 Ga0207675_101637184 3300026118 Bacteria 664
351 Ga0207683_10221189 3300026121 Unclassified 1725
352 Ga0207698_11867719 3300026142 Unclassified 616
353 Ga0209981_1018057 3300027378 Bacteria 998
354 Ga0209984_1015919 3300027424 Unclassified 1002
355 Ga0209179_1020935 3300027512 Unclassified 1273
356 Ga0209588_1190886 3300027671 Bacteria 640
357 Ga0209974_10009094 3300027876 Bacteria 3377
358 Ga0268266_10053400 3300028379 Bacteria 3471
359 Ga0268266_10073310 3300028379 Bacteria 2971
360 Ga0268266_10669901 3300028379 Bacteria 999
361 Ga0268264_10016515 3300028381 Bacteria 6044
362 Ga0373944_0197817 3300035089 Bacteria 727
363 Ga0373936_0113169 3300035113 Bacteria 1154
364 Ga0373939_0297324 3300035114 Bacteria 643
365 Ga0373943_0080974 3300035170 Bacteria 1665
366 Ga0373943_0156850 3300035170 Bacteria 1236
367 Ga0373946_0040914 3300035171 Bacteria 1899
368 Ga0373946_0563645 3300035171 Unclassified 588
369 Ga0373955_0055517 3300035172 Bacteria 2170
370 Ga0373924_0131268 3300035410 Bacteria 1090
371 Ga0373931_0015102 3300035691 Bacteria 3785
372 Ga0373935_0018819 3300035692 Bacteria 4208
373 Ga0373935_0173486 3300035692 Bacteria 1476
374 Ga0373935_0262282 3300035692 Bacteria 1212
375 Ga0373927_0071472 3300035695 Bacteria 2246
376 Ga0373927_0076041 3300035695 Bacteria 2175
377 Ga0373933_0082536 3300035724 Unclassified 1973
378 Ga0373947_0028673 3300035725 Bacteria 3265
379 Ga0373947_0500425 3300035725 Bacteria 826
380 Ga0373947_0665902 3300035725 Bacteria 710
381 Ga0373937_0280144 3300036401 Bacteria 1574
382 Ga0373937_0975960 3300036401 Bacteria 796
383 Ga0373925_0010936 3300037068 Bacteria 6588
384 Ga0373925_0429049 3300037068 Bacteria 1081
385 Ga0373925_0525067 3300037068 Bacteria 973
386 Ga0373925_0590631 3300037068 Bacteria 914
387 Ga0395899_0202269 3300037312 Bacteria 1384
388 Ga0395900_0090143 3300037418 Bacteria 3152
389 Ga0395900_0537342 3300037418 Bacteria 1115
390 Ga0395898_0032973 3300037466 Bacteria 5170
391 Ga0395905_0346200 3300037471 Bacteria 1378
392 Ga0395905_0390710 3300037471 Unclassified 1286
393 Ga0395905_0626917 3300037471 Bacteria 977
394 Ga0395905_1757195 3300037471 Bacteria 526
395 Ga0395901_0001548 3300038443 Bacteria 23830
396 Ga0395901_0089180 3300038443 Bacteria 3227
397 Ga0395901_0378666 3300038443 Bacteria 1457
398 Ga0395901_0842928 3300038443 Unclassified 903
399 Ga0451835_0663666 3300041492 Unclassified 564
400 Ga0451853_0577735 3300041512 Bacteria 2215
401 Ga0439448_0018515 3300042005 Bacteria 2136
402 Ga0439455_0000520 3300042012 Bacteria 5374
403 Ga0439458_0014766 3300042157 Unclassified 1765
404 Ga0439464_0017248 3300042439 Unclassified 1957
405 Ga0495603_0356439 3300046455 Bacteria 839
406 Ga0495651_0538991 3300046462 Bacteria 743
407 Ga0495664_0119843 3300046477 Bacteria 1592
408 Ga0495594_0328732 3300046499 Bacteria 871
409 Ga0495608_0241548 3300046511 Bacteria 1128
410 Ga0495630_0142315 3300046517 Bacteria 1824
411 Ga0495630_0415061 3300046517 Bacteria 1031
412 Ga0495666_0085500 3300046526 Bacteria 1490
413 Ga0495652_0388810 3300046529 Bacteria 990
414 Ga0495665_0280518 3300046531 Bacteria 855
415 Ga0495640_0272038 3300046533 Unclassified 1056
416 Ga0495640_0589443 3300046533 Bacteria 672
417 Ga0495586_0166149 3300046535 Bacteria 1246
418 Ga0495587_0165475 3300046536 Bacteria 1257
419 Ga0495587_0348335 3300046536 Unclassified 826
420 Ga0495645_0006709 3300046543 Bacteria 7998
421 Ga0495634_0029418 3300046642 Bacteria 3803
422 Ga0495634_0143867 3300046642 Bacteria 1512
423 Ga0495657_0193567 3300046675 Bacteria 1242
424 Ga0495599_0002744 3300046678 Bacteria 10272
425 Ga0495623_0042456 3300046679 Bacteria 2896
426 Ga0495646_0036436 3300046680 Bacteria 3047
427 Ga0495647_0076865 3300046681 Bacteria 1347
428 Ga0495658_0308605 3300046683 Bacteria 1001
429 Ga0495669_0074203 3300046684 Bacteria 1555
430 Ga0495600_0227156 3300046809 Bacteria 1193
431 Ga0495604_0414233 3300047317 Bacteria 885
432 Ga0495674_0278005 3300047319 Bacteria 1372
433 Ga0495684_0010873 3300047471 Bacteria 7037
434 Ga0495602_0571903 3300048088 Bacteria 780
435 Ga0495614_0310439 3300048089 Bacteria 730
436 Ga0496101_0124446 3300048904 Bacteria 1953
437 Ga0496101_0254864 3300048904 Bacteria 1368
438 Ga0496102_0097697 3300048905 Bacteria 2724
439 Ga0496102_0159621 3300048905 Bacteria 2120
440 Ga0496102_0449645 3300048905 Bacteria 1209
441 Ga0496104_0065707 3300048907 Bacteria 3443
442 Ga0496104_0729065 3300048907 Bacteria 899
443 Ga0496104_0734994 3300048907 Bacteria 894
444 Ga0496104_1371686 3300048907 Unclassified 610
445 Ga0496105_0087870 3300048908 Bacteria 2568
446 Ga0496105_0142286 3300048908 Bacteria 1974
447 Ga0496106_0298970 3300048909 Bacteria 1291
448 Ga0496106_1031804 3300048909 Bacteria 646
449 Ga0496107_0158825 3300048910 Bacteria 1675
450 Ga0496107_0529096 3300048910 Unclassified 874
451 Ga0496109_0005026 3300048912 Bacteria 11049
452 Ga0496109_0829889 3300048912 Unclassified 862
453 Ga0496110_0173027 3300048913 Bacteria 1959
454 Ga0496110_0697704 3300048913 Bacteria 916
455 Ga0496111_0216760 3300048914 Unclassified 1422
456 Ga0496111_0251184 3300048914 Unclassified 1313
457 Ga0496111_0340997 3300048914 Bacteria 1109
458 Ga0496112_0034027 3300048915 Bacteria 4958
459 Ga0496112_0096332 3300048915 Unclassified 2929
460 Ga0496112_0743742 3300048915 Unclassified 907
461 Ga0496113_0044056 3300048916 Bacteria 3304
462 Ga0496113_0152026 3300048916 Unclassified 1827
463 Ga0496114_0018012 3300048917 Bacteria 5706
464 Ga0496114_0089371 3300048917 Bacteria 2614
465 Ga0496115_0098738 3300048918 Unclassified 2392
466 Ga0496115_0208927 3300048918 Bacteria 1612
467 Ga0496115_0224807 3300048918 Unclassified 1549
468 Ga0496115_0435005 3300048918 Bacteria 1061
469 Ga0496115_1144098 3300048918 Bacteria 588
470 Ga0501067_0705979 3300049583 Unclassified 567
471 Ga0501069_0784859 3300049585 Unclassified 577
472 nmdc:mga05p37_1054801_c1 3300050507 Bacteria 857
473 nmdc:mga05p37_4003_c1 3300050507 Bacteria 17226
474 nmdc:mga0n895_386381_c1 3300050512 Bacteria 1416
475 nmdc:mga0n895_830702_c1 3300050512 Bacteria 913
476 nmdc:mga0a205_331162_c1 3300050515 Bacteria 1392
477 nmdc:mga0a205_414541_c1 3300050515 Bacteria 1209
478 Ga0495595_0544707 3300053084 Bacteria 592
479 Ga0495619_0128112 3300053085 Bacteria 1743
480 Ga0495619_0500322 3300053085 Bacteria 836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_1757195 Ga0395905_1757195_43_480 145
2 3300025910 Ga0207684_10839176 Ga0207684_108391762 146
3 3300049583 Ga0501067_0705979 Ga0501067_0705979_10_528 146
4 3300037068 Ga0373925_0525067 Ga0373925_0525067_80_604 154
5 3300042005 Ga0439448_0018515 Ga0439448_0018515_821_1345 156
6 3300005289 Ga0065704_10091739 Ga0065704_100917394 157
7 3300005983 Ga0081540_1034481 Ga0081540_10344813 157
8 3300006871 Ga0075434_100206361 Ga0075434_1002063612 157
9 3300050512 nmdc:mga0n895_830702_c1 nmdc:mga0n895_830702_c1_190_714 157
10 3300005347 Ga0070668_100031417 Ga0070668_1000314173 158
11 3300005353 Ga0070669_101690418 Ga0070669_1016904181 158
12 3300010375 Ga0105239_11481934 Ga0105239_114819342 158
13 3300013297 Ga0157378_10013099 Ga0157378_100130992 158
14 3300014968 Ga0157379_11452792 Ga0157379_114527921 158
15 3300025923 Ga0207681_10624154 Ga0207681_106241542 158
16 3300025933 Ga0207706_10993595 Ga0207706_109935951 158
17 3300025972 Ga0207668_11010348 Ga0207668_110103482 158
18 3300048905 Ga0496102_0097697 Ga0496102_0097697_1061_1552 161
19 3300048909 Ga0496106_1031804 Ga0496106_1031804_88_612 161
20 3300006173 Ga0070716_100261807 Ga0070716_1002618072 164
21 3300013306 Ga0163162_10498761 Ga0163162_104987612 165
22 3300025931 Ga0207644_10475179 Ga0207644_104751792 165
23 3300005290 Ga0065712_10026984 Ga0065712_100269841 168
24 3300005356 Ga0070674_100653919 Ga0070674_1006539192 168
25 3300005435 Ga0070714_100050890 Ga0070714_1000508904 168
26 3300005445 Ga0070708_100090982 Ga0070708_1000909822 168
27 3300005468 Ga0070707_100230858 Ga0070707_1002308583 168
28 3300005471 Ga0070698_100234901 Ga0070698_1002349012 168
29 3300005518 Ga0070699_100731637 Ga0070699_1007316372 168
30 3300005536 Ga0070697_100383910 Ga0070697_1003839102 168
31 3300006175 Ga0070712_100314383 Ga0070712_1003143832 168
32 3300013297 Ga0157378_10023174 Ga0157378_100231743 168
33 3300025910 Ga0207684_10024895 Ga0207684_100248953 168
34 3300025929 Ga0207664_10085388 Ga0207664_100853883 168
35 3300005290 Ga0065712_10180216 Ga0065712_101802162 169
36 3300005467 Ga0070706_100306393 Ga0070706_1003063932 169
37 3300005518 Ga0070699_100208581 Ga0070699_1002085813 169
38 3300006028 Ga0070717_10119455 Ga0070717_101194553 169
39 3300006175 Ga0070712_100217983 Ga0070712_1002179833 169
40 3300009147 Ga0114129_10244078 Ga0114129_102440783 169
41 3300013102 Ga0157371_10227161 Ga0157371_102271613 169
42 3300013308 Ga0157375_11879119 Ga0157375_118791191 169
43 3300035113 Ga0373936_0113169 Ga0373936_0113169_492_1001 169
44 3300035171 Ga0373946_0040914 Ga0373946_0040914_1329_1838 169
45 3300035410 Ga0373924_0131268 Ga0373924_0131268_344_853 169
46 3300035692 Ga0373935_0173486 Ga0373935_0173486_163_672 169
47 3300035695 Ga0373927_0071472 Ga0373927_0071472_1703_2212 169
48 3300035725 Ga0373947_0028673 Ga0373947_0028673_47_556 169
49 3300035725 Ga0373947_0500425 Ga0373947_0500425_95_610 169
50 3300037068 Ga0373925_0010936 Ga0373925_0010936_3103_3612 169
51 3300048912 Ga0496109_0829889 Ga0496109_0829889_288_800 169
52 3300048914 Ga0496111_0216760 Ga0496111_0216760_64_576 169
53 3300005536 Ga0070697_100019422 Ga0070697_1000194225 170
54 3300006175 Ga0070712_101030841 Ga0070712_1010308411 170
55 3300013296 Ga0157374_10111000 Ga0157374_101110003 170
56 3300020076 Ga0206355_1145327 Ga0206355_11453272 170
57 3300025915 Ga0207693_10515591 Ga0207693_105155912 170
58 3300035171 Ga0373946_0563645 Ga0373946_0563645_64_576 170
59 3300035692 Ga0373935_0262282 Ga0373935_0262282_491_1003 170
60 3300035695 Ga0373927_0076041 Ga0373927_0076041_933_1445 170
61 3300037068 Ga0373925_0429049 Ga0373925_0429049_276_788 170
62 3300041492 Ga0451835_0663666 Ga0451835_0663666_11_529 170
63 3300003911 JGI25405J52794_10000412 JGI25405J52794_100004123 171
64 3300005356 Ga0070674_100523768 Ga0070674_1005237682 171
65 3300005434 Ga0070709_10335287 Ga0070709_103352872 171
66 3300005435 Ga0070714_100132998 Ga0070714_1001329982 171
67 3300005436 Ga0070713_100508376 Ga0070713_1005083762 171
68 3300005467 Ga0070706_100430716 Ga0070706_1004307162 171
69 3300005468 Ga0070707_101540367 Ga0070707_1015403671 171
70 3300005518 Ga0070699_100267075 Ga0070699_1002670752 171
71 3300005536 Ga0070697_100390410 Ga0070697_1003904102 171
72 3300005937 Ga0081455_10001872 Ga0081455_1000187212 171
73 3300006175 Ga0070712_100103973 Ga0070712_1001039733 171
74 3300006175 Ga0070712_100289267 Ga0070712_1002892672 171
75 3300006358 Ga0068871_100363983 Ga0068871_1003639832 171
76 3300006844 Ga0075428_100766644 Ga0075428_1007666442 171
77 3300009147 Ga0114129_10007418 Ga0114129_100074187 171
78 3300013296 Ga0157374_11863618 Ga0157374_118636182 171
79 3300013297 Ga0157378_10366754 Ga0157378_103667542 171
80 3300025905 Ga0207685_10199033 Ga0207685_101990332 171
81 3300025906 Ga0207699_10670631 Ga0207699_106706311 171
82 3300025916 Ga0207663_10177341 Ga0207663_101773413 171
83 3300025922 Ga0207646_11420269 Ga0207646_114202692 171
84 3300025928 Ga0207700_10412209 Ga0207700_104122093 171
85 3300025928 Ga0207700_11080412 Ga0207700_110804122 171
86 3300025929 Ga0207664_10121339 Ga0207664_101213393 171
87 3300035691 Ga0373931_0015102 Ga0373931_0015102_2887_3405 171
88 3300037312 Ga0395899_0202269 Ga0395899_0202269_736_1251 171
89 3300037418 Ga0395900_0537342 Ga0395900_0537342_540_1055 171
90 3300037466 Ga0395898_0032973 Ga0395898_0032973_1614_2129 171
91 3300037471 Ga0395905_0626917 Ga0395905_0626917_394_909 171
92 3300038443 Ga0395901_0001548 Ga0395901_0001548_6252_6767 171
93 3300038443 Ga0395901_0089180 Ga0395901_0089180_140_655 171
94 3300049585 Ga0501069_0784859 Ga0501069_0784859_29_550 171
95 3300050507 nmdc:mga05p37_4003_c1 nmdc:mga05p37_4003_c1_5887_6402 171
96 3300050515 nmdc:mga0a205_331162_c1 nmdc:mga0a205_331162_c1_742_1257 171
97 2162886007 SwRhRL2b_contig_2070193 SwRhRL2b_0265.00006740 172
98 3300001990 JGI24737J22298_10012645 JGI24737J22298_100126453 172
99 3300002126 JGI24035J26624_1000141 JGI24035J26624_10001413 172
100 3300002126 JGI24035J26624_1003257 JGI24035J26624_10032572 172
101 3300003659 JGI25404J52841_10004829 JGI25404J52841_100048293 172
102 3300003911 JGI25405J52794_10002813 JGI25405J52794_100028133 172
103 3300003911 JGI25405J52794_10024888 JGI25405J52794_100248882 172
104 3300005288 Ga0065714_10094929 Ga0065714_100949292 172
105 3300005289 Ga0065704_10004850 Ga0065704_100048503 172
106 3300005289 Ga0065704_10027173 Ga0065704_100271732 172
107 3300005289 Ga0065704_10073950 Ga0065704_100739503 172
108 3300005289 Ga0065704_10438568 Ga0065704_104385681 172
109 3300005290 Ga0065712_10001692 Ga0065712_100016925 172
110 3300005290 Ga0065712_10004664 Ga0065712_100046643 172
111 3300005290 Ga0065712_10016478 Ga0065712_100164781 172
112 3300005290 Ga0065712_10019107 Ga0065712_100191072 172
113 3300005290 Ga0065712_10116148 Ga0065712_101161482 172
114 3300005293 Ga0065715_10001727 Ga0065715_100017273 172
115 3300005293 Ga0065715_10089933 Ga0065715_100899334 172
116 3300005293 Ga0065715_10119901 Ga0065715_101199013 172
117 3300005293 Ga0065715_10167516 Ga0065715_101675162 172
118 3300005293 Ga0065715_10174334 Ga0065715_101743342 172
119 3300005293 Ga0065715_10340754 Ga0065715_103407542 172
120 3300005295 Ga0065707_10013106 Ga0065707_100131062 172
121 3300005295 Ga0065707_10024750 Ga0065707_100247502 172
122 3300005295 Ga0065707_10118992 Ga0065707_101189923 172
123 3300005327 Ga0070658_10136660 Ga0070658_101366602 172
124 3300005328 Ga0070676_10494148 Ga0070676_104941482 172
125 3300005329 Ga0070683_100041590 Ga0070683_1000415903 172
126 3300005329 Ga0070683_100114079 Ga0070683_1001140793 172
127 3300005330 Ga0070690_100070824 Ga0070690_1000708243 172
128 3300005335 Ga0070666_10223058 Ga0070666_102230582 172
129 3300005336 Ga0070680_100026698 Ga0070680_1000266983 172
130 3300005336 Ga0070680_100905527 Ga0070680_1009055272 172
131 3300005339 Ga0070660_100319905 Ga0070660_1003199052 172
132 3300005340 Ga0070689_100000978 Ga0070689_10000097813 172
133 3300005340 Ga0070689_100128485 Ga0070689_1001284852 172
134 3300005343 Ga0070687_100068392 Ga0070687_1000683922 172
135 3300005344 Ga0070661_100192774 Ga0070661_1001927742 172
136 3300005345 Ga0070692_10116733 Ga0070692_101167332 172
137 3300005347 Ga0070668_100178032 Ga0070668_1001780323 172
138 3300005347 Ga0070668_100707515 Ga0070668_1007075151 172
139 3300005353 Ga0070669_100327219 Ga0070669_1003272192 172
140 3300005354 Ga0070675_100003712 Ga0070675_1000037123 172
141 3300005354 Ga0070675_100009595 Ga0070675_1000095955 172
142 3300005354 Ga0070675_100063293 Ga0070675_1000632931 172
143 3300005354 Ga0070675_100333325 Ga0070675_1003333252 172
144 3300005354 Ga0070675_100574665 Ga0070675_1005746651 172
145 3300005355 Ga0070671_100214076 Ga0070671_1002140763 172
146 3300005355 Ga0070671_100619828 Ga0070671_1006198282 172
147 3300005356 Ga0070674_100337668 Ga0070674_1003376682 172
148 3300005364 Ga0070673_100003140 Ga0070673_1000031402 172
149 3300005364 Ga0070673_100016374 Ga0070673_1000163745 172
150 3300005365 Ga0070688_100007537 Ga0070688_1000075373 172
151 3300005365 Ga0070688_100076237 Ga0070688_1000762372 172
152 3300005365 Ga0070688_100615751 Ga0070688_1006157511 172
153 3300005366 Ga0070659_100000971 Ga0070659_1000009719 172
154 3300005367 Ga0070667_100281625 Ga0070667_1002816252 172
155 3300005367 Ga0070667_100697066 Ga0070667_1006970662 172
156 3300005435 Ga0070714_100022318 Ga0070714_1000223182 172
157 3300005435 Ga0070714_100754987 Ga0070714_1007549872 172
158 3300005436 Ga0070713_100115542 Ga0070713_1001155422 172
159 3300005436 Ga0070713_100226852 Ga0070713_1002268523 172
160 3300005436 Ga0070713_100791398 Ga0070713_1007913982 172
161 3300005437 Ga0070710_10169400 Ga0070710_101694003 172
162 3300005437 Ga0070710_10290018 Ga0070710_102900182 172
163 3300005439 Ga0070711_100012799 Ga0070711_1000127994 172
164 3300005439 Ga0070711_100020670 Ga0070711_1000206703 172
165 3300005439 Ga0070711_100114073 Ga0070711_1001140731 172
166 3300005440 Ga0070705_100035698 Ga0070705_1000356982 172
167 3300005440 Ga0070705_100128756 Ga0070705_1001287561 172
168 3300005440 Ga0070705_100146728 Ga0070705_1001467282 172
169 3300005440 Ga0070705_100229032 Ga0070705_1002290322 172
170 3300005441 Ga0070700_100039609 Ga0070700_1000396093 172
171 3300005444 Ga0070694_100024137 Ga0070694_1000241373 172
172 3300005445 Ga0070708_100047427 Ga0070708_1000474274 172
173 3300005445 Ga0070708_100085529 Ga0070708_1000855294 172
174 3300005445 Ga0070708_100117242 Ga0070708_1001172422 172
175 3300005445 Ga0070708_100251169 Ga0070708_1002511692 172
176 3300005445 Ga0070708_100549179 Ga0070708_1005491791 172
177 3300005456 Ga0070678_100195049 Ga0070678_1001950492 172
178 3300005457 Ga0070662_100097269 Ga0070662_1000972692 172
179 3300005457 Ga0070662_100131592 Ga0070662_1001315922 172
180 3300005457 Ga0070662_100496470 Ga0070662_1004964702 172
181 3300005457 Ga0070662_100897270 Ga0070662_1008972702 172
182 3300005458 Ga0070681_10047861 Ga0070681_100478612 172
183 3300005466 Ga0070685_10004903 Ga0070685_100049032 172
184 3300005466 Ga0070685_10067747 Ga0070685_100677473 172
185 3300005467 Ga0070706_100018474 Ga0070706_1000184746 172
186 3300005467 Ga0070706_100042062 Ga0070706_1000420622 172
187 3300005467 Ga0070706_100132337 Ga0070706_1001323372 172
188 3300005467 Ga0070706_100881451 Ga0070706_1008814511 172
189 3300005468 Ga0070707_100039255 Ga0070707_1000392554 172
190 3300005468 Ga0070707_100052961 Ga0070707_1000529613 172
191 3300005468 Ga0070707_100162077 Ga0070707_1001620772 172
192 3300005471 Ga0070698_100028712 Ga0070698_1000287122 172
193 3300005471 Ga0070698_100258988 Ga0070698_1002589882 172
194 3300005518 Ga0070699_100242601 Ga0070699_1002426012 172
195 3300005530 Ga0070679_100043747 Ga0070679_1000437472 172
196 3300005535 Ga0070684_100006663 Ga0070684_1000066635 172
197 3300005535 Ga0070684_100041434 Ga0070684_1000414344 172
198 3300005535 Ga0070684_100099186 Ga0070684_1000991863 172
199 3300005535 Ga0070684_100144234 Ga0070684_1001442341 172
200 3300005535 Ga0070684_100160218 Ga0070684_1001602182 172
201 3300005535 Ga0070684_100399990 Ga0070684_1003999902 172
202 3300005536 Ga0070697_100002917 Ga0070697_1000029176 172
203 3300005536 Ga0070697_100012443 Ga0070697_1000124433 172
204 3300005536 Ga0070697_100018284 Ga0070697_1000182847 172
205 3300005536 Ga0070697_100074750 Ga0070697_1000747501 172
206 3300005536 Ga0070697_100412577 Ga0070697_1004125772 172
207 3300005536 Ga0070697_100457155 Ga0070697_1004571552 172
208 3300005543 Ga0070672_100495084 Ga0070672_1004950842 172
209 3300005548 Ga0070665_100048215 Ga0070665_1000482153 172
210 3300005548 Ga0070665_101206620 Ga0070665_1012066202 172
211 3300005549 Ga0070704_100002924 Ga0070704_1000029245 172
212 3300005563 Ga0068855_101989899 Ga0068855_1019898991 172
213 3300005564 Ga0070664_100523318 Ga0070664_1005233181 172
214 3300005564 Ga0070664_100596767 Ga0070664_1005967672 172
215 3300005614 Ga0068856_100246292 Ga0068856_1002462921 172
216 3300005618 Ga0068864_100578497 Ga0068864_1005784972 172
217 3300005719 Ga0068861_100130976 Ga0068861_1001309762 172
218 3300005719 Ga0068861_100907316 Ga0068861_1009073161 172
219 3300005841 Ga0068863_100003600 Ga0068863_1000036007 172
220 3300005842 Ga0068858_100068419 Ga0068858_1000684193 172
221 3300005842 Ga0068858_100320271 Ga0068858_1003202713 172
222 3300005843 Ga0068860_100037757 Ga0068860_1000377573 172
223 3300005937 Ga0081455_10016809 Ga0081455_100168097 172
224 3300005937 Ga0081455_10016935 Ga0081455_100169353 172
225 3300005937 Ga0081455_10030722 Ga0081455_100307222 172
226 3300005937 Ga0081455_10044602 Ga0081455_100446023 172
227 3300005937 Ga0081455_10049102 Ga0081455_100491026 172
228 3300005937 Ga0081455_10134780 Ga0081455_101347803 172
229 3300005937 Ga0081455_10398506 Ga0081455_103985062 172
230 3300005983 Ga0081540_1000036 Ga0081540_100003692 172
231 3300005985 Ga0081539_10040243 Ga0081539_100402432 172
232 3300006028 Ga0070717_10093046 Ga0070717_100930464 172
233 3300006028 Ga0070717_10150132 Ga0070717_101501323 172
234 3300006028 Ga0070717_10443304 Ga0070717_104433042 172
235 3300006163 Ga0070715_10047133 Ga0070715_100471333 172
236 3300006163 Ga0070715_10052209 Ga0070715_100522093 172
237 3300006173 Ga0070716_100016121 Ga0070716_1000161213 172
238 3300006173 Ga0070716_100184230 Ga0070716_1001842302 172
239 3300006175 Ga0070712_100122575 Ga0070712_1001225753 172
240 3300006175 Ga0070712_100393349 Ga0070712_1003933492 172
241 3300006175 Ga0070712_100462086 Ga0070712_1004620862 172
242 3300006175 Ga0070712_100660903 Ga0070712_1006609032 172
243 3300006237 Ga0097621_100195024 Ga0097621_1001950243 172
244 3300006237 Ga0097621_101126170 Ga0097621_1011261701 172
245 3300006358 Ga0068871_100257457 Ga0068871_1002574572 172
246 3300006844 Ga0075428_100342689 Ga0075428_1003426892 172
247 3300006852 Ga0075433_10434038 Ga0075433_104340382 172
248 3300006871 Ga0075434_100315267 Ga0075434_1003152672 172
249 3300006881 Ga0068865_100307578 Ga0068865_1003075782 172
250 3300007265 Ga0099794_10285779 Ga0099794_102857792 172
251 3300007265 Ga0099794_10299269 Ga0099794_102992692 172
252 3300009094 Ga0111539_10818175 Ga0111539_108181752 172
253 3300009094 Ga0111539_11255332 Ga0111539_112553322 172
254 3300009098 Ga0105245_10442326 Ga0105245_104423262 172
255 3300009098 Ga0105245_11141640 Ga0105245_111416402 172
256 3300009098 Ga0105245_11154743 Ga0105245_111547432 172
257 3300009098 Ga0105245_11651040 Ga0105245_116510401 172
258 3300009101 Ga0105247_10138968 Ga0105247_101389683 172
259 3300009101 Ga0105247_10593969 Ga0105247_105939691 172
260 3300009147 Ga0114129_10265958 Ga0114129_102659583 172
261 3300009147 Ga0114129_10598948 Ga0114129_105989483 172
262 3300009148 Ga0105243_10127504 Ga0105243_101275044 172
263 3300009174 Ga0105241_10118065 Ga0105241_101180652 172
264 3300009174 Ga0105241_10872656 Ga0105241_108726561 172
265 3300009174 Ga0105241_10893821 Ga0105241_108938212 172
266 3300009176 Ga0105242_10368511 Ga0105242_103685112 172
267 3300009177 Ga0105248_11312752 Ga0105248_113127522 172
268 3300009553 Ga0105249_10021762 Ga0105249_100217622 172
269 3300009553 Ga0105249_10122059 Ga0105249_101220592 172
270 3300009553 Ga0105249_10625246 Ga0105249_106252461 172
271 3300010159 Ga0099796_10029945 Ga0099796_100299451 172
272 3300010375 Ga0105239_10155992 Ga0105239_101559923 172
273 3300010375 Ga0105239_10217548 Ga0105239_102175483 172
274 3300010375 Ga0105239_10505219 Ga0105239_105052192 172
275 3300011119 Ga0105246_10408075 Ga0105246_104080752 172
276 3300013105 Ga0157369_10607696 Ga0157369_106076962 172
277 3300013296 Ga0157374_10383692 Ga0157374_103836921 172
278 3300013296 Ga0157374_10484372 Ga0157374_104843722 172
279 3300013296 Ga0157374_10688677 Ga0157374_106886772 172
280 3300013297 Ga0157378_10033296 Ga0157378_100332967 172
281 3300013297 Ga0157378_10738567 Ga0157378_107385671 172
282 3300013297 Ga0157378_12411931 Ga0157378_124119311 172
283 3300013297 Ga0157378_12419876 Ga0157378_124198761 172
284 3300013306 Ga0163162_10224840 Ga0163162_102248402 172
285 3300013306 Ga0163162_10351894 Ga0163162_103518942 172
286 3300013306 Ga0163162_10444203 Ga0163162_104442032 172
287 3300013306 Ga0163162_10718145 Ga0163162_107181452 172
288 3300013307 Ga0157372_10492839 Ga0157372_104928391 172
289 3300013308 Ga0157375_10115628 Ga0157375_101156283 172
290 3300013308 Ga0157375_10220135 Ga0157375_102201353 172
291 3300013308 Ga0157375_10488812 Ga0157375_104888122 172
292 3300013308 Ga0157375_10536949 Ga0157375_105369493 172
293 3300014325 Ga0163163_10119296 Ga0163163_101192962 172
294 3300014325 Ga0163163_10441232 Ga0163163_104412322 172
295 3300014325 Ga0163163_10550772 Ga0163163_105507722 172
296 3300014325 Ga0163163_10716924 Ga0163163_107169241 172
297 3300014497 Ga0182008_10064976 Ga0182008_100649763 172
298 3300014745 Ga0157377_10048614 Ga0157377_100486142 172
299 3300014745 Ga0157377_10603953 Ga0157377_106039531 172
300 3300014968 Ga0157379_10100892 Ga0157379_101008922 172
301 3300014969 Ga0157376_10094594 Ga0157376_100945943 172
302 3300014969 Ga0157376_10135143 Ga0157376_101351433 172
303 3300014969 Ga0157376_10454591 Ga0157376_104545912 172
304 3300014969 Ga0157376_10689991 Ga0157376_106899911 172
305 3300015261 Ga0182006_1020264 Ga0182006_10202643 172
306 3300017792 Ga0163161_10203079 Ga0163161_102030792 172
307 3300025271 Ga0207666_1001627 Ga0207666_10016273 172
308 3300025315 Ga0207697_10001294 Ga0207697_1000129413 172
309 3300025315 Ga0207697_10001403 Ga0207697_100014039 172
310 3300025315 Ga0207697_10012438 Ga0207697_100124383 172
311 3300025315 Ga0207697_10025316 Ga0207697_100253162 172
312 3300025315 Ga0207697_10034103 Ga0207697_100341033 172
313 3300025315 Ga0207697_10093717 Ga0207697_100937172 172
314 3300025898 Ga0207692_10606353 Ga0207692_106063531 172
315 3300025903 Ga0207680_10257224 Ga0207680_102572242 172
316 3300025904 Ga0207647_10004861 Ga0207647_1000486112 172
317 3300025905 Ga0207685_10022911 Ga0207685_100229112 172
318 3300025906 Ga0207699_10119319 Ga0207699_101193193 172
319 3300025906 Ga0207699_10367150 Ga0207699_103671502 172
320 3300025907 Ga0207645_10293934 Ga0207645_102939342 172
321 3300025909 Ga0207705_10348965 Ga0207705_103489652 172
322 3300025910 Ga0207684_10104691 Ga0207684_101046913 172
323 3300025910 Ga0207684_10107589 Ga0207684_101075893 172
324 3300025910 Ga0207684_10149719 Ga0207684_101497192 172
325 3300025910 Ga0207684_10682131 Ga0207684_106821312 172
326 3300025911 Ga0207654_10538338 Ga0207654_105383382 172
327 3300025915 Ga0207693_10035674 Ga0207693_100356743 172
328 3300025915 Ga0207693_10063349 Ga0207693_100633493 172
329 3300025915 Ga0207693_10084225 Ga0207693_100842253 172
330 3300025915 Ga0207693_10100253 Ga0207693_101002532 172
331 3300025916 Ga0207663_10055206 Ga0207663_100552063 172
332 3300025916 Ga0207663_10077235 Ga0207663_100772352 172
333 3300025916 Ga0207663_10237294 Ga0207663_102372942 172
334 3300025916 Ga0207663_10362952 Ga0207663_103629522 172
335 3300025917 Ga0207660_10022146 Ga0207660_100221463 172
336 3300025918 Ga0207662_10047832 Ga0207662_100478321 172
337 3300025919 Ga0207657_10100597 Ga0207657_101005972 172
338 3300025920 Ga0207649_10113401 Ga0207649_101134013 172
339 3300025921 Ga0207652_10068891 Ga0207652_100688912 172
340 3300025921 Ga0207652_10805224 Ga0207652_108052242 172
341 3300025922 Ga0207646_10076725 Ga0207646_100767253 172
342 3300025922 Ga0207646_10113228 Ga0207646_101132282 172
343 3300025922 Ga0207646_10384124 Ga0207646_103841242 172
344 3300025926 Ga0207659_10003753 Ga0207659_100037539 172
345 3300025926 Ga0207659_10028169 Ga0207659_100281694 172
346 3300025926 Ga0207659_10633215 Ga0207659_106332152 172
347 3300025927 Ga0207687_11049905 Ga0207687_110499051 172
348 3300025928 Ga0207700_10039447 Ga0207700_100394472 172
349 3300025928 Ga0207700_10290012 Ga0207700_102900123 172
350 3300025931 Ga0207644_10213289 Ga0207644_102132892 172
351 3300025932 Ga0207690_10001481 Ga0207690_100014819 172
352 3300025932 Ga0207690_10905866 Ga0207690_109058661 172
353 3300025933 Ga0207706_10162413 Ga0207706_101624133 172
354 3300025934 Ga0207686_10213234 Ga0207686_102132343 172
355 3300025935 Ga0207709_10305429 Ga0207709_103054292 172
356 3300025936 Ga0207670_10003100 Ga0207670_100031008 172
357 3300025936 Ga0207670_10097423 Ga0207670_100974233 172
358 3300025939 Ga0207665_10026896 Ga0207665_100268963 172
359 3300025939 Ga0207665_10318360 Ga0207665_103183602 172
360 3300025940 Ga0207691_10100551 Ga0207691_101005513 172
361 3300025941 Ga0207711_10496751 Ga0207711_104967512 172
362 3300025945 Ga0207679_10325844 Ga0207679_103258442 172
363 3300025945 Ga0207679_10525205 Ga0207679_105252051 172
364 3300025960 Ga0207651_10714929 Ga0207651_107149292 172
365 3300025961 Ga0207712_10092201 Ga0207712_100922013 172
366 3300025961 Ga0207712_10163457 Ga0207712_101634572 172
367 3300025972 Ga0207668_10056103 Ga0207668_100561033 172
368 3300025972 Ga0207668_10527304 Ga0207668_105273042 172
369 3300025986 Ga0207658_10067376 Ga0207658_100673763 172
370 3300025986 Ga0207658_10490577 Ga0207658_104905772 172
371 3300026023 Ga0207677_10475463 Ga0207677_104754631 172
372 3300026035 Ga0207703_10009368 Ga0207703_100093686 172
373 3300026035 Ga0207703_10200678 Ga0207703_102006783 172
374 3300026067 Ga0207678_10001585 Ga0207678_1000158519 172
375 3300026075 Ga0207708_10038619 Ga0207708_100386194 172
376 3300026078 Ga0207702_10128811 Ga0207702_101288113 172
377 3300026088 Ga0207641_10012427 Ga0207641_100124275 172
378 3300026088 Ga0207641_10084465 Ga0207641_100844653 172
379 3300026095 Ga0207676_10592417 Ga0207676_105924172 172
380 3300026095 Ga0207676_10633153 Ga0207676_106331532 172
381 3300026118 Ga0207675_100154766 Ga0207675_1001547663 172
382 3300026118 Ga0207675_101637184 Ga0207675_1016371841 172
383 3300026121 Ga0207683_10221189 Ga0207683_102211893 172
384 3300026142 Ga0207698_11867719 Ga0207698_118677191 172
385 3300027378 Ga0209981_1018057 Ga0209981_10180572 172
386 3300027424 Ga0209984_1015919 Ga0209984_10159192 172
387 3300027512 Ga0209179_1020935 Ga0209179_10209352 172
388 3300027671 Ga0209588_1190886 Ga0209588_11908862 172
389 3300027876 Ga0209974_10009094 Ga0209974_100090943 172
390 3300028379 Ga0268266_10053400 Ga0268266_100534002 172
391 3300028379 Ga0268266_10073310 Ga0268266_100733102 172
392 3300028379 Ga0268266_10669901 Ga0268266_106699011 172
393 3300028381 Ga0268264_10016515 Ga0268264_100165153 172
394 3300035089 Ga0373944_0197817 Ga0373944_0197817_186_710 172
395 3300035114 Ga0373939_0297324 Ga0373939_0297324_27_551 172
396 3300035170 Ga0373943_0080974 Ga0373943_0080974_150_674 172
397 3300035170 Ga0373943_0156850 Ga0373943_0156850_518_1036 172
398 3300035172 Ga0373955_0055517 Ga0373955_0055517_928_1452 172
399 3300035692 Ga0373935_0018819 Ga0373935_0018819_3088_3606 172
400 3300035724 Ga0373933_0082536 Ga0373933_0082536_53_577 172
401 3300035725 Ga0373947_0665902 Ga0373947_0665902_20_544 172
402 3300036401 Ga0373937_0280144 Ga0373937_0280144_1000_1524 172
403 3300036401 Ga0373937_0975960 Ga0373937_0975960_26_550 172
404 3300037068 Ga0373925_0590631 Ga0373925_0590631_72_590 172
405 3300037418 Ga0395900_0090143 Ga0395900_0090143_942_1460 172
406 3300037471 Ga0395905_0346200 Ga0395905_0346200_657_1175 172
407 3300037471 Ga0395905_0390710 Ga0395905_0390710_261_779 172
408 3300038443 Ga0395901_0378666 Ga0395901_0378666_329_847 172
409 3300038443 Ga0395901_0842928 Ga0395901_0842928_247_771 172
410 3300041512 Ga0451853_0577735 Ga0451853_0577735_1121_1645 172
411 3300042012 Ga0439455_0000520 Ga0439455_0000520_720_1244 172
412 3300042157 Ga0439458_0014766 Ga0439458_0014766_1195_1719 172
413 3300042439 Ga0439464_0017248 Ga0439464_0017248_1330_1854 172
414 3300046455 Ga0495603_0356439 Ga0495603_0356439_226_750 172
415 3300046462 Ga0495651_0538991 Ga0495651_0538991_145_669 172
416 3300046477 Ga0495664_0119843 Ga0495664_0119843_1017_1541 172
417 3300046499 Ga0495594_0328732 Ga0495594_0328732_184_708 172
418 3300046511 Ga0495608_0241548 Ga0495608_0241548_188_712 172
419 3300046517 Ga0495630_0142315 Ga0495630_0142315_630_1154 172
420 3300046517 Ga0495630_0415061 Ga0495630_0415061_11_535 172
421 3300046526 Ga0495666_0085500 Ga0495666_0085500_841_1365 172
422 3300046529 Ga0495652_0388810 Ga0495652_0388810_139_663 172
423 3300046531 Ga0495665_0280518 Ga0495665_0280518_101_625 172
424 3300046533 Ga0495640_0272038 Ga0495640_0272038_227_751 172
425 3300046533 Ga0495640_0589443 Ga0495640_0589443_128_652 172
426 3300046535 Ga0495586_0166149 Ga0495586_0166149_34_558 172
427 3300046536 Ga0495587_0165475 Ga0495587_0165475_592_1116 172
428 3300046536 Ga0495587_0348335 Ga0495587_0348335_113_637 172
429 3300046543 Ga0495645_0006709 Ga0495645_0006709_3068_3592 172
430 3300046642 Ga0495634_0029418 Ga0495634_0029418_3202_3726 172
431 3300046642 Ga0495634_0143867 Ga0495634_0143867_307_831 172
432 3300046675 Ga0495657_0193567 Ga0495657_0193567_663_1187 172
433 3300046678 Ga0495599_0002744 Ga0495599_0002744_5526_6050 172
434 3300046679 Ga0495623_0042456 Ga0495623_0042456_396_920 172
435 3300046680 Ga0495646_0036436 Ga0495646_0036436_328_852 172
436 3300046681 Ga0495647_0076865 Ga0495647_0076865_251_775 172
437 3300046683 Ga0495658_0308605 Ga0495658_0308605_227_751 172
438 3300046684 Ga0495669_0074203 Ga0495669_0074203_970_1500 172
439 3300046809 Ga0495600_0227156 Ga0495600_0227156_293_817 172
440 3300047317 Ga0495604_0414233 Ga0495604_0414233_27_551 172
441 3300047319 Ga0495674_0278005 Ga0495674_0278005_441_965 172
442 3300047471 Ga0495684_0010873 Ga0495684_0010873_851_1375 172
443 3300048088 Ga0495602_0571903 Ga0495602_0571903_114_638 172
444 3300048089 Ga0495614_0310439 Ga0495614_0310439_179_703 172
445 3300048904 Ga0496101_0124446 Ga0496101_0124446_846_1370 172
446 3300048904 Ga0496101_0254864 Ga0496101_0254864_323_847 172
447 3300048905 Ga0496102_0159621 Ga0496102_0159621_1272_1796 172
448 3300048905 Ga0496102_0449645 Ga0496102_0449645_232_756 172
449 3300048907 Ga0496104_0065707 Ga0496104_0065707_2268_2792 172
450 3300048907 Ga0496104_0729065 Ga0496104_0729065_277_801 172
451 3300048907 Ga0496104_0734994 Ga0496104_0734994_25_549 172
452 3300048907 Ga0496104_1371686 Ga0496104_1371686_18_542 172
453 3300048908 Ga0496105_0087870 Ga0496105_0087870_357_881 172
454 3300048908 Ga0496105_0142286 Ga0496105_0142286_646_1170 172
455 3300048909 Ga0496106_0298970 Ga0496106_0298970_663_1187 172
456 3300048910 Ga0496107_0158825 Ga0496107_0158825_917_1441 172
457 3300048910 Ga0496107_0529096 Ga0496107_0529096_223_747 172
458 3300048912 Ga0496109_0005026 Ga0496109_0005026_8050_8574 172
459 3300048913 Ga0496110_0173027 Ga0496110_0173027_1354_1878 172
460 3300048913 Ga0496110_0697704 Ga0496110_0697704_359_883 172
461 3300048914 Ga0496111_0251184 Ga0496111_0251184_338_862 172
462 3300048914 Ga0496111_0340997 Ga0496111_0340997_160_684 172
463 3300048915 Ga0496112_0034027 Ga0496112_0034027_1180_1704 172
464 3300048915 Ga0496112_0096332 Ga0496112_0096332_1204_1728 172
465 3300048915 Ga0496112_0743742 Ga0496112_0743742_247_771 172
466 3300048916 Ga0496113_0044056 Ga0496113_0044056_510_1034 172
467 3300048916 Ga0496113_0152026 Ga0496113_0152026_812_1336 172
468 3300048917 Ga0496114_0018012 Ga0496114_0018012_207_731 172
469 3300048917 Ga0496114_0089371 Ga0496114_0089371_1561_2085 172
470 3300048918 Ga0496115_0098738 Ga0496115_0098738_1116_1640 172
471 3300048918 Ga0496115_0208927 Ga0496115_0208927_472_996 172
472 3300048918 Ga0496115_0224807 Ga0496115_0224807_221_745 172
473 3300048918 Ga0496115_0435005 Ga0496115_0435005_14_538 172
474 3300048918 Ga0496115_1144098 Ga0496115_1144098_41_565 172
475 3300050507 nmdc:mga05p37_1054801_c1 nmdc:mga05p37_1054801_c1_232_756 172
476 3300050512 nmdc:mga0n895_386381_c1 nmdc:mga0n895_386381_c1_466_990 172
477 3300050515 nmdc:mga0a205_414541_c1 nmdc:mga0a205_414541_c1_332_850 172
478 3300053084 Ga0495595_0544707 Ga0495595_0544707_14_538 172
479 3300053085 Ga0495619_0128112 Ga0495619_0128112_196_720 172
480 3300053085 Ga0495619_0500322 Ga0495619_0500322_60_584 172

Feature Viewer

pLDDT pTM Quality
66.27 0.31 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map