F452268

General Info

Members Datasets Scaffolds Average Seq Length
480 215 960 82

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0266247|Ga0466967_0266247_1148_1459
Length 103
Sequence MLHHLNYFKDTKINILKRVTMAKDITIFTTNTCSYCGMVKRFLDLKGQSYEVVNLDEHPERNQEAYELSNGALTVPITVVTKQDDSKEVVVGYNLAKLAPAIA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
154 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
195 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
200 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
201 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
202 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
203 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
207 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
211 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
212 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
213 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
214 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.5
Nodule 0
Rhizoplane 1.67
Rhizosphere 78.54
Stem 0
Stem Tuber 0
Unclassified 23.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0266247 3300045976 Bacteria 1641
2 JGI24741J21665_1000424 3300001915 Bacteria 12795
3 JGI24737J22298_10004082 3300001990 Bacteria 5100
4 JGI24735J21928_10000140 3300002067 Bacteria 25432
5 rootH1_10086967 3300003316 Bacteria 1059
6 rootH1_10158041 3300003316 Unclassified 1156
7 rootH1_10197065 3300003316 Bacteria 1178
8 rootH2_10241683 3300003320 Bacteria 1420
9 rootH2_10245634 3300003320 Unclassified 2967
10 rootH2_10261574 3300003320 Unclassified 3301
11 rootL2_10055469 3300003322 Bacteria 14111
12 rootL2_10151442 3300003322 Bacteria 1719
13 rootH1_10200985 3300003323 Unclassified 2634
14 rootH1_10298537 3300003323 Bacteria 3881
15 Ga0070658_10000015 3300005327 Bacteria 230579
16 Ga0070658_10001477 3300005327 Bacteria 19990
17 Ga0070658_10004598 3300005327 Bacteria 11212
18 Ga0070658_10424973 3300005327 Bacteria 1143
19 Ga0070658_10645553 3300005327 Bacteria 918
20 Ga0070658_10871248 3300005327 Unclassified 783
21 Ga0070658_11729036 3300005327 Bacteria 541
22 Ga0070658_11935063 3300005327 Unclassified 509
23 Ga0070676_10000782 3300005328 Bacteria 15687
24 Ga0070683_100003532 3300005329 Bacteria 12725
25 Ga0070683_100116623 3300005329 Bacteria 2521
26 Ga0070683_100187301 3300005329 Bacteria 1965
27 Ga0070683_102116626 3300005329 Bacteria 540
28 Ga0070690_101122937 3300005330 Bacteria 624
29 Ga0070666_11459586 3300005335 Unclassified 511
30 Ga0070680_100142327 3300005336 Bacteria 2011
31 Ga0070680_100488898 3300005336 Bacteria 1052
32 Ga0070680_100722998 3300005336 Unclassified 857
33 Ga0070680_101249768 3300005336 Bacteria 642
34 Ga0070682_100014732 3300005337 Bacteria 4522
35 Ga0070682_100342838 3300005337 Bacteria 1111
36 Ga0070682_101826847 3300005337 Unclassified 531
37 Ga0068868_102082093 3300005338 Unclassified 539
38 Ga0070660_100139884 3300005339 Unclassified 1941
39 Ga0070689_100708494 3300005340 Bacteria 879
40 Ga0070691_10472473 3300005341 Unclassified 720
41 Ga0070687_100125056 3300005343 Bacteria 1476
42 Ga0070661_100038470 3300005344 Unclassified 3482
43 Ga0070661_101316354 3300005344 Unclassified 606
44 Ga0070661_101461528 3300005344 Unclassified 576
45 Ga0070669_100382950 3300005353 Bacteria 1147
46 Ga0070669_101847518 3300005353 Unclassified 527
47 Ga0070675_102079723 3300005354 Bacteria 523
48 Ga0070671_100000001 3300005355 Bacteria 1228151
49 Ga0070671_100024827 3300005355 Bacteria 4911
50 Ga0070674_100027540 3300005356 Bacteria 3725
51 Ga0070673_102124502 3300005364 Bacteria 533
52 Ga0070688_100734112 3300005365 Unclassified 767
53 Ga0070667_100000001 3300005367 Bacteria 1108638
54 Ga0070714_100000374 3300005435 Bacteria 33426
55 Ga0070714_101742635 3300005435 Bacteria 608
56 Ga0070663_100393683 3300005455 Bacteria 1131
57 Ga0070681_10013092 3300005458 Bacteria 8238
58 Ga0070681_10673830 3300005458 Bacteria 949
59 Ga0070681_10970405 3300005458 Unclassified 769
60 Ga0070681_11213242 3300005458 Unclassified 676
61 Ga0070681_11360612 3300005458 Bacteria 633
62 Ga0070681_11390309 3300005458 Unclassified 625
63 Ga0070685_10048014 3300005466 Bacteria 2457
64 Ga0070685_11121153 3300005466 Unclassified 595
65 Ga0074259_10819813 3300005507 Bacteria 527
66 Ga0070679_100000730 3300005530 Bacteria 28399
67 Ga0070679_100000876 3300005530 Bacteria 26140
68 Ga0070679_100014684 3300005530 Bacteria 7528
69 Ga0070679_100174500 3300005530 Bacteria 2122
70 Ga0070679_101136073 3300005530 Bacteria 726
71 Ga0070679_101303276 3300005530 Bacteria 672
72 Ga0070679_101426450 3300005530 Unclassified 639
73 Ga0070679_101527394 3300005530 Unclassified 615
74 Ga0070679_101702570 3300005530 Bacteria 578
75 Ga0070679_101842572 3300005530 Unclassified 553
76 Ga0070684_100015260 3300005535 Bacteria 6250
77 Ga0070684_100076505 3300005535 Bacteria 2954
78 Ga0070684_101013252 3300005535 Bacteria 779
79 Ga0068853_100156676 3300005539 Unclassified 2052
80 Ga0070686_100013698 3300005544 Bacteria 4651
81 Ga0070686_100516488 3300005544 Bacteria 929
82 Ga0070686_100548080 3300005544 Bacteria 904
83 Ga0070696_100217164 3300005546 Bacteria 1433
84 Ga0070693_100983047 3300005547 Bacteria 637
85 Ga0070665_100019550 3300005548 Bacteria 6799
86 Ga0070665_100502732 3300005548 Unclassified 1223
87 Ga0068855_100000003 3300005563 Bacteria 589862
88 Ga0068855_100011595 3300005563 Bacteria 10648
89 Ga0068855_100016848 3300005563 Bacteria 8791
90 Ga0068855_100241041 3300005563 Bacteria 2020
91 Ga0068855_100457997 3300005563 Bacteria 1391
92 Ga0068855_100791713 3300005563 Bacteria 1008
93 Ga0068855_100834723 3300005563 Bacteria 977
94 Ga0070664_102199588 3300005564 Unclassified 523
95 Ga0068857_100095012 3300005577 Unclassified 2669
96 Ga0068857_100097710 3300005577 Bacteria 2633
97 Ga0068857_100195277 3300005577 Unclassified 1844
98 Ga0068857_101153796 3300005577 Unclassified 749
99 Ga0068857_101497729 3300005577 Bacteria 657
100 Ga0068854_100664005 3300005578 Unclassified 896
101 Ga0068856_100045758 3300005614 Bacteria 4310
102 Ga0068856_100206437 3300005614 Bacteria 1979
103 Ga0068856_100593044 3300005614 Bacteria 1129
104 Ga0068856_101475437 3300005614 Unclassified 694
105 Ga0068856_102666803 3300005614 Unclassified 505
106 Ga0068852_100100678 3300005616 Unclassified 2607
107 Ga0068852_102864663 3300005616 Unclassified 500
108 Ga0068859_100346624 3300005617 Bacteria 1580
109 Ga0068859_100468632 3300005617 Unclassified 1355
110 Ga0068864_102539076 3300005618 Unclassified 518
111 Ga0068863_100187815 3300005841 Bacteria 1985
112 Ga0068863_101073324 3300005841 Bacteria 809
113 Ga0068860_100072682 3300005843 Bacteria 3269
114 Ga0068860_100961416 3300005843 Unclassified 871
115 Ga0081539_10001746 3300005985 Bacteria 34691
116 Ga0075365_10000020 3300006038 Bacteria 64494
117 Ga0075365_10084867 3300006038 Unclassified 2150
118 Ga0075365_10114163 3300006038 Unclassified 1858
119 Ga0075365_10271323 3300006038 Bacteria 1193
120 Ga0075365_10702780 3300006038 Bacteria 714
121 Ga0075368_10000003 3300006042 Bacteria 56143
122 Ga0075363_100000016 3300006048 Bacteria 38279
123 Ga0075363_100534691 3300006048 Unclassified 698
124 Ga0075364_10001774 3300006051 Bacteria 11934
125 Ga0075364_10002093 3300006051 Bacteria 11140
126 Ga0075364_10013993 3300006051 Unclassified 4946
127 Ga0075364_10214442 3300006051 Bacteria 1306
128 Ga0075364_10386280 3300006051 Bacteria 955
129 Ga0075364_10463477 3300006051 Bacteria 866
130 Ga0075364_10902505 3300006051 Bacteria 601
131 Ga0075362_10000073 3300006177 Bacteria 27914
132 Ga0075362_10339577 3300006177 Bacteria 750
133 Ga0075367_10000034 3300006178 Bacteria 29945
134 Ga0075369_10000005 3300006186 Bacteria 147699
135 Ga0075369_10000051 3300006186 Bacteria 29832
136 Ga0075369_10109021 3300006186 Bacteria 1247
137 Ga0075369_10119698 3300006186 Bacteria 1191
138 Ga0075369_10265553 3300006186 Unclassified 798
139 Ga0075369_10447919 3300006186 Bacteria 611
140 Ga0075366_10000001 3300006195 Bacteria 569172
141 Ga0075366_10000044 3300006195 Bacteria 45021
142 Ga0075366_10000083 3300006195 Bacteria 37001
143 Ga0075366_10066203 3300006195 Unclassified 2149
144 Ga0075366_10075027 3300006195 Unclassified 2017
145 Ga0075366_10203540 3300006195 Bacteria 1204
146 Ga0097621_100296810 3300006237 Unclassified 1426
147 Ga0075370_10000307 3300006353 Bacteria 17662
148 Ga0075370_10059008 3300006353 Bacteria 2183
149 Ga0075370_10963582 3300006353 Unclassified 522
150 Ga0075370_10985905 3300006353 Unclassified 516
151 Ga0068871_100000055 3300006358 Bacteria 62753
152 Ga0075428_102454948 3300006844 Bacteria 534
153 Ga0097620_100346613 3300006931 Bacteria 1580
154 Ga0097620_100468616 3300006931 Unclassified 1355
155 Ga0105240_10033473 3300009093 Bacteria 6639
156 Ga0105240_10255468 3300009093 Bacteria 2024
157 Ga0105240_10364004 3300009093 Bacteria 1637
158 Ga0105240_10617419 3300009093 Unclassified 1192
159 Ga0111539_10012227 3300009094 Bacteria 10766
160 Ga0105245_10000002 3300009098 Bacteria 634374
161 Ga0105245_10548213 3300009098 Bacteria 1178
162 Ga0105247_11054547 3300009101 Unclassified 638
163 Ga0105247_11374298 3300009101 Bacteria 570
164 Ga0105243_10657311 3300009148 Bacteria 1016
165 Ga0105241_10080012 3300009174 Bacteria 2556
166 Ga0105241_10997156 3300009174 Unclassified 783
167 Ga0105241_11114811 3300009174 Bacteria 744
168 Ga0105242_10015406 3300009176 Bacteria 5937
169 Ga0105248_10239584 3300009177 Bacteria 2042
170 Ga0105248_10615782 3300009177 Bacteria 1225
171 Ga0105248_11177587 3300009177 Bacteria 866
172 Ga0105237_11075306 3300009545 Bacteria 811
173 Ga0105238_11582380 3300009551 Bacteria 685
174 Ga0105249_10004190 3300009553 Bacteria 12456
175 Ga0105249_10775217 3300009553 Bacteria 1022
176 Ga0105239_10242537 3300010375 Bacteria 2023
177 Ga0105239_10782975 3300010375 Unclassified 1092
178 Ga0105239_12075173 3300010375 Bacteria 660
179 Ga0157373_10000042 3300013100 Bacteria 113564
180 Ga0157371_11295029 3300013102 Bacteria 564
181 Ga0157370_10092687 3300013104 Bacteria 2835
182 Ga0157370_10322705 3300013104 Bacteria 1424
183 Ga0157369_10928287 3300013105 Bacteria 892
184 Ga0157369_12038625 3300013105 Bacteria 582
185 Ga0157374_10000031 3300013296 Bacteria 204840
186 Ga0157374_10001387 3300013296 Bacteria 20572
187 Ga0157374_10003340 3300013296 Bacteria 13471
188 Ga0157374_10725608 3300013296 Bacteria 1008
189 Ga0157374_11109786 3300013296 Unclassified 812
190 Ga0157372_11580058 3300013307 Unclassified 755
191 Ga0163163_10215507 3300014325 Bacteria 1969
192 Ga0163163_10890309 3300014325 Unclassified 953
193 Ga0157380_10190906 3300014326 Bacteria 1808
194 Ga0157379_12585395 3300014968 Unclassified 508
195 Ga0206351_10272916 3300020077 Archaea 790
196 Ga0154015_1394197 3300020610 Unclassified 626
197 Ga0207710_10609954 3300025900 Bacteria 570
198 Ga0207680_10055319 3300025903 Bacteria 2391
199 Ga0207647_10000458 3300025904 Bacteria 33136
200 Ga0207645_10005159 3300025907 Bacteria 9544
201 Ga0207705_10000011 3300025909 Bacteria 517768
202 Ga0207705_10000327 3300025909 Bacteria 43259
203 Ga0207705_10004428 3300025909 Bacteria 10616
204 Ga0207705_10007475 3300025909 Bacteria 8034
205 Ga0207705_10020453 3300025909 Bacteria 4729
206 Ga0207705_10027442 3300025909 Bacteria 4060
207 Ga0207705_10858708 3300025909 Unclassified 704
208 Ga0207705_11288503 3300025909 Bacteria 558
209 Ga0207705_11361345 3300025909 Bacteria 541
210 Ga0207654_10000002 3300025911 Bacteria 1460142
211 Ga0207654_10064496 3300025911 Bacteria 2153
212 Ga0207654_10069902 3300025911 Bacteria 2082
213 Ga0207654_10491864 3300025911 Bacteria 865
214 Ga0207654_10737581 3300025911 Bacteria 709
215 Ga0207707_10011863 3300025912 Bacteria 7581
216 Ga0207707_10129466 3300025912 Bacteria 2207
217 Ga0207707_10215219 3300025912 Bacteria 1673
218 Ga0207707_10278207 3300025912 Unclassified 1450
219 Ga0207707_10779183 3300025912 Unclassified 798
220 Ga0207707_10932984 3300025912 Bacteria 716
221 Ga0207695_10046405 3300025913 Bacteria 4605
222 Ga0207695_10151527 3300025913 Bacteria 2257
223 Ga0207695_10160564 3300025913 Bacteria 2180
224 Ga0207695_10509514 3300025913 Unclassified 1085
225 Ga0207695_11703277 3300025913 Bacteria 511
226 Ga0207671_10424219 3300025914 Bacteria 1058
227 Ga0207671_10426287 3300025914 Bacteria 1055
228 Ga0207671_10611767 3300025914 Bacteria 868
229 Ga0207660_10004973 3300025917 Bacteria 8665
230 Ga0207660_10010648 3300025917 Bacteria 5976
231 Ga0207660_10169896 3300025917 Unclassified 1687
232 Ga0207660_10470079 3300025917 Bacteria 1018
233 Ga0207657_10001246 3300025919 Bacteria 27202
234 Ga0207657_10004983 3300025919 Bacteria 13968
235 Ga0207657_10683429 3300025919 Bacteria 798
236 Ga0207649_10090195 3300025920 Unclassified 2005
237 Ga0207649_10959575 3300025920 Unclassified 672
238 Ga0207652_10000906 3300025921 Bacteria 28011
239 Ga0207652_10002999 3300025921 Bacteria 14100
240 Ga0207652_10003903 3300025921 Bacteria 12193
241 Ga0207652_10004857 3300025921 Bacteria 10886
242 Ga0207652_10018146 3300025921 Bacteria 5768
243 Ga0207652_10131350 3300025921 Bacteria 2234
244 Ga0207652_10422192 3300025921 Bacteria 1203
245 Ga0207652_10612524 3300025921 Unclassified 976
246 Ga0207652_11374080 3300025921 Unclassified 609
247 Ga0207652_11407373 3300025921 Unclassified 601
248 Ga0207652_11879068 3300025921 Bacteria 504
249 Ga0207681_10212348 3300025923 Bacteria 1492
250 Ga0207694_10004584 3300025924 Bacteria 10769
251 Ga0207694_10224365 3300025924 Bacteria 1533
252 Ga0207694_10298548 3300025924 Unclassified 1326
253 Ga0207694_10725322 3300025924 Bacteria 839
254 Ga0207687_10000001 3300025927 Bacteria 1130810
255 Ga0207687_10416144 3300025927 Bacteria 1108
256 Ga0207687_10740416 3300025927 Bacteria 836
257 Ga0207664_10000269 3300025929 Bacteria 39220
258 Ga0207644_10000001 3300025931 Bacteria 1243214
259 Ga0207644_10016581 3300025931 Bacteria 4958
260 Ga0207690_10002993 3300025932 Bacteria 10175
261 Ga0207686_10018414 3300025934 Bacteria 3955
262 Ga0207709_10014139 3300025935 Bacteria 4406
263 Ga0207709_10152425 3300025935 Bacteria 1602
264 Ga0207670_11808652 3300025936 Bacteria 520
265 Ga0207669_10009507 3300025937 Bacteria 4636
266 Ga0207711_11007634 3300025941 Unclassified 772
267 Ga0207661_10000359 3300025944 Bacteria 29302
268 Ga0207661_10232114 3300025944 Bacteria 1634
269 Ga0207661_10557094 3300025944 Bacteria 1050
270 Ga0207661_10631622 3300025944 Unclassified 984
271 Ga0207667_10000008 3300025949 Bacteria 625138
272 Ga0207667_10000466 3300025949 Bacteria 54272
273 Ga0207667_10002118 3300025949 Bacteria 24862
274 Ga0207667_10021272 3300025949 Bacteria 7190
275 Ga0207667_10066886 3300025949 Unclassified 3745
276 Ga0207667_10332050 3300025949 Bacteria 1552
277 Ga0207667_10593930 3300025949 Bacteria 1117
278 Ga0207667_10935502 3300025949 Bacteria 857
279 Ga0207651_11562826 3300025960 Bacteria 594
280 Ga0207651_12139006 3300025960 Bacteria 502
281 Ga0207712_10002011 3300025961 Bacteria 13346
282 Ga0207712_10680186 3300025961 Unclassified 896
283 Ga0207658_10000003 3300025986 Bacteria 1151934
284 Ga0207639_10010803 3300026041 Bacteria 6329
285 Ga0207639_10019128 3300026041 Bacteria 4879
286 Ga0207639_12004352 3300026041 Bacteria 540
287 Ga0207639_12175982 3300026041 Unclassified 516
288 Ga0207702_10004326 3300026078 Bacteria 12669
289 Ga0207702_10171656 3300026078 Bacteria 1989
290 Ga0207702_10229960 3300026078 Bacteria 1732
291 Ga0207702_11597863 3300026078 Bacteria 645
292 Ga0207702_12189092 3300026078 Unclassified 542
293 Ga0207674_10000001 3300026116 Bacteria 616581
294 Ga0207674_10008752 3300026116 Bacteria 11651
295 Ga0207674_10217946 3300026116 Unclassified 1857
296 Ga0207674_10579317 3300026116 Unclassified 1084
297 Ga0207674_11411002 3300026116 Bacteria 666
298 Ga0207674_11683986 3300026116 Bacteria 602
299 Ga0207698_10010530 3300026142 Bacteria 5951
300 Ga0207698_12546958 3300026142 Bacteria 521
301 Ga0209998_10160707 3300027717 Unclassified 580
302 Ga0209813_10000004 3300027866 Bacteria 139340
303 Ga0209813_10029685 3300027866 Unclassified 1602
304 Ga0207428_10008431 3300027907 Bacteria 9305
305 Ga0268266_10001150 3300028379 Bacteria 32834
306 Ga0268264_10122143 3300028381 Bacteria 2297
307 Ga0268264_10937144 3300028381 Unclassified 871
308 Ga0265337_1000836 3300028556 Bacteria 16153
309 Ga0265337_1001897 3300028556 Bacteria 9949
310 Ga0265337_1001932 3300028556 Bacteria 9853
311 Ga0265337_1021129 3300028556 Bacteria 2033
312 Ga0265337_1065685 3300028556 Bacteria 1001
313 Ga0265326_10006303 3300028558 Bacteria 3699
314 Ga0265326_10008194 3300028558 Unclassified 3161
315 Ga0265319_1007660 3300028563 Unclassified 4821
316 Ga0265319_1008458 3300028563 Bacteria 4505
317 Ga0265334_10000032 3300028573 Bacteria 107258
318 Ga0265334_10003365 3300028573 Bacteria 7293
319 Ga0265334_10033553 3300028573 Bacteria 2042
320 Ga0265334_10034375 3300028573 Unclassified 2012
321 Ga0265334_10149697 3300028573 Unclassified 823
322 Ga0265322_10017029 3300028654 Bacteria 2095
323 Ga0265322_10080820 3300028654 Bacteria 922
324 Ga0265336_10002635 3300028666 Bacteria 7288
325 Ga0265336_10002777 3300028666 Bacteria 7074
326 Ga0265336_10082853 3300028666 Archaea 957
327 Ga0265338_10000054 3300028800 Bacteria 207383
328 Ga0265338_10000192 3300028800 Bacteria 115195
329 Ga0265338_10000482 3300028800 Bacteria 71209
330 Ga0265338_10002389 3300028800 Bacteria 28280
331 Ga0265338_10003756 3300028800 Bacteria 21096
332 Ga0265338_10007578 3300028800 Bacteria 13408
333 Ga0265338_10030060 3300028800 Bacteria 5366
334 Ga0265338_10046688 3300028800 Bacteria 3966
335 Ga0265338_10074297 3300028800 Bacteria 2892
336 Ga0265338_10238937 3300028800 Bacteria 1346
337 Ga0265338_10718470 3300028800 Unclassified 688
338 Ga0265324_10010164 3300029957 Bacteria 3642
339 Ga0265324_10014054 3300029957 Unclassified 2971
340 Ga0265324_10033292 3300029957 Unclassified 1799
341 Ga0265332_10435041 3300031238 Unclassified 542
342 Ga0265320_10048535 3300031240 Bacteria 2071
343 Ga0265325_10118362 3300031241 Bacteria 1280
344 Ga0265329_10331793 3300031242 Unclassified 518
345 Ga0265340_10000077 3300031247 Bacteria 47065
346 Ga0265339_10053095 3300031249 Unclassified 2205
347 Ga0265327_10004080 3300031251 Bacteria 13211
348 Ga0265327_10070817 3300031251 Bacteria 1746
349 Ga0265327_10121589 3300031251 Bacteria 1236
350 Ga0265316_10038388 3300031344 Bacteria 3859
351 Ga0265316_10103108 3300031344 Bacteria 2166
352 Ga0265316_10231544 3300031344 Unclassified 1360
353 Ga0265316_10256885 3300031344 Bacteria 1282
354 Ga0265316_10565568 3300031344 Bacteria 808
355 Ga0265313_10118050 3300031595 Unclassified 1160
356 Ga0265314_10135997 3300031711 Bacteria 1526
357 Ga0265342_10355166 3300031712 Unclassified 763
358 Ga0307407_10567734 3300031903 Bacteria 841
359 Ga0307415_101212552 3300032126 Bacteria 711
360 Ga0395899_0001600 3300037312 Bacteria 18991
361 Ga0395899_0002540 3300037312 Bacteria 14790
362 Ga0395900_0000232 3300037418 Bacteria 87268
363 Ga0395900_0001931 3300037418 Bacteria 23494
364 Ga0395900_0024461 3300037418 Bacteria 6185
365 Ga0395900_0079748 3300037418 Bacteria 3364
366 Ga0395900_0119289 3300037418 Bacteria 2707
367 Ga0395900_0391664 3300037418 Unclassified 1355
368 Ga0395898_0004193 3300037466 Bacteria 15800
369 Ga0395898_0036662 3300037466 Bacteria 4869
370 Ga0395898_0075016 3300037466 Bacteria 3267
371 Ga0395898_0090571 3300037466 Bacteria 2943
372 Ga0395898_0460906 3300037466 Unclassified 1210
373 Ga0395905_0070586 3300037471 Bacteria 3274
374 Ga0395905_0083595 3300037471 Bacteria 2991
375 Ga0395905_0181419 3300037471 Bacteria 1976
376 Ga0395905_0701593 3300037471 Bacteria 914
377 Ga0395905_0750358 3300037471 Unclassified 878
378 Ga0395901_0000680 3300038443 Bacteria 39129
379 Ga0395901_0001919 3300038443 Bacteria 21405
380 Ga0395901_0039888 3300038443 Bacteria 4861
381 Ga0395901_0249052 3300038443 Bacteria 1851
382 Ga0395901_0519159 3300038443 Bacteria 1210
383 Ga0395901_0621780 3300038443 Bacteria 1087
384 Ga0451793_0535451 3300041452 Unclassified 552
385 Ga0451797_0140699 3300041453 Unclassified 514
386 Ga0451798_0643091 3300041458 Bacteria 659
387 Ga0451807_0162086 3300041486 Unclassified 709
388 Ga0451807_1300082 3300041486 Bacteria 1560
389 Ga0466966_0366370 3300044684 Bacteria 866
390 Ga0466959_0701780 3300045049 Unclassified 678
391 Ga0466967_0362316 3300045976 Unclassified 1405
392 Ga0495588_0000116 3300046674 Bacteria 135919
393 Ga0495658_0587755 3300046683 Bacteria 713
394 Ga0495671_0326911 3300046692 Bacteria 736
395 Ga0495671_0393589 3300046692 Unclassified 664
396 Ga0496100_0007722 3300048903 Bacteria 5956
397 Ga0496105_0723800 3300048908 Unclassified 762
398 Ga0496112_0163422 3300048915 Bacteria 2192
399 Ga0496125_0080479 3300048928 Bacteria 2493
400 Ga0501031_0000163 3300049568 Bacteria 38332
401 Ga0501032_0002271 3300049569 Bacteria 15106
402 Ga0501033_0106016 3300049570 Bacteria 2048
403 Ga0501033_0805250 3300049570 Bacteria 635
404 Ga0501034_0006713 3300049571 Bacteria 12339
405 Ga0501034_0007892 3300049571 Bacteria 11308
406 Ga0501034_1579148 3300049571 Unclassified 529
407 Ga0501036_0018114 3300049572 Bacteria 5896
408 Ga0501036_0769983 3300049572 Bacteria 793
409 Ga0501037_0000121 3300049573 Bacteria 72862
410 Ga0501038_0010627 3300049574 Bacteria 8415
411 Ga0501038_0286170 3300049574 Bacteria 1296
412 Ga0501039_0138439 3300049575 Bacteria 1912
413 Ga0501042_0174208 3300049578 Bacteria 1552
414 Ga0501042_1290429 3300049578 Bacteria 532
415 Ga0501043_0018247 3300049579 Bacteria 5500
416 Ga0501046_0000138 3300049580 Bacteria 77052
417 Ga0501047_0000397 3300049581 Bacteria 48886
418 Ga0501047_0000681 3300049581 Bacteria 35407
419 Ga0501048_0000361 3300049582 Bacteria 31413
420 Ga0501048_0026878 3300049582 Bacteria 4188
421 Ga0501070_0384200 3300049586 Bacteria 1137
422 Ga0501070_0522545 3300049586 Bacteria 952
423 Ga0501073_0047232 3300049589 Bacteria 3026
424 Ga0501073_0074583 3300049589 Unclassified 2362
425 Ga0501080_0000133 3300049742 Bacteria 52488
426 Ga0501083_0012944 3300049744 Bacteria 5829
427 Ga0501035_0000033 3300049822 Bacteria 175087
428 Ga0501035_0000765 3300049822 Bacteria 34530
429 Ga0501044_0164019 3300049823 Bacteria 2197
430 nmdc:mga03683_6719_c3 3300050489 Bacteria 1969
431 nmdc:mga03n38_123487_c2 3300050490 Unclassified 977
432 nmdc:mga03n38_22_c1 3300050490 Bacteria 38225
433 nmdc:mga00v17_21483_c1 3300050491 Bacteria 3710
434 nmdc:mga00v17_702_c1 3300050491 Bacteria 15977
435 nmdc:mga00v17_74234_c1 3300050491 Bacteria 2113
436 nmdc:mga0yw44_1227033_c1 3300050492 Bacteria 506
437 nmdc:mga0yw44_193195_c1 3300050492 Unclassified 1343
438 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
439 nmdc:mga0yw44_64260_c1 3300050492 Bacteria 1193
440 nmdc:mga0k408_114_c1 3300050493 Bacteria 39328
441 nmdc:mga0k408_8008_c1 3300050493 Bacteria 5664
442 nmdc:mga06z11_6_c1 3300050494 Bacteria 124054
443 nmdc:mga04h51_4_c1 3300050495 Bacteria 139342
444 nmdc:mga07m45_7456_c1 3300050496 Bacteria 5593
445 nmdc:mga07m45_869795_c1 3300050496 Unclassified 516
446 nmdc:mga08y16_8783_c1 3300050511 Bacteria 10606
447 nmdc:mga0sz30_114550_c1 3300050516 Bacteria 1183
448 nmdc:mga0sz30_127998_c1 3300050516 Unclassified 1118
449 nmdc:mga0sz30_128074_c1 3300050516 Bacteria 1118
450 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
451 Ga0500610_0008991 3300053079 Bacteria 4392
452 Ga0500643_000038 3300053087 Bacteria 178974
453 Ga0500643_000043 3300053087 Bacteria 157905
454 Ga0500644_0000347 3300053088 Bacteria 23270
455 Ga0500583_0000137 3300053092 Bacteria 31497
456 Ga0500583_0008340 3300053092 Bacteria 3712
457 Ga0500651_0000045 3300053093 Bacteria 85481
458 Ga0500651_0000441 3300053093 Bacteria 22180
459 Ga0500555_000001 3300053103 Bacteria 1353713
460 Ga0500555_028471 3300053103 Unclassified 1591
461 Ga0500614_000001 3300053123 Bacteria 1274484
462 Ga0500614_000525 3300053123 Bacteria 9920
463 Ga0500621_247724 3300053126 Bacteria 600
464 Ga0500642_0007922 3300053130 Bacteria 3601
465 Ga0500561_0000001 3300053137 Bacteria 957685
466 Ga0500568_0003383 3300053139 Bacteria 8918
467 Ga0500568_0016761 3300053139 Unclassified 3247
468 Ga0500577_0004024 3300053142 Bacteria 3852
469 Ga0500588_0267069 3300053146 Unclassified 644
470 Ga0500589_000016 3300053147 Bacteria 107090
471 Ga0500589_258520 3300053147 Unclassified 635
472 Ga0500604_0017862 3300053151 Bacteria 1970
473 Ga0500616_0000005 3300053153 Bacteria 961725
474 Ga0500649_000013 3300053722 Bacteria 73694
475 Ga0500570_000005 3300053724 Bacteria 132994
476 Ga0500611_000259 3300053727 Bacteria 5749
477 Ga0500611_039054 3300053727 Bacteria 1031
478 Ga0500599_093133 3300053736 Unclassified 522
479 Ga0587094_105389 3300059513 Bacteria 549
480 Ga0587069_116402 3300059642 Unclassified 562
481 Ga0466967_0266247
482 JGI24741J21665_1000424
483 JGI24737J22298_10004082
484 JGI24735J21928_10000140
485 rootH1_10086967
486 rootH1_10158041
487 rootH1_10197065
488 rootH2_10241683
489 rootH2_10245634
490 rootH2_10261574
491 rootL2_10055469
492 rootL2_10151442
493 rootH1_10200985
494 rootH1_10298537
495 Ga0070658_10000015
496 Ga0070658_10001477
497 Ga0070658_10004598
498 Ga0070658_10424973
499 Ga0070658_10645553
500 Ga0070658_10871248
501 Ga0070658_11729036
502 Ga0070658_11935063
503 Ga0070676_10000782
504 Ga0070683_100003532
505 Ga0070683_100116623
506 Ga0070683_100187301
507 Ga0070683_102116626
508 Ga0070690_101122937
509 Ga0070666_11459586
510 Ga0070680_100142327
511 Ga0070680_100488898
512 Ga0070680_100722998
513 Ga0070680_101249768
514 Ga0070682_100014732
515 Ga0070682_100342838
516 Ga0070682_101826847
517 Ga0068868_102082093
518 Ga0070660_100139884
519 Ga0070689_100708494
520 Ga0070691_10472473
521 Ga0070687_100125056
522 Ga0070661_100038470
523 Ga0070661_101316354
524 Ga0070661_101461528
525 Ga0070669_100382950
526 Ga0070669_101847518
527 Ga0070675_102079723
528 Ga0070671_100000001
529 Ga0070671_100024827
530 Ga0070674_100027540
531 Ga0070673_102124502
532 Ga0070688_100734112
533 Ga0070667_100000001
534 Ga0070714_100000374
535 Ga0070714_101742635
536 Ga0070663_100393683
537 Ga0070681_10013092
538 Ga0070681_10673830
539 Ga0070681_10970405
540 Ga0070681_11213242
541 Ga0070681_11360612
542 Ga0070681_11390309
543 Ga0070685_10048014
544 Ga0070685_11121153
545 Ga0074259_10819813
546 Ga0070679_100000730
547 Ga0070679_100000876
548 Ga0070679_100014684
549 Ga0070679_100174500
550 Ga0070679_101136073
551 Ga0070679_101303276
552 Ga0070679_101426450
553 Ga0070679_101527394
554 Ga0070679_101702570
555 Ga0070679_101842572
556 Ga0070684_100015260
557 Ga0070684_100076505
558 Ga0070684_101013252
559 Ga0068853_100156676
560 Ga0070686_100013698
561 Ga0070686_100516488
562 Ga0070686_100548080
563 Ga0070696_100217164
564 Ga0070693_100983047
565 Ga0070665_100019550
566 Ga0070665_100502732
567 Ga0068855_100000003
568 Ga0068855_100011595
569 Ga0068855_100016848
570 Ga0068855_100241041
571 Ga0068855_100457997
572 Ga0068855_100791713
573 Ga0068855_100834723
574 Ga0070664_102199588
575 Ga0068857_100095012
576 Ga0068857_100097710
577 Ga0068857_100195277
578 Ga0068857_101153796
579 Ga0068857_101497729
580 Ga0068854_100664005
581 Ga0068856_100045758
582 Ga0068856_100206437
583 Ga0068856_100593044
584 Ga0068856_101475437
585 Ga0068856_102666803
586 Ga0068852_100100678
587 Ga0068852_102864663
588 Ga0068859_100346624
589 Ga0068859_100468632
590 Ga0068864_102539076
591 Ga0068863_100187815
592 Ga0068863_101073324
593 Ga0068860_100072682
594 Ga0068860_100961416
595 Ga0081539_10001746
596 Ga0075365_10000020
597 Ga0075365_10084867
598 Ga0075365_10114163
599 Ga0075365_10271323
600 Ga0075365_10702780
601 Ga0075368_10000003
602 Ga0075363_100000016
603 Ga0075363_100534691
604 Ga0075364_10001774
605 Ga0075364_10002093
606 Ga0075364_10013993
607 Ga0075364_10214442
608 Ga0075364_10386280
609 Ga0075364_10463477
610 Ga0075364_10902505
611 Ga0075362_10000073
612 Ga0075362_10339577
613 Ga0075367_10000034
614 Ga0075369_10000005
615 Ga0075369_10000051
616 Ga0075369_10109021
617 Ga0075369_10119698
618 Ga0075369_10265553
619 Ga0075369_10447919
620 Ga0075366_10000001
621 Ga0075366_10000044
622 Ga0075366_10000083
623 Ga0075366_10066203
624 Ga0075366_10075027
625 Ga0075366_10203540
626 Ga0097621_100296810
627 Ga0075370_10000307
628 Ga0075370_10059008
629 Ga0075370_10963582
630 Ga0075370_10985905
631 Ga0068871_100000055
632 Ga0075428_102454948
633 Ga0097620_100346613
634 Ga0097620_100468616
635 Ga0105240_10033473
636 Ga0105240_10255468
637 Ga0105240_10364004
638 Ga0105240_10617419
639 Ga0111539_10012227
640 Ga0105245_10000002
641 Ga0105245_10548213
642 Ga0105247_11054547
643 Ga0105247_11374298
644 Ga0105243_10657311
645 Ga0105241_10080012
646 Ga0105241_10997156
647 Ga0105241_11114811
648 Ga0105242_10015406
649 Ga0105248_10239584
650 Ga0105248_10615782
651 Ga0105248_11177587
652 Ga0105237_11075306
653 Ga0105238_11582380
654 Ga0105249_10004190
655 Ga0105249_10775217
656 Ga0105239_10242537
657 Ga0105239_10782975
658 Ga0105239_12075173
659 Ga0157373_10000042
660 Ga0157371_11295029
661 Ga0157370_10092687
662 Ga0157370_10322705
663 Ga0157369_10928287
664 Ga0157369_12038625
665 Ga0157374_10000031
666 Ga0157374_10001387
667 Ga0157374_10003340
668 Ga0157374_10725608
669 Ga0157374_11109786
670 Ga0157372_11580058
671 Ga0163163_10215507
672 Ga0163163_10890309
673 Ga0157380_10190906
674 Ga0157379_12585395
675 Ga0206351_10272916
676 Ga0154015_1394197
677 Ga0207710_10609954
678 Ga0207680_10055319
679 Ga0207647_10000458
680 Ga0207645_10005159
681 Ga0207705_10000011
682 Ga0207705_10000327
683 Ga0207705_10004428
684 Ga0207705_10007475
685 Ga0207705_10020453
686 Ga0207705_10027442
687 Ga0207705_10858708
688 Ga0207705_11288503
689 Ga0207705_11361345
690 Ga0207654_10000002
691 Ga0207654_10064496
692 Ga0207654_10069902
693 Ga0207654_10491864
694 Ga0207654_10737581
695 Ga0207707_10011863
696 Ga0207707_10129466
697 Ga0207707_10215219
698 Ga0207707_10278207
699 Ga0207707_10779183
700 Ga0207707_10932984
701 Ga0207695_10046405
702 Ga0207695_10151527
703 Ga0207695_10160564
704 Ga0207695_10509514
705 Ga0207695_11703277
706 Ga0207671_10424219
707 Ga0207671_10426287
708 Ga0207671_10611767
709 Ga0207660_10004973
710 Ga0207660_10010648
711 Ga0207660_10169896
712 Ga0207660_10470079
713 Ga0207657_10001246
714 Ga0207657_10004983
715 Ga0207657_10683429
716 Ga0207649_10090195
717 Ga0207649_10959575
718 Ga0207652_10000906
719 Ga0207652_10002999
720 Ga0207652_10003903
721 Ga0207652_10004857
722 Ga0207652_10018146
723 Ga0207652_10131350
724 Ga0207652_10422192
725 Ga0207652_10612524
726 Ga0207652_11374080
727 Ga0207652_11407373
728 Ga0207652_11879068
729 Ga0207681_10212348
730 Ga0207694_10004584
731 Ga0207694_10224365
732 Ga0207694_10298548
733 Ga0207694_10725322
734 Ga0207687_10000001
735 Ga0207687_10416144
736 Ga0207687_10740416
737 Ga0207664_10000269
738 Ga0207644_10000001
739 Ga0207644_10016581
740 Ga0207690_10002993
741 Ga0207686_10018414
742 Ga0207709_10014139
743 Ga0207709_10152425
744 Ga0207670_11808652
745 Ga0207669_10009507
746 Ga0207711_11007634
747 Ga0207661_10000359
748 Ga0207661_10232114
749 Ga0207661_10557094
750 Ga0207661_10631622
751 Ga0207667_10000008
752 Ga0207667_10000466
753 Ga0207667_10002118
754 Ga0207667_10021272
755 Ga0207667_10066886
756 Ga0207667_10332050
757 Ga0207667_10593930
758 Ga0207667_10935502
759 Ga0207651_11562826
760 Ga0207651_12139006
761 Ga0207712_10002011
762 Ga0207712_10680186
763 Ga0207658_10000003
764 Ga0207639_10010803
765 Ga0207639_10019128
766 Ga0207639_12004352
767 Ga0207639_12175982
768 Ga0207702_10004326
769 Ga0207702_10171656
770 Ga0207702_10229960
771 Ga0207702_11597863
772 Ga0207702_12189092
773 Ga0207674_10000001
774 Ga0207674_10008752
775 Ga0207674_10217946
776 Ga0207674_10579317
777 Ga0207674_11411002
778 Ga0207674_11683986
779 Ga0207698_10010530
780 Ga0207698_12546958
781 Ga0209998_10160707
782 Ga0209813_10000004
783 Ga0209813_10029685
784 Ga0207428_10008431
785 Ga0268266_10001150
786 Ga0268264_10122143
787 Ga0268264_10937144
788 Ga0265337_1000836
789 Ga0265337_1001897
790 Ga0265337_1001932
791 Ga0265337_1021129
792 Ga0265337_1065685
793 Ga0265326_10006303
794 Ga0265326_10008194
795 Ga0265319_1007660
796 Ga0265319_1008458
797 Ga0265334_10000032
798 Ga0265334_10003365
799 Ga0265334_10033553
800 Ga0265334_10034375
801 Ga0265334_10149697
802 Ga0265322_10017029
803 Ga0265322_10080820
804 Ga0265336_10002635
805 Ga0265336_10002777
806 Ga0265336_10082853
807 Ga0265338_10000054
808 Ga0265338_10000192
809 Ga0265338_10000482
810 Ga0265338_10002389
811 Ga0265338_10003756
812 Ga0265338_10007578
813 Ga0265338_10030060
814 Ga0265338_10046688
815 Ga0265338_10074297
816 Ga0265338_10238937
817 Ga0265338_10718470
818 Ga0265324_10010164
819 Ga0265324_10014054
820 Ga0265324_10033292
821 Ga0265332_10435041
822 Ga0265320_10048535
823 Ga0265325_10118362
824 Ga0265329_10331793
825 Ga0265340_10000077
826 Ga0265339_10053095
827 Ga0265327_10004080
828 Ga0265327_10070817
829 Ga0265327_10121589
830 Ga0265316_10038388
831 Ga0265316_10103108
832 Ga0265316_10231544
833 Ga0265316_10256885
834 Ga0265316_10565568
835 Ga0265313_10118050
836 Ga0265314_10135997
837 Ga0265342_10355166
838 Ga0307407_10567734
839 Ga0307415_101212552
840 Ga0395899_0001600
841 Ga0395899_0002540
842 Ga0395900_0000232
843 Ga0395900_0001931
844 Ga0395900_0024461
845 Ga0395900_0079748
846 Ga0395900_0119289
847 Ga0395900_0391664
848 Ga0395898_0004193
849 Ga0395898_0036662
850 Ga0395898_0075016
851 Ga0395898_0090571
852 Ga0395898_0460906
853 Ga0395905_0070586
854 Ga0395905_0083595
855 Ga0395905_0181419
856 Ga0395905_0701593
857 Ga0395905_0750358
858 Ga0395901_0000680
859 Ga0395901_0001919
860 Ga0395901_0039888
861 Ga0395901_0249052
862 Ga0395901_0519159
863 Ga0395901_0621780
864 Ga0451793_0535451
865 Ga0451797_0140699
866 Ga0451798_0643091
867 Ga0451807_0162086
868 Ga0451807_1300082
869 Ga0466966_0366370
870 Ga0466959_0701780
871 Ga0466967_0362316
872 Ga0495588_0000116
873 Ga0495658_0587755
874 Ga0495671_0326911
875 Ga0495671_0393589
876 Ga0496100_0007722
877 Ga0496105_0723800
878 Ga0496112_0163422
879 Ga0496125_0080479
880 Ga0501031_0000163
881 Ga0501032_0002271
882 Ga0501033_0106016
883 Ga0501033_0805250
884 Ga0501034_0006713
885 Ga0501034_0007892
886 Ga0501034_1579148
887 Ga0501036_0018114
888 Ga0501036_0769983
889 Ga0501037_0000121
890 Ga0501038_0010627
891 Ga0501038_0286170
892 Ga0501039_0138439
893 Ga0501042_0174208
894 Ga0501042_1290429
895 Ga0501043_0018247
896 Ga0501046_0000138
897 Ga0501047_0000397
898 Ga0501047_0000681
899 Ga0501048_0000361
900 Ga0501048_0026878
901 Ga0501070_0384200
902 Ga0501070_0522545
903 Ga0501073_0047232
904 Ga0501073_0074583
905 Ga0501080_0000133
906 Ga0501083_0012944
907 Ga0501035_0000033
908 Ga0501035_0000765
909 Ga0501044_0164019
910 nmdc:mga03683_6719_c3
911 nmdc:mga03n38_123487_c2
912 nmdc:mga03n38_22_c1
913 nmdc:mga00v17_21483_c1
914 nmdc:mga00v17_702_c1
915 nmdc:mga00v17_74234_c1
916 nmdc:mga0yw44_1227033_c1
917 nmdc:mga0yw44_193195_c1
918 nmdc:mga0yw44_2_c1
919 nmdc:mga0yw44_64260_c1
920 nmdc:mga0k408_114_c1
921 nmdc:mga0k408_8008_c1
922 nmdc:mga06z11_6_c1
923 nmdc:mga04h51_4_c1
924 nmdc:mga07m45_7456_c1
925 nmdc:mga07m45_869795_c1
926 nmdc:mga08y16_8783_c1
927 nmdc:mga0sz30_114550_c1
928 nmdc:mga0sz30_127998_c1
929 nmdc:mga0sz30_128074_c1
930 nmdc:mga0sz30_1_c1
931 Ga0500610_0008991
932 Ga0500643_000038
933 Ga0500643_000043
934 Ga0500644_0000347
935 Ga0500583_0000137
936 Ga0500583_0008340
937 Ga0500651_0000045
938 Ga0500651_0000441
939 Ga0500555_000001
940 Ga0500555_028471
941 Ga0500614_000001
942 Ga0500614_000525
943 Ga0500621_247724
944 Ga0500642_0007922
945 Ga0500561_0000001
946 Ga0500568_0003383
947 Ga0500568_0016761
948 Ga0500577_0004024
949 Ga0500588_0267069
950 Ga0500589_000016
951 Ga0500589_258520
952 Ga0500604_0017862
953 Ga0500616_0000005
954 Ga0500649_000013
955 Ga0500570_000005
956 Ga0500611_000259
957 Ga0500611_039054
958 Ga0500599_093133
959 Ga0587094_105389
960 Ga0587069_116402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

25

84

0.95

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

27

92

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c10-assembly2.cif.gz_B dithiol cgrx1 0.9267 4 82
7c10-assembly1.cif.gz_A dithiol cgrx1 0.9241 4 82
7c10-assembly2.cif.gz_B dithiol cgrx1 0.915 4 82
3zit-assembly1.cif.gz_A crystal structure of the thioredoxin-like protein bc3987 mutant t8a 0.9125 4 82
3zij-assembly2.cif.gz_B crystal structure of the thioredoxin-like protein bc3987 0.9072 4 80
ID Description Score Start End Superfamily
3zijB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9072 4 80 3.40.30.10
4fiwA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8987 5 79 3.40.30.10
af_Q54XE7_2_89_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8959 4 57 3.40.30.10
3zijB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8845 4 80 3.40.30.10
af_A4HYU2_3_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8601 4 59 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1F7RF92-F1-model_v4 Glutaredoxin domain-containing protein 0.9885 1 82
AF-A0A7W1KGP9-F1-model_v4 Glutaredoxin family protein 0.9878 1 82
AF-A0A2M7TUG3-F1-model_v4 Glutaredoxin domain-containing protein 0.9803 1 82 GO:0009055
GO:0045454
AF-A0A2M7TUG3-F1-model_v4 Glutaredoxin domain-containing protein 0.9687 1 82 GO:0009055
GO:0045454
AF-A0A7Z0VNG9-F1-model_v4 Glutaredoxin-3 0.963 4 59 GO:0009055
GO:0045454

Map