F452276

General Info

Members Datasets Scaffolds Average Seq Length
480 254 960 280

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0068545|Ga0495648_0068545_785_1705
Length 306
Sequence MSGSIIEICAPSRAEENRAMSRFAYVNGRFVRHGEAAVHIEDRGYQLADGVYEVWAVFGGKLADAAGHFTRLWRSLDALKIAHPMSEKALTVVLREAIRRNKVREGMVYLQVTRGVAPRDHAFPNPAVPPAVVITAKRVDRAVAEAKAAKGQSVVTVPETRWGRCDIKSIGLLPNALAKQVAREHGAVEAWFVDELGLVTEGASSNAXIVDAEGRLRTRDTQANILRGITRSSLLEVIAEAGLPVAEQPFTVEEAKAAREAFITGAGTLVLPIVSVDGAQIGDGKPGPVATRLRRLYIERAKAAAI

Samples

Sample ID Description Type Environment
1 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
202 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
203 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
204 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
207 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
208 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
213 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
214 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
218 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
219 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
221 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
222 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
223 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
224 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
225 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
226 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
227 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
228 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
229 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
230 2643221583 Caulobacter sp. Root655 Isolate Unclassified
231 2643221584 Caulobacter sp. Root656 Isolate Unclassified
232 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
233 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
234 2643221640 Caulobacter sp. Root342 Isolate Unclassified
235 2643221642 Caulobacter sp. Root343 Isolate Unclassified
236 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
237 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
238 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
239 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
240 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
241 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
242 2818991435 Caulobacter henricii 536 Isolate Unclassified
243 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
244 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
245 2849560528 Caulobacter zeae 410 Isolate Unclassified
246 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
247 2851153111 Caulobacter radicis 736 Isolate Unclassified
248 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
249 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
250 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
251 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
252 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
253 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
254 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 0
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.04
Nodule 0
Rhizoplane 3.33
Rhizosphere 65.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495648_0068545 3300046524 Bacteria 2069
2 JGI25153J46596_10011054 3300003215 Bacteria 4021
3 rootH1_10024972 3300003316 Bacteria 2419
4 rootL2_10016341 3300003322 Bacteria 1170
5 rootL2_10108629 3300003322 Bacteria 2276
6 Ga0055537_1001548 3300003773 Bacteria 8793
7 Ga0055536_1001784 3300003781 Bacteria 12672
8 Ga0055536_1001785 3300003781 Bacteria 12671
9 Ga0055536_1004131 3300003781 Bacteria 7528
10 Ga0055528_1009282 3300003790 Bacteria 4123
11 Ga0055530_10002235 3300003791 Bacteria 12741
12 Ga0055530_10002261 3300003791 Bacteria 12672
13 Ga0055530_10012334 3300003791 Bacteria 2990
14 Ga0055531_10001651 3300003794 Bacteria 16116
15 Ga0055531_10003859 3300003794 Bacteria 9380
16 Ga0055531_10004432 3300003794 Bacteria 8554
17 Ga0055531_10021933 3300003794 Bacteria 2454
18 Ga0065165_1000277 3300005262 Bacteria 87540
19 Ga0065165_1000979 3300005262 Bacteria 35374
20 Ga0070658_10141448 3300005327 Bacteria 2010
21 Ga0070670_100000037 3300005331 Bacteria 156070
22 Ga0070670_100128993 3300005331 Bacteria 2183
23 Ga0070670_100221763 3300005331 Bacteria 1645
24 Ga0070666_10038205 3300005335 Bacteria 3194
25 Ga0070666_10083827 3300005335 Bacteria 2181
26 Ga0070682_100374245 3300005337 Bacteria 1069
27 Ga0068868_100088795 3300005338 Bacteria 2488
28 Ga0070660_100025974 3300005339 Bacteria 4358
29 Ga0070660_100039179 3300005339 Bacteria 3601
30 Ga0070689_100552643 3300005340 Bacteria 992
31 Ga0070691_10016761 3300005341 Bacteria 3369
32 Ga0070668_100000097 3300005347 Bacteria 53800
33 Ga0070668_100003647 3300005347 Bacteria 11362
34 Ga0070668_100008258 3300005347 Bacteria 7728
35 Ga0070668_100032514 3300005347 Bacteria 3970
36 Ga0070669_100009680 3300005353 Bacteria 6864
37 Ga0070669_100224256 3300005353 Bacteria 1487
38 Ga0070671_100015818 3300005355 Bacteria 6094
39 Ga0070673_100063025 3300005364 Bacteria 2948
40 Ga0070659_100000206 3300005366 Bacteria 45867
41 Ga0070659_100082619 3300005366 Bacteria 2566
42 Ga0070667_100000083 3300005367 Bacteria 118261
43 Ga0070667_100015009 3300005367 Bacteria 6400
44 Ga0070667_100019958 3300005367 Bacteria 5563
45 Ga0070662_100057312 3300005457 Bacteria 2831
46 Ga0070681_10020463 3300005458 Bacteria 6632
47 Ga0070681_10102470 3300005458 Bacteria 2807
48 Ga0070681_10137131 3300005458 Bacteria 2377
49 Ga0070679_100014435 3300005530 Bacteria 7586
50 Ga0070679_100118978 3300005530 Bacteria 2626
51 Ga0068853_100117512 3300005539 Bacteria 2368
52 Ga0068853_100219238 3300005539 Bacteria 1737
53 Ga0070665_100000116 3300005548 Bacteria 150141
54 Ga0070665_100000278 3300005548 Bacteria 84248
55 Ga0070665_100002488 3300005548 Bacteria 20280
56 Ga0070665_100019655 3300005548 Bacteria 6779
57 Ga0070665_100089774 3300005548 Bacteria 3079
58 Ga0068855_100153498 3300005563 Bacteria 2617
59 Ga0068855_100163838 3300005563 Bacteria 2522
60 Ga0068855_100334574 3300005563 Bacteria 1671
61 Ga0068856_100217689 3300005614 Bacteria 1925
62 Ga0068852_100069141 3300005616 Bacteria 3094
63 Ga0068859_100008475 3300005617 Bacteria 10403
64 Ga0068859_100012653 3300005617 Bacteria 8482
65 Ga0068859_100317326 3300005617 Bacteria 1652
66 Ga0068864_100000115 3300005618 Bacteria 79542
67 Ga0068864_100001225 3300005618 Bacteria 21325
68 Ga0068864_100012817 3300005618 Bacteria 6932
69 Ga0068864_100045218 3300005618 Bacteria 3777
70 Ga0068861_100366727 3300005719 Bacteria 1268
71 Ga0068863_100000007 3300005841 Bacteria 257578
72 Ga0068863_100000392 3300005841 Bacteria 44421
73 Ga0068863_100001891 3300005841 Bacteria 20782
74 Ga0068863_100071096 3300005841 Bacteria 3292
75 Ga0068858_100000031 3300005842 Bacteria 143397
76 Ga0068858_100009930 3300005842 Bacteria 9041
77 Ga0068858_100058358 3300005842 Bacteria 3568
78 Ga0068860_100000128 3300005843 Bacteria 122731
79 Ga0068860_100000145 3300005843 Bacteria 115830
80 Ga0068860_100053593 3300005843 Bacteria 3835
81 Ga0068860_100081778 3300005843 Bacteria 3071
82 Ga0068860_100211397 3300005843 Bacteria 1882
83 Ga0068862_100000121 3300005844 Bacteria 91849
84 Ga0068862_100041215 3300005844 Bacteria 3929
85 Ga0068862_100098611 3300005844 Bacteria 2553
86 Ga0068862_100128607 3300005844 Bacteria 2238
87 Ga0070717_10082704 3300006028 Bacteria 2699
88 Ga0075368_10000507 3300006042 Bacteria 11578
89 Ga0075367_10028953 3300006178 Bacteria 3164
90 Ga0075369_10017537 3300006186 Bacteria 2903
91 Ga0075366_10038607 3300006195 Bacteria 2820
92 Ga0075370_10121370 3300006353 Bacteria 1521
93 Ga0075370_10146693 3300006353 Bacteria 1381
94 Ga0068865_100001650 3300006881 Bacteria 13080
95 Ga0097620_100008475 3300006931 Bacteria 10403
96 Ga0097620_100012653 3300006931 Bacteria 8482
97 Ga0097620_100317314 3300006931 Bacteria 1652
98 Ga0105240_10002344 3300009093 Bacteria 30572
99 Ga0105240_10003036 3300009093 Bacteria 26403
100 Ga0105240_10103156 3300009093 Bacteria 3466
101 Ga0105240_10195224 3300009093 Bacteria 2377
102 Ga0105240_10430017 3300009093 Bacteria 1481
103 Ga0105240_10593506 3300009093 Bacteria 1220
104 Ga0105240_10626944 3300009093 Bacteria 1181
105 Ga0105241_10141161 3300009174 Bacteria 1961
106 Ga0105248_10021528 3300009177 Bacteria 7141
107 Ga0105248_10030040 3300009177 Bacteria 6065
108 Ga0105248_10167635 3300009177 Bacteria 2475
109 Ga0105248_10340869 3300009177 Bacteria 1687
110 Ga0105238_10002686 3300009551 Bacteria 17688
111 Ga0105238_10036220 3300009551 Bacteria 5015
112 Ga0105238_10072766 3300009551 Bacteria 3432
113 Ga0105238_10081313 3300009551 Bacteria 3229
114 Ga0105238_10172779 3300009551 Bacteria 2137
115 Ga0105238_10526611 3300009551 Bacteria 1185
116 Ga0105249_10000410 3300009553 Bacteria 41122
117 Ga0105239_10364604 3300010375 Bacteria 1632
118 Ga0157373_10000955 3300013100 Bacteria 22427
119 Ga0157373_10001704 3300013100 Bacteria 16742
120 Ga0157371_10211905 3300013102 Bacteria 1390
121 Ga0157370_10064898 3300013104 Bacteria 3455
122 Ga0157375_10020078 3300013308 Bacteria 6097
123 Ga0163163_10002453 3300014325 Bacteria 15680
124 Ga0163163_10008010 3300014325 Bacteria 9352
125 Ga0163163_10154580 3300014325 Bacteria 2338
126 Ga0163163_10334391 3300014325 Bacteria 1569
127 Ga0157379_10002929 3300014968 Bacteria 14405
128 Ga0157379_10027128 3300014968 Bacteria 5099
129 Ga0157379_10287489 3300014968 Bacteria 1497
130 Ga0213876_10000108 3300021384 Bacteria 91222
131 Ga0213876_10023034 3300021384 Bacteria 3291
132 Ga0209026_1000755 3300025250 Bacteria 18340
133 Ga0209148_1011724 3300025254 Bacteria 1622
134 Ga0209565_1000475 3300025263 Bacteria 29667
135 Ga0209673_1000941 3300025273 Bacteria 36504
136 Ga0209675_1006647 3300025291 Bacteria 4596
137 Ga0209676_1000057 3300025292 Bacteria 361061
138 Ga0209676_1000061 3300025292 Bacteria 332674
139 Ga0209676_1001335 3300025292 Bacteria 24868
140 Ga0209676_1002066 3300025292 Bacteria 15614
141 Ga0209564_1005262 3300025295 Bacteria 7468
142 Ga0209758_1001598 3300025297 Bacteria 25915
143 Ga0209758_1002304 3300025297 Bacteria 19732
144 Ga0209758_1004011 3300025297 Bacteria 12728
145 Ga0209050_1000135 3300025298 Bacteria 184020
146 Ga0209050_1000200 3300025298 Bacteria 134115
147 Ga0209050_1001221 3300025298 Bacteria 29961
148 Ga0209050_1013858 3300025298 Bacteria 3536
149 Ga0209050_1034697 3300025298 Bacteria 1504
150 Ga0209256_1001833 3300025299 Bacteria 19808
151 Ga0209256_1002440 3300025299 Bacteria 15186
152 Ga0209256_1011418 3300025299 Bacteria 3554
153 Ga0209051_1003169 3300025303 Bacteria 11021
154 Ga0209257_1000225 3300025304 Bacteria 134023
155 Ga0209257_1000350 3300025304 Bacteria 95008
156 Ga0209257_1000439 3300025304 Bacteria 79332
157 Ga0209257_1001135 3300025304 Bacteria 34110
158 Ga0209257_1001883 3300025304 Bacteria 22693
159 Ga0209257_1002835 3300025304 Bacteria 16261
160 Ga0207710_10034491 3300025900 Bacteria 2223
161 Ga0207680_10012538 3300025903 Bacteria 4320
162 Ga0207680_10242654 3300025903 Bacteria 1242
163 Ga0207705_10142704 3300025909 Bacteria 1789
164 Ga0207707_10034064 3300025912 Bacteria 4457
165 Ga0207707_10048598 3300025912 Bacteria 3695
166 Ga0207695_10001670 3300025913 Bacteria 35733
167 Ga0207695_10001727 3300025913 Bacteria 34901
168 Ga0207695_10011998 3300025913 Bacteria 10426
169 Ga0207695_10012731 3300025913 Bacteria 10072
170 Ga0207695_10123334 3300025913 Bacteria 2556
171 Ga0207695_10420739 3300025913 Bacteria 1220
172 Ga0207671_10230941 3300025914 Bacteria 1451
173 Ga0207660_10006796 3300025917 Bacteria 7410
174 Ga0207657_10011260 3300025919 Bacteria 8888
175 Ga0207657_10068631 3300025919 Bacteria 3011
176 Ga0207652_10016562 3300025921 Bacteria 6019
177 Ga0207652_10049768 3300025921 Bacteria 3588
178 Ga0207681_10008523 3300025923 Bacteria 6260
179 Ga0207681_10026538 3300025923 Bacteria 3737
180 Ga0207694_10042964 3300025924 Bacteria 3488
181 Ga0207694_10131721 3300025924 Bacteria 2005
182 Ga0207694_10151387 3300025924 Bacteria 1869
183 Ga0207650_10000099 3300025925 Bacteria 113522
184 Ga0207650_10029759 3300025925 Bacteria 3928
185 Ga0207650_10104513 3300025925 Bacteria 2185
186 Ga0207644_10010335 3300025931 Bacteria 6152
187 Ga0207690_10000129 3300025932 Bacteria 62350
188 Ga0207690_10025820 3300025932 Bacteria 3693
189 Ga0207706_10031495 3300025933 Bacteria 4724
190 Ga0207704_10001553 3300025938 Bacteria 10296
191 Ga0207711_10015019 3300025941 Bacteria 6432
192 Ga0207711_10045768 3300025941 Bacteria 3739
193 Ga0207667_10029177 3300025949 Bacteria 5984
194 Ga0207667_10105079 3300025949 Bacteria 2913
195 Ga0207667_10109530 3300025949 Bacteria 2848
196 Ga0207651_10051441 3300025960 Bacteria 2803
197 Ga0207712_10003410 3300025961 Bacteria 10044
198 Ga0207668_10000028 3300025972 Bacteria 125361
199 Ga0207668_10000828 3300025972 Bacteria 18733
200 Ga0207668_10003243 3300025972 Bacteria 9540
201 Ga0207668_10060410 3300025972 Bacteria 2660
202 Ga0207658_10000209 3300025986 Bacteria 61041
203 Ga0207658_10007659 3300025986 Bacteria 7353
204 Ga0207677_10053357 3300026023 Bacteria 2752
205 Ga0207703_10000038 3300026035 Bacteria 175917
206 Ga0207703_10016753 3300026035 Bacteria 5717
207 Ga0207703_10119100 3300026035 Bacteria 2264
208 Ga0207639_10213845 3300026041 Bacteria 1661
209 Ga0207702_10227814 3300026078 Bacteria 1740
210 Ga0207702_10472443 3300026078 Bacteria 1219
211 Ga0207641_10000012 3300026088 Bacteria 375486
212 Ga0207641_10000341 3300026088 Bacteria 56155
213 Ga0207641_10004917 3300026088 Bacteria 11484
214 Ga0207641_10248795 3300026088 Bacteria 1659
215 Ga0207676_10000610 3300026095 Bacteria 29371
216 Ga0207676_10000637 3300026095 Bacteria 28167
217 Ga0207676_10008902 3300026095 Bacteria 7143
218 Ga0207676_10032695 3300026095 Bacteria 3923
219 Ga0207676_10193065 3300026095 Bacteria 1793
220 Ga0207675_100040064 3300026118 Bacteria 4372
221 Ga0207675_100201814 3300026118 Bacteria 1910
222 Ga0207698_10242929 3300026142 Bacteria 1642
223 Ga0207698_10852606 3300026142 Bacteria 916
224 Ga0209967_1005035 3300027364 Bacteria 1768
225 Ga0210000_1001907 3300027462 Bacteria 2948
226 Ga0209999_1001720 3300027543 Bacteria 3794
227 Ga0209983_1012644 3300027665 Bacteria 1733
228 Ga0268266_10000064 3300028379 Bacteria 249533
229 Ga0268266_10001158 3300028379 Bacteria 32665
230 Ga0268266_10005451 3300028379 Bacteria 11854
231 Ga0268266_10030256 3300028379 Bacteria 4601
232 Ga0268266_10066657 3300028379 Bacteria 3114
233 Ga0268265_10001336 3300028380 Bacteria 21037
234 Ga0268265_10040101 3300028380 Bacteria 3456
235 Ga0268265_10173275 3300028380 Bacteria 1846
236 Ga0268264_10000059 3300028381 Bacteria 306927
237 Ga0268264_10044071 3300028381 Bacteria 3700
238 Ga0268264_10132016 3300028381 Bacteria 2215
239 Ga0265337_1058245 3300028556 Bacteria 1074
240 Ga0265334_10001441 3300028573 Bacteria 11435
241 Ga0307517_10012250 3300028786 Bacteria 11791
242 Ga0307517_10054379 3300028786 Bacteria 3960
243 Ga0307515_10046005 3300028794 Bacteria 6684
244 Ga0265338_10019502 3300028800 Bacteria 7189
245 Ga0265338_10141820 3300028800 Bacteria 1881
246 Ga0265327_10000166 3300031251 Bacteria 141539
247 Ga0265327_10006559 3300031251 Bacteria 9263
248 Ga0265327_10165079 3300031251 Bacteria 1020
249 Ga0307513_10001153 3300031456 Bacteria 38347
250 Ga0307513_10002695 3300031456 Bacteria 24428
251 Ga0307513_10005321 3300031456 Bacteria 17020
252 Ga0307513_10095473 3300031456 Bacteria 3014
253 Ga0316579_10050212 3300031691 Bacteria 1950
254 Ga0265314_10035212 3300031711 Bacteria 3651
255 Ga0307516_10000004 3300031730 Bacteria 367451
256 Ga0307406_10000761 3300031901 Bacteria 18132
257 Ga0307412_10137884 3300031911 Bacteria 1782
258 Ga0307414_10039492 3300032004 Bacteria 3179
259 Ga0307414_10047842 3300032004 Bacteria 2946
260 Ga0307414_10090110 3300032004 Bacteria 2275
261 Ga0307414_10160186 3300032004 Bacteria 1786
262 Ga0307414_10229550 3300032004 Bacteria 1529
263 Ga0307510_10020294 3300033180 Bacteria 7769
264 Ga0373936_0001078 3300035113 Bacteria 9771
265 Ga0373946_0008035 3300035171 Bacteria 3874
266 Ga0373927_0005817 3300035695 Bacteria 8456
267 Ga0373925_0000478 3300037068 Bacteria 39975
268 Ga0373925_0082657 3300037068 Bacteria 2445
269 Ga0395899_0000013 3300037312 Bacteria 510397
270 Ga0395899_0000407 3300037312 Bacteria 50216
271 Ga0395899_0038572 3300037312 Bacteria 3578
272 Ga0395899_0100329 3300037312 Bacteria 2091
273 Ga0395900_0000009 3300037418 Bacteria 476249
274 Ga0395900_0077750 3300037418 Bacteria 3409
275 Ga0395898_0009683 3300037466 Bacteria 10106
276 Ga0395898_0027308 3300037466 Bacteria 5732
277 Ga0395905_0005890 3300037471 Bacteria 12443
278 Ga0395905_0182874 3300037471 Bacteria 1968
279 Ga0395905_0274642 3300037471 Bacteria 1571
280 Ga0395905_0306811 3300037471 Bacteria 1475
281 Ga0395905_0674679 3300037471 Bacteria 936
282 Ga0395901_0000014 3300038443 Bacteria 375100
283 Ga0395901_0279060 3300038443 Bacteria 1736
284 Ga0436365_0504517 3300039437 Bacteria 6100
285 Ga0436365_1544656 3300039437 Bacteria 122419
286 Ga0436365_1718085 3300039437 Bacteria 3611
287 Ga0436361_1148114 3300039447 Bacteria 29234
288 Ga0450901_001515 3300042533 Bacteria 2642
289 Ga0466968_0062017 3300044735 Bacteria 1614
290 Ga0466968_0072576 3300044735 Bacteria 1501
291 Ga0451576_0183262 3300045051 Bacteria 2186
292 Ga0495627_002098 3300046453 Bacteria 10119
293 Ga0495590_0006851 3300046457 Bacteria 4427
294 Ga0495629_0039309 3300046459 Bacteria 3330
295 Ga0495638_0000585 3300046460 Bacteria 41159
296 Ga0495638_0000595 3300046460 Bacteria 40733
297 Ga0495638_0004039 3300046460 Bacteria 11253
298 Ga0495638_0015863 3300046460 Bacteria 5048
299 Ga0495638_0108515 3300046460 Bacteria 1651
300 Ga0495638_0124406 3300046460 Bacteria 1521
301 Ga0495650_0000007 3300046471 Bacteria 718072
302 Ga0495583_0000037 3300046506 Bacteria 244437
303 Ga0495583_0135721 3300046506 Bacteria 1027
304 Ga0495606_0086797 3300046507 Bacteria 1932
305 Ga0495610_0000205 3300046512 Bacteria 65600
306 Ga0495610_0001459 3300046512 Bacteria 20922
307 Ga0495610_0003505 3300046512 Bacteria 12191
308 Ga0495616_0000159 3300046513 Bacteria 58948
309 Ga0495631_0007090 3300046518 Bacteria 5731
310 Ga0495631_0154919 3300046518 Bacteria 983
311 Ga0495632_0005666 3300046519 Bacteria 8212
312 Ga0495632_0036755 3300046519 Bacteria 2489
313 Ga0495632_0047472 3300046519 Bacteria 2129
314 Ga0495637_0005910 3300046520 Bacteria 6186
315 Ga0495637_0029290 3300046520 Bacteria 2452
316 Ga0495637_0062855 3300046520 Bacteria 1518
317 Ga0495643_0013329 3300046522 Bacteria 4924
318 Ga0495648_0054005 3300046524 Bacteria 2430
319 Ga0495654_0000100 3300046530 Bacteria 98615
320 Ga0495654_0030593 3300046530 Bacteria 2738
321 Ga0495597_0033131 3300046542 Bacteria 2341
322 Ga0495622_0023187 3300046557 Bacteria 2893
323 Ga0495668_0000345 3300046616 Bacteria 61921
324 Ga0495668_0002985 3300046616 Bacteria 13224
325 Ga0495668_0024823 3300046616 Bacteria 3408
326 Ga0495668_0031972 3300046616 Bacteria 2963
327 Ga0495625_0000080 3300046660 Bacteria 156895
328 Ga0495625_0007880 3300046660 Bacteria 9174
329 Ga0495625_0011578 3300046660 Bacteria 7179
330 Ga0495625_0044891 3300046660 Bacteria 3197
331 Ga0495625_0071086 3300046660 Bacteria 2442
332 Ga0495625_0116160 3300046660 Bacteria 1825
333 Ga0495625_0192873 3300046660 Bacteria 1348
334 Ga0495669_0000024 3300046684 Bacteria 113943
335 Ga0495669_0065630 3300046684 Bacteria 1648
336 Ga0495669_0068668 3300046684 Bacteria 1613
337 Ga0495670_0113932 3300046691 Bacteria 1401
338 Ga0495670_0339365 3300046691 Bacteria 808
339 Ga0495671_0059220 3300046692 Bacteria 1894
340 Ga0495649_0000868 3300046694 Bacteria 24311
341 Ga0495660_0108582 3300046810 Bacteria 1418
342 Ga0495636_0027952 3300047318 Bacteria 2298
343 Ga0495672_0027862 3300047320 Bacteria 3583
344 Ga0495673_0000132 3300047469 Bacteria 138001
345 Ga0495673_0000330 3300047469 Bacteria 60940
346 Ga0495673_0017258 3300047469 Bacteria 3672
347 Ga0495686_0000525 3300047472 Bacteria 55165
348 Ga0495686_0012848 3300047472 Bacteria 5839
349 Ga0495686_0019298 3300047472 Bacteria 4557
350 Ga0495686_0070101 3300047472 Bacteria 2160
351 Ga0495686_0086162 3300047472 Bacteria 1912
352 Ga0495686_0089482 3300047472 Bacteria 1870
353 Ga0495686_0102822 3300047472 Bacteria 1721
354 Ga0495593_0011453 3300047673 Bacteria 5094
355 Ga0496102_0039205 3300048905 Bacteria 4280
356 Ga0496106_0026740 3300048909 Bacteria 4297
357 Ga0496106_0030270 3300048909 Bacteria 4037
358 Ga0496106_0157077 3300048909 Bacteria 1797
359 Ga0496107_0000110 3300048910 Bacteria 39732
360 Ga0496107_0060824 3300048910 Bacteria 2734
361 Ga0496108_0018026 3300048911 Bacteria 5776
362 Ga0496109_0322731 3300048912 Bacteria 1457
363 Ga0496110_0474655 3300048913 Bacteria 1139
364 Ga0496112_0020401 3300048915 Bacteria 6282
365 Ga0496112_0243332 3300048915 Bacteria 1751
366 Ga0496113_0367287 3300048916 Bacteria 1155
367 Ga0496115_0000598 3300048918 Bacteria 27622
368 Ga0496115_0004231 3300048918 Bacteria 10380
369 Ga0496115_0014971 3300048918 Bacteria 5880
370 Ga0496115_0076963 3300048918 Bacteria 2712
371 Ga0496121_0019891 3300048924 Bacteria 6683
372 Ga0496122_0018335 3300048925 Bacteria 6476
373 Ga0496123_0000539 3300048926 Bacteria 65166
374 Ga0496124_0030836 3300048927 Bacteria 4751
375 Ga0496125_0006744 3300048928 Bacteria 12339
376 Ga0496125_0010256 3300048928 Bacteria 9490
377 Ga0496125_0074667 3300048928 Bacteria 2628
378 Ga0496126_0005285 3300048929 Bacteria 14819
379 Ga0495678_000191 3300049459 Bacteria 71862
380 Ga0495682_0045422 3300049460 Bacteria 1605
381 Ga0501032_0066093 3300049569 Bacteria 2417
382 Ga0501033_0050203 3300049570 Bacteria 3096
383 Ga0501037_0070446 3300049573 Bacteria 2544
384 Ga0501037_0080232 3300049573 Bacteria 2368
385 Ga0501047_0078904 3300049581 Bacteria 3166
386 Ga0501047_0455763 3300049581 Bacteria 1108
387 Ga0501048_0062234 3300049582 Bacteria 2642
388 Ga0501069_0255952 3300049585 Bacteria 1022
389 Ga0501238_004550 3300049671 Bacteria 1738
390 Ga0501035_0031556 3300049822 Bacteria 4825
391 Ga0501044_0011457 3300049823 Bacteria 9606
392 Ga0501044_0016468 3300049823 Bacteria 7935
393 Ga0501044_0224288 3300049823 Bacteria 1829
394 nmdc:mga00v17_405_c1 3300050491 Bacteria 24411
395 nmdc:mga0k408_56455_c1 3300050493 Bacteria 2279
396 nmdc:mga0k408_81943_c1 3300050493 Bacteria 1890
397 nmdc:mga07m45_1752_c1 3300050496 Bacteria 9997
398 nmdc:mga0sz30_23808_c1 3300050516 Bacteria 2495
399 Ga0500578_0000008 3300053086 Bacteria 223557
400 Ga0500643_000376 3300053087 Bacteria 34859
401 Ga0500643_025824 3300053087 Bacteria 1847
402 Ga0500644_0000028 3300053088 Bacteria 92405
403 Ga0500644_0142534 3300053088 Bacteria 954
404 Ga0500651_0006348 3300053093 Bacteria 6807
405 Ga0500641_0000264 3300053096 Bacteria 19552
406 Ga0500641_0027163 3300053096 Bacteria 2227
407 Ga0500650_0149652 3300053098 Bacteria 1080
408 Ga0500556_0000273 3300053104 Bacteria 40555
409 Ga0500556_0001358 3300053104 Bacteria 10788
410 Ga0500556_0016230 3300053104 Bacteria 2313
411 Ga0500562_000706 3300053108 Bacteria 8129
412 Ga0500562_000813 3300053108 Bacteria 7604
413 Ga0500562_000904 3300053108 Bacteria 7193
414 Ga0500562_003507 3300053108 Bacteria 3933
415 Ga0500594_0000015 3300053118 Bacteria 67180
416 Ga0500595_001608 3300053119 Bacteria 11900
417 Ga0500595_050366 3300053119 Bacteria 1293
418 Ga0500608_000025 3300053122 Bacteria 71403
419 Ga0500608_066224 3300053122 Bacteria 1723
420 Ga0500614_002640 3300053123 Bacteria 3971
421 Ga0500618_000034 3300053125 Bacteria 120560
422 Ga0500642_0013799 3300053130 Bacteria 2984
423 Ga0500658_0002444 3300053134 Bacteria 7185
424 Ga0500658_0008800 3300053134 Bacteria 3726
425 Ga0500559_0000005 3300053136 Bacteria 230231
426 Ga0500559_0002934 3300053136 Bacteria 8575
427 Ga0500559_0102368 3300053136 Bacteria 1320
428 Ga0500564_000007 3300053138 Bacteria 84097
429 Ga0500573_0199349 3300053140 Bacteria 1063
430 Ga0500577_0001077 3300053142 Bacteria 7042
431 Ga0500616_0016176 3300053153 Bacteria 4252
432 Ga0500622_0000105 3300053156 Bacteria 85855
433 Ga0500622_0010120 3300053156 Bacteria 5194
434 Ga0500622_0011582 3300053156 Bacteria 4798
435 Ga0500622_0018570 3300053156 Bacteria 3697
436 Ga0500622_0020758 3300053156 Bacteria 3486
437 Ga0500622_0043855 3300053156 Bacteria 2318
438 Ga0500622_0050594 3300053156 Bacteria 2141
439 Ga0500639_089932 3300053163 Bacteria 1531
440 Ga0500576_068527 3300053725 Bacteria 1531
441 Ga0500625_019188 3300053729 Bacteria 3209
442 Ga0500645_000419 3300053730 Bacteria 29374
443 Ga0500645_002080 3300053730 Bacteria 9264
444 Ga0500645_003577 3300053730 Bacteria 6240
445 Ga0500645_004920 3300053730 Bacteria 5022
446 Ga0500596_001239 3300053735 Bacteria 5165
447 2511122761 2510917020 Bacteria 5657507
448 2585148635 2582581279 Bacteria 4980720
449 2585153854 2582581280 Bacteria 5994497
450 2585198067 2582581293 Bacteria 5907401
451 2587916594 2585428106 Bacteria 5179711
452 2643747823 2643221545 Bacteria 5083237
453 2643778509 2643221552 Bacteria 5708754
454 2643883555 2643221574 Bacteria 2789653
455 2643924918 2643221583 Bacteria 5218014
456 2643931336 2643221584 Bacteria 5511711
457 2644000213 2643221598 Bacteria 4578346
458 2644085026 2643221614 Bacteria 4260023
459 2644225875 2643221640 Bacteria 5258820
460 2644235364 2643221642 Bacteria 5357871
461 2644342578 2643221661 Bacteria 4267604
462 2644352040 2643221663 Bacteria 3425771
463 2644365878 2643221666 Bacteria 4265935
464 2644511437 2643221691 Bacteria 5093099
465 2644551909 2643221699 Bacteria 5731501
466 2644553056 2643221699 Bacteria 5731501
467 2792463339 2791355048 Bacteria 5832535
468 2819537961 2818991435 Bacteria 5433759
469 2819648478 2818991454 Bacteria 5563326
470 2843748071 2843744320 Bacteria 5659202
471 2849564890 2849560528 Bacteria 5393480
472 2849574650 2849573788 Bacteria 5421256
473 2851154607 2851153111 Bacteria 5542585
474 2857506234 2857504554 Bacteria 5369913
475 2884964989 2884960567 Bacteria 5437054
476 2898329831 2898329390 Bacteria 5168154
477 2928535262 2928531327 Bacteria 5101314
478 2928974829 2928972540 Bacteria 3058286
479 2941487512 2941485952 Bacteria 3591484
480 2977242127 2977240413 Bacteria 3191065
481 Ga0495648_0068545
482 JGI25153J46596_10011054
483 rootH1_10024972
484 rootL2_10016341
485 rootL2_10108629
486 Ga0055537_1001548
487 Ga0055536_1001784
488 Ga0055536_1001785
489 Ga0055536_1004131
490 Ga0055528_1009282
491 Ga0055530_10002235
492 Ga0055530_10002261
493 Ga0055530_10012334
494 Ga0055531_10001651
495 Ga0055531_10003859
496 Ga0055531_10004432
497 Ga0055531_10021933
498 Ga0065165_1000277
499 Ga0065165_1000979
500 Ga0070658_10141448
501 Ga0070670_100000037
502 Ga0070670_100128993
503 Ga0070670_100221763
504 Ga0070666_10038205
505 Ga0070666_10083827
506 Ga0070682_100374245
507 Ga0068868_100088795
508 Ga0070660_100025974
509 Ga0070660_100039179
510 Ga0070689_100552643
511 Ga0070691_10016761
512 Ga0070668_100000097
513 Ga0070668_100003647
514 Ga0070668_100008258
515 Ga0070668_100032514
516 Ga0070669_100009680
517 Ga0070669_100224256
518 Ga0070671_100015818
519 Ga0070673_100063025
520 Ga0070659_100000206
521 Ga0070659_100082619
522 Ga0070667_100000083
523 Ga0070667_100015009
524 Ga0070667_100019958
525 Ga0070662_100057312
526 Ga0070681_10020463
527 Ga0070681_10102470
528 Ga0070681_10137131
529 Ga0070679_100014435
530 Ga0070679_100118978
531 Ga0068853_100117512
532 Ga0068853_100219238
533 Ga0070665_100000116
534 Ga0070665_100000278
535 Ga0070665_100002488
536 Ga0070665_100019655
537 Ga0070665_100089774
538 Ga0068855_100153498
539 Ga0068855_100163838
540 Ga0068855_100334574
541 Ga0068856_100217689
542 Ga0068852_100069141
543 Ga0068859_100008475
544 Ga0068859_100012653
545 Ga0068859_100317326
546 Ga0068864_100000115
547 Ga0068864_100001225
548 Ga0068864_100012817
549 Ga0068864_100045218
550 Ga0068861_100366727
551 Ga0068863_100000007
552 Ga0068863_100000392
553 Ga0068863_100001891
554 Ga0068863_100071096
555 Ga0068858_100000031
556 Ga0068858_100009930
557 Ga0068858_100058358
558 Ga0068860_100000128
559 Ga0068860_100000145
560 Ga0068860_100053593
561 Ga0068860_100081778
562 Ga0068860_100211397
563 Ga0068862_100000121
564 Ga0068862_100041215
565 Ga0068862_100098611
566 Ga0068862_100128607
567 Ga0070717_10082704
568 Ga0075368_10000507
569 Ga0075367_10028953
570 Ga0075369_10017537
571 Ga0075366_10038607
572 Ga0075370_10121370
573 Ga0075370_10146693
574 Ga0068865_100001650
575 Ga0097620_100008475
576 Ga0097620_100012653
577 Ga0097620_100317314
578 Ga0105240_10002344
579 Ga0105240_10003036
580 Ga0105240_10103156
581 Ga0105240_10195224
582 Ga0105240_10430017
583 Ga0105240_10593506
584 Ga0105240_10626944
585 Ga0105241_10141161
586 Ga0105248_10021528
587 Ga0105248_10030040
588 Ga0105248_10167635
589 Ga0105248_10340869
590 Ga0105238_10002686
591 Ga0105238_10036220
592 Ga0105238_10072766
593 Ga0105238_10081313
594 Ga0105238_10172779
595 Ga0105238_10526611
596 Ga0105249_10000410
597 Ga0105239_10364604
598 Ga0157373_10000955
599 Ga0157373_10001704
600 Ga0157371_10211905
601 Ga0157370_10064898
602 Ga0157375_10020078
603 Ga0163163_10002453
604 Ga0163163_10008010
605 Ga0163163_10154580
606 Ga0163163_10334391
607 Ga0157379_10002929
608 Ga0157379_10027128
609 Ga0157379_10287489
610 Ga0213876_10000108
611 Ga0213876_10023034
612 Ga0209026_1000755
613 Ga0209148_1011724
614 Ga0209565_1000475
615 Ga0209673_1000941
616 Ga0209675_1006647
617 Ga0209676_1000057
618 Ga0209676_1000061
619 Ga0209676_1001335
620 Ga0209676_1002066
621 Ga0209564_1005262
622 Ga0209758_1001598
623 Ga0209758_1002304
624 Ga0209758_1004011
625 Ga0209050_1000135
626 Ga0209050_1000200
627 Ga0209050_1001221
628 Ga0209050_1013858
629 Ga0209050_1034697
630 Ga0209256_1001833
631 Ga0209256_1002440
632 Ga0209256_1011418
633 Ga0209051_1003169
634 Ga0209257_1000225
635 Ga0209257_1000350
636 Ga0209257_1000439
637 Ga0209257_1001135
638 Ga0209257_1001883
639 Ga0209257_1002835
640 Ga0207710_10034491
641 Ga0207680_10012538
642 Ga0207680_10242654
643 Ga0207705_10142704
644 Ga0207707_10034064
645 Ga0207707_10048598
646 Ga0207695_10001670
647 Ga0207695_10001727
648 Ga0207695_10011998
649 Ga0207695_10012731
650 Ga0207695_10123334
651 Ga0207695_10420739
652 Ga0207671_10230941
653 Ga0207660_10006796
654 Ga0207657_10011260
655 Ga0207657_10068631
656 Ga0207652_10016562
657 Ga0207652_10049768
658 Ga0207681_10008523
659 Ga0207681_10026538
660 Ga0207694_10042964
661 Ga0207694_10131721
662 Ga0207694_10151387
663 Ga0207650_10000099
664 Ga0207650_10029759
665 Ga0207650_10104513
666 Ga0207644_10010335
667 Ga0207690_10000129
668 Ga0207690_10025820
669 Ga0207706_10031495
670 Ga0207704_10001553
671 Ga0207711_10015019
672 Ga0207711_10045768
673 Ga0207667_10029177
674 Ga0207667_10105079
675 Ga0207667_10109530
676 Ga0207651_10051441
677 Ga0207712_10003410
678 Ga0207668_10000028
679 Ga0207668_10000828
680 Ga0207668_10003243
681 Ga0207668_10060410
682 Ga0207658_10000209
683 Ga0207658_10007659
684 Ga0207677_10053357
685 Ga0207703_10000038
686 Ga0207703_10016753
687 Ga0207703_10119100
688 Ga0207639_10213845
689 Ga0207702_10227814
690 Ga0207702_10472443
691 Ga0207641_10000012
692 Ga0207641_10000341
693 Ga0207641_10004917
694 Ga0207641_10248795
695 Ga0207676_10000610
696 Ga0207676_10000637
697 Ga0207676_10008902
698 Ga0207676_10032695
699 Ga0207676_10193065
700 Ga0207675_100040064
701 Ga0207675_100201814
702 Ga0207698_10242929
703 Ga0207698_10852606
704 Ga0209967_1005035
705 Ga0210000_1001907
706 Ga0209999_1001720
707 Ga0209983_1012644
708 Ga0268266_10000064
709 Ga0268266_10001158
710 Ga0268266_10005451
711 Ga0268266_10030256
712 Ga0268266_10066657
713 Ga0268265_10001336
714 Ga0268265_10040101
715 Ga0268265_10173275
716 Ga0268264_10000059
717 Ga0268264_10044071
718 Ga0268264_10132016
719 Ga0265337_1058245
720 Ga0265334_10001441
721 Ga0307517_10012250
722 Ga0307517_10054379
723 Ga0307515_10046005
724 Ga0265338_10019502
725 Ga0265338_10141820
726 Ga0265327_10000166
727 Ga0265327_10006559
728 Ga0265327_10165079
729 Ga0307513_10001153
730 Ga0307513_10002695
731 Ga0307513_10005321
732 Ga0307513_10095473
733 Ga0316579_10050212
734 Ga0265314_10035212
735 Ga0307516_10000004
736 Ga0307406_10000761
737 Ga0307412_10137884
738 Ga0307414_10039492
739 Ga0307414_10047842
740 Ga0307414_10090110
741 Ga0307414_10160186
742 Ga0307414_10229550
743 Ga0307510_10020294
744 Ga0373936_0001078
745 Ga0373946_0008035
746 Ga0373927_0005817
747 Ga0373925_0000478
748 Ga0373925_0082657
749 Ga0395899_0000013
750 Ga0395899_0000407
751 Ga0395899_0038572
752 Ga0395899_0100329
753 Ga0395900_0000009
754 Ga0395900_0077750
755 Ga0395898_0009683
756 Ga0395898_0027308
757 Ga0395905_0005890
758 Ga0395905_0182874
759 Ga0395905_0274642
760 Ga0395905_0306811
761 Ga0395905_0674679
762 Ga0395901_0000014
763 Ga0395901_0279060
764 Ga0436365_0504517
765 Ga0436365_1544656
766 Ga0436365_1718085
767 Ga0436361_1148114
768 Ga0450901_001515
769 Ga0466968_0062017
770 Ga0466968_0072576
771 Ga0451576_0183262
772 Ga0495627_002098
773 Ga0495590_0006851
774 Ga0495629_0039309
775 Ga0495638_0000585
776 Ga0495638_0000595
777 Ga0495638_0004039
778 Ga0495638_0015863
779 Ga0495638_0108515
780 Ga0495638_0124406
781 Ga0495650_0000007
782 Ga0495583_0000037
783 Ga0495583_0135721
784 Ga0495606_0086797
785 Ga0495610_0000205
786 Ga0495610_0001459
787 Ga0495610_0003505
788 Ga0495616_0000159
789 Ga0495631_0007090
790 Ga0495631_0154919
791 Ga0495632_0005666
792 Ga0495632_0036755
793 Ga0495632_0047472
794 Ga0495637_0005910
795 Ga0495637_0029290
796 Ga0495637_0062855
797 Ga0495643_0013329
798 Ga0495648_0054005
799 Ga0495654_0000100
800 Ga0495654_0030593
801 Ga0495597_0033131
802 Ga0495622_0023187
803 Ga0495668_0000345
804 Ga0495668_0002985
805 Ga0495668_0024823
806 Ga0495668_0031972
807 Ga0495625_0000080
808 Ga0495625_0007880
809 Ga0495625_0011578
810 Ga0495625_0044891
811 Ga0495625_0071086
812 Ga0495625_0116160
813 Ga0495625_0192873
814 Ga0495669_0000024
815 Ga0495669_0065630
816 Ga0495669_0068668
817 Ga0495670_0113932
818 Ga0495670_0339365
819 Ga0495671_0059220
820 Ga0495649_0000868
821 Ga0495660_0108582
822 Ga0495636_0027952
823 Ga0495672_0027862
824 Ga0495673_0000132
825 Ga0495673_0000330
826 Ga0495673_0017258
827 Ga0495686_0000525
828 Ga0495686_0012848
829 Ga0495686_0019298
830 Ga0495686_0070101
831 Ga0495686_0086162
832 Ga0495686_0089482
833 Ga0495686_0102822
834 Ga0495593_0011453
835 Ga0496102_0039205
836 Ga0496106_0026740
837 Ga0496106_0030270
838 Ga0496106_0157077
839 Ga0496107_0000110
840 Ga0496107_0060824
841 Ga0496108_0018026
842 Ga0496109_0322731
843 Ga0496110_0474655
844 Ga0496112_0020401
845 Ga0496112_0243332
846 Ga0496113_0367287
847 Ga0496115_0000598
848 Ga0496115_0004231
849 Ga0496115_0014971
850 Ga0496115_0076963
851 Ga0496121_0019891
852 Ga0496122_0018335
853 Ga0496123_0000539
854 Ga0496124_0030836
855 Ga0496125_0006744
856 Ga0496125_0010256
857 Ga0496125_0074667
858 Ga0496126_0005285
859 Ga0495678_000191
860 Ga0495682_0045422
861 Ga0501032_0066093
862 Ga0501033_0050203
863 Ga0501037_0070446
864 Ga0501037_0080232
865 Ga0501047_0078904
866 Ga0501047_0455763
867 Ga0501048_0062234
868 Ga0501069_0255952
869 Ga0501238_004550
870 Ga0501035_0031556
871 Ga0501044_0011457
872 Ga0501044_0016468
873 Ga0501044_0224288
874 nmdc:mga00v17_405_c1
875 nmdc:mga0k408_56455_c1
876 nmdc:mga0k408_81943_c1
877 nmdc:mga07m45_1752_c1
878 nmdc:mga0sz30_23808_c1
879 Ga0500578_0000008
880 Ga0500643_000376
881 Ga0500643_025824
882 Ga0500644_0000028
883 Ga0500644_0142534
884 Ga0500651_0006348
885 Ga0500641_0000264
886 Ga0500641_0027163
887 Ga0500650_0149652
888 Ga0500556_0000273
889 Ga0500556_0001358
890 Ga0500556_0016230
891 Ga0500562_000706
892 Ga0500562_000813
893 Ga0500562_000904
894 Ga0500562_003507
895 Ga0500594_0000015
896 Ga0500595_001608
897 Ga0500595_050366
898 Ga0500608_000025
899 Ga0500608_066224
900 Ga0500614_002640
901 Ga0500618_000034
902 Ga0500642_0013799
903 Ga0500658_0002444
904 Ga0500658_0008800
905 Ga0500559_0000005
906 Ga0500559_0002934
907 Ga0500559_0102368
908 Ga0500564_000007
909 Ga0500573_0199349
910 Ga0500577_0001077
911 Ga0500616_0016176
912 Ga0500622_0000105
913 Ga0500622_0010120
914 Ga0500622_0011582
915 Ga0500622_0018570
916 Ga0500622_0020758
917 Ga0500622_0043855
918 Ga0500622_0050594
919 Ga0500639_089932
920 Ga0500576_068527
921 Ga0500625_019188
922 Ga0500645_000419
923 Ga0500645_002080
924 Ga0500645_003577
925 Ga0500645_004920
926 Ga0500596_001239
927 2511122761
928 2585148635
929 2585153854
930 2585198067
931 2587916594
932 2643747823
933 2643778509
934 2643883555
935 2643924918
936 2643931336
937 2644000213
938 2644085026
939 2644225875
940 2644235364
941 2644342578
942 2644352040
943 2644365878
944 2644511437
945 2644551909
946 2644553056
947 2792463339
948 2819537961
949 2819648478
950 2843748071
951 2849564890
952 2849574650
953 2851154607
954 2857506234
955 2884964989
956 2898329831
957 2928535262
958 2928974829
959 2941487512
960 2977242127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

50

276

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dab-assembly1.cif.gz_A l201a mutant of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate 0.9603 4 280
4daa-assembly1.cif.gz_A crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form 0.9594 4 280
5daa-assembly1.cif.gz_B e177k mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate 0.9582 4 280
1g2w-assembly1.cif.gz_B e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase 0.9576 4 280
4daa-assembly1.cif.gz_A crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form 0.946 4 280
ID Description Score Start End Superfamily
3lqsA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9606 126 280 3.20.10.10
af_Q2FXI0_1_119_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9507 3 120 3.30.470.10
5cm0C01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9446 3 120 3.30.470.10
1a0gA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9406 4 120 3.30.470.10
af_Q2FXI0_1_119_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9355 3 120 3.30.470.10
ID Description Score Start End GO Terms
AF-D6V6F1-F1-model_v4 Probable branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9896 1 280 GO:0005829
GO:0008483
GO:0046394
AF-A0A519KT82-F1-model_v4 branched-chain-amino-acid transaminase (EC 2.6.1.42) 0.9871 170 286 GO:0005829
GO:0046394
GO:0047810
AF-A0A2D5FP47-F1-model_v4 deleted 0.9864 1 279
AF-A0A1H1FX82-F1-model_v4 Probable branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9842 1 280 GO:0005829
GO:0008483
GO:0046394
AF-A0A5M6I7J6-F1-model_v4 Probable branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9767 1 286 GO:0005829
GO:0008483
GO:0046394

Map