F452295

General Info

Members Datasets Scaffolds Average Seq Length
480 258 960 324

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0169076|Ga0501039_0169076_29_1156
Length 375
Sequence MSLTPSAPVGQSRTVTPRRATSRTVAIVAYDGVQALDVTGPHEVFAGASSVLGERPRPRAGYDVSIVALSAGPVRSESGLTLVAGALDPAVAPDTLIVPGGSGVRAAAADAVLVRAVGELAGRARRTVGVCSGAFLLAAXXXXSGRRVTTHWARAASLAERHPDVRVDVDPIWVRDGDVWTSAGVTAGIDVSLALVEDDHGVDVANTVARWLVMFLRRPGGQSQFAAPVWRTRARHDPVRRVQDLIDADPAADLRVGVLAARAAMSERHFLRRFTEEVGMPPARYVAAARVESARRELEQTGDSVAAIAARVGFGTSESMRRTFVRLVGTSPDEYRRHFTHATERRPSLRSPATQAVAGRSLAGAHSLAFVKETQ

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
144 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
233 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
236 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
243 2643221604 Nocardioides sp. Root190 Isolate Unclassified
244 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
245 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
246 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
247 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
248 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
249 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
250 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
251 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
252 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
253 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
254 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
255 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
256 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
257 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
258 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0
Isolates 3.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.46
Nodule 0.21
Rhizoplane 9.17
Rhizosphere 66.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0169076 3300049575 Bacteria 1719
2 LJNas_1004774 3300000546 Bacteria 1494
3 JGI24744J21845_10006017 3300002077 Bacteria 2516
4 rootH2_10331403 3300003320 Bacteria 1148
5 Ga0055540_1005091 3300003792 Bacteria 5673
6 Ga0070683_100079781 3300005329 Bacteria 3063
7 Ga0068869_100017408 3300005334 Bacteria 4869
8 Ga0068868_100047209 3300005338 Bacteria 3373
9 Ga0070689_100028720 3300005340 Bacteria 4207
10 Ga0070691_10001512 3300005341 Bacteria 9995
11 Ga0070668_100001541 3300005347 Bacteria 16627
12 Ga0070675_100234574 3300005354 Bacteria 1601
13 Ga0070671_100019376 3300005355 Bacteria 5537
14 Ga0070671_100034380 3300005355 Bacteria 4196
15 Ga0070671_100069861 3300005355 Bacteria 2929
16 Ga0070674_100003576 3300005356 Bacteria 8740
17 Ga0070673_100179057 3300005364 Bacteria 1814
18 Ga0070688_100003497 3300005365 Bacteria 8096
19 Ga0070667_100002436 3300005367 Bacteria 16263
20 Ga0070667_100003582 3300005367 Bacteria 13217
21 Ga0070667_100030427 3300005367 Bacteria 4503
22 Ga0070709_10064378 3300005434 Bacteria 2345
23 Ga0070714_100030383 3300005435 Bacteria 4496
24 Ga0070714_100054636 3300005435 Bacteria 3412
25 Ga0070713_100036948 3300005436 Bacteria 3946
26 Ga0070713_100186877 3300005436 Bacteria 1865
27 Ga0070710_10002663 3300005437 Bacteria 8483
28 Ga0070710_10004600 3300005437 Bacteria 6522
29 Ga0070710_10025012 3300005437 Bacteria 3157
30 Ga0070710_10055701 3300005437 Bacteria 2235
31 Ga0070701_10000600 3300005438 Bacteria 12563
32 Ga0070711_100009210 3300005439 Bacteria 6070
33 Ga0070711_100012587 3300005439 Bacteria 5290
34 Ga0070705_100343282 3300005440 Bacteria 1086
35 Ga0070700_100017095 3300005441 Bacteria 4141
36 Ga0070694_100008566 3300005444 Bacteria 6261
37 Ga0070694_100298393 3300005444 Bacteria 1234
38 Ga0070663_100044350 3300005455 Bacteria 3134
39 Ga0070678_100011278 3300005456 Bacteria 5506
40 Ga0068867_100015025 3300005459 Bacteria 5488
41 Ga0068867_100091162 3300005459 Bacteria 2313
42 Ga0068853_100012408 3300005539 Bacteria 6932
43 Ga0068853_100018680 3300005539 Bacteria 5741
44 Ga0070693_100174958 3300005547 Bacteria 1378
45 Ga0070665_100002411 3300005548 Bacteria 20609
46 Ga0070665_100025250 3300005548 Bacteria 5987
47 Ga0070665_100085320 3300005548 Bacteria 3163
48 Ga0070665_100099220 3300005548 Bacteria 2916
49 Ga0068852_100168671 3300005616 Bacteria 2050
50 Ga0068859_100004954 3300005617 Bacteria 13524
51 Ga0068859_100008300 3300005617 Bacteria 10524
52 Ga0068864_100124974 3300005618 Bacteria 2304
53 Ga0068866_10000656 3300005718 Bacteria 15727
54 Ga0068861_100017259 3300005719 Bacteria 5119
55 Ga0068861_100286126 3300005719 Bacteria 1421
56 Ga0068863_100001051 3300005841 Bacteria 27597
57 Ga0068858_100005490 3300005842 Bacteria 12416
58 Ga0068858_100009724 3300005842 Bacteria 9157
59 Ga0068860_100000186 3300005843 Bacteria 98982
60 Ga0068860_100008830 3300005843 Bacteria 10039
61 Ga0068860_100090127 3300005843 Bacteria 2920
62 Ga0068862_100000018 3300005844 Bacteria 231245
63 Ga0068862_100005177 3300005844 Bacteria 10958
64 Ga0068862_100111139 3300005844 Bacteria 2405
65 Ga0081455_10091271 3300005937 Bacteria 2467
66 Ga0081455_10119870 3300005937 Bacteria 2074
67 Ga0081540_1052814 3300005983 Bacteria 1997
68 Ga0070717_10007822 3300006028 Bacteria 7954
69 Ga0075365_10003191 3300006038 Bacteria 8374
70 Ga0075365_10017329 3300006038 Bacteria 4405
71 Ga0075365_10028236 3300006038 Bacteria 3577
72 Ga0075365_10028747 3300006038 Bacteria 3547
73 Ga0075365_10070436 3300006038 Bacteria 2352
74 Ga0075368_10087039 3300006042 Bacteria 1275
75 Ga0075363_100001297 3300006048 Bacteria 9318
76 Ga0075363_100030839 3300006048 Bacteria 2777
77 Ga0075363_100034462 3300006048 Bacteria 2643
78 Ga0075363_100036510 3300006048 Bacteria 2577
79 Ga0075363_100066450 3300006048 Bacteria 1952
80 Ga0075363_100070170 3300006048 Bacteria 1902
81 Ga0075364_10000848 3300006051 Bacteria 16105
82 Ga0075364_10008835 3300006051 Bacteria 6031
83 Ga0075364_10015526 3300006051 Bacteria 4725
84 Ga0075364_10024283 3300006051 Bacteria 3847
85 Ga0075364_10109734 3300006051 Bacteria 1840
86 Ga0075364_10218936 3300006051 Bacteria 1292
87 Ga0070716_100001725 3300006173 Bacteria 9859
88 Ga0070712_100022539 3300006175 Bacteria 4151
89 Ga0070712_100026549 3300006175 Bacteria 3859
90 Ga0070712_100086371 3300006175 Bacteria 2286
91 Ga0070712_100439152 3300006175 Bacteria 1085
92 Ga0075362_10015483 3300006177 Bacteria 3103
93 Ga0075362_10024426 3300006177 Bacteria 2564
94 Ga0075362_10042671 3300006177 Bacteria 2006
95 Ga0075367_10014478 3300006178 Bacteria 4270
96 Ga0075369_10000879 3300006186 Bacteria 9958
97 Ga0075369_10007818 3300006186 Bacteria 4090
98 Ga0075369_10009002 3300006186 Bacteria 3863
99 Ga0075369_10027977 3300006186 Bacteria 2360
100 Ga0075369_10035317 3300006186 Bacteria 2124
101 Ga0075369_10052257 3300006186 Bacteria 1771
102 Ga0075369_10088392 3300006186 Bacteria 1381
103 Ga0075369_10121535 3300006186 Bacteria 1182
104 Ga0075370_10000392 3300006353 Bacteria 16194
105 Ga0075370_10000398 3300006353 Bacteria 16078
106 Ga0075370_10016521 3300006353 Bacteria 3971
107 Ga0075370_10046395 3300006353 Bacteria 2459
108 Ga0075370_10181284 3300006353 Bacteria 1240
109 Ga0075428_100003662 3300006844 Bacteria 16848
110 Ga0075428_100110628 3300006844 Bacteria 2993
111 Ga0075430_100029278 3300006846 Bacteria 4674
112 Ga0075430_100051278 3300006846 Bacteria 3478
113 Ga0075431_100107103 3300006847 Bacteria 2884
114 Ga0075434_100082389 3300006871 Bacteria 3214
115 Ga0075436_100051762 3300006914 Bacteria 2833
116 Ga0097620_100004954 3300006931 Bacteria 13524
117 Ga0097620_100008300 3300006931 Bacteria 10524
118 Ga0075435_100016266 3300007076 Bacteria 5608
119 Ga0105245_10122008 3300009098 Bacteria 2436
120 Ga0105247_10000011 3300009101 Bacteria 296480
121 Ga0105247_10145054 3300009101 Bacteria 1559
122 Ga0114129_10010447 3300009147 Bacteria 13240
123 Ga0105243_10011193 3300009148 Bacteria 6786
124 Ga0105242_10000903 3300009176 Bacteria 23039
125 Ga0105242_10059673 3300009176 Bacteria 3131
126 Ga0105248_10000370 3300009177 Bacteria 52274
127 Ga0105248_10001286 3300009177 Bacteria 27975
128 Ga0105248_10547143 3300009177 Bacteria 1306
129 Ga0105237_10007419 3300009545 Bacteria 12008
130 Ga0105237_10010308 3300009545 Bacteria 9956
131 Ga0105249_10000091 3300009553 Bacteria 126848
132 Ga0105249_10001187 3300009553 Bacteria 22997
133 Ga0105249_10055711 3300009553 Bacteria 3618
134 Ga0105033_101116 3300009986 Bacteria 2172
135 Ga0105239_10003250 3300010375 Bacteria 20070
136 Ga0105239_10005756 3300010375 Bacteria 14457
137 Ga0105239_10054794 3300010375 Bacteria 4374
138 Ga0105239_10310594 3300010375 Bacteria 1777
139 Ga0157378_10004710 3300013297 Bacteria 11960
140 Ga0163162_10010156 3300013306 Bacteria 9146
141 Ga0163162_10170749 3300013306 Bacteria 2299
142 Ga0157372_10125331 3300013307 Bacteria 2953
143 Ga0157375_10002646 3300013308 Bacteria 15514
144 Ga0163163_10589443 3300014325 Bacteria 1175
145 Ga0157379_10042829 3300014968 Bacteria 4042
146 Ga0157379_10043015 3300014968 Bacteria 4034
147 Ga0157376_10069910 3300014969 Bacteria 2978
148 Ga0157376_10271723 3300014969 Bacteria 1593
149 Ga0163161_10001083 3300017792 Bacteria 20625
150 Ga0163161_10027293 3300017792 Bacteria 4050
151 Ga0213876_10005156 3300021384 Bacteria 7202
152 Ga0213876_10009045 3300021384 Bacteria 5364
153 Ga0213875_10028800 3300021388 Bacteria 2635
154 Ga0209051_1030827 3300025303 Bacteria 2075
155 Ga0207692_10014535 3300025898 Bacteria 3442
156 Ga0207692_10023531 3300025898 Bacteria 2850
157 Ga0207692_10050302 3300025898 Bacteria 2107
158 Ga0207642_10000620 3300025899 Bacteria 10931
159 Ga0207642_10009491 3300025899 Bacteria 3387
160 Ga0207710_10000006 3300025900 Bacteria 538831
161 Ga0207710_10016334 3300025900 Bacteria 3140
162 Ga0207688_10000257 3300025901 Bacteria 24012
163 Ga0207688_10009346 3300025901 Bacteria 5344
164 Ga0207647_10020145 3300025904 Bacteria 4477
165 Ga0207645_10065782 3300025907 Bacteria 2317
166 Ga0207671_10000177 3300025914 Bacteria 97072
167 Ga0207693_10001089 3300025915 Bacteria 24398
168 Ga0207693_10003989 3300025915 Bacteria 12541
169 Ga0207693_10056058 3300025915 Bacteria 3090
170 Ga0207681_10057332 3300025923 Bacteria 2662
171 Ga0207681_10069005 3300025923 Bacteria 2457
172 Ga0207687_10000655 3300025927 Bacteria 23309
173 Ga0207687_10313189 3300025927 Bacteria 1268
174 Ga0207700_10141650 3300025928 Bacteria 1976
175 Ga0207664_10006593 3300025929 Bacteria 7999
176 Ga0207664_10020870 3300025929 Bacteria 4861
177 Ga0207644_10049501 3300025931 Bacteria 3009
178 Ga0207644_10089656 3300025931 Bacteria 2289
179 Ga0207644_10128448 3300025931 Bacteria 1937
180 Ga0207690_10004951 3300025932 Bacteria 7863
181 Ga0207690_10047930 3300025932 Bacteria 2837
182 Ga0207706_10001480 3300025933 Bacteria 23438
183 Ga0207706_10032368 3300025933 Bacteria 4657
184 Ga0207686_10007135 3300025934 Bacteria 6012
185 Ga0207709_10006201 3300025935 Bacteria 6733
186 Ga0207670_10073642 3300025936 Bacteria 2369
187 Ga0207669_10001190 3300025937 Bacteria 11052
188 Ga0207665_10002679 3300025939 Bacteria 11956
189 Ga0207665_10012133 3300025939 Bacteria 5656
190 Ga0207691_10103195 3300025940 Bacteria 2543
191 Ga0207711_10000080 3300025941 Bacteria 103331
192 Ga0207711_10007470 3300025941 Bacteria 9145
193 Ga0207689_10005414 3300025942 Bacteria 11426
194 Ga0207689_10032244 3300025942 Bacteria 4359
195 Ga0207661_10259888 3300025944 Bacteria 1546
196 Ga0207651_10110191 3300025960 Bacteria 2065
197 Ga0207712_10000061 3300025961 Bacteria 136114
198 Ga0207712_10124408 3300025961 Bacteria 1956
199 Ga0207668_10036731 3300025972 Bacteria 3272
200 Ga0207658_10000123 3300025986 Bacteria 84341
201 Ga0207658_10007674 3300025986 Bacteria 7346
202 Ga0207658_10012443 3300025986 Bacteria 5813
203 Ga0207658_10084684 3300025986 Bacteria 2440
204 Ga0207677_10025746 3300026023 Bacteria 3675
205 Ga0207677_10095617 3300026023 Bacteria 2171
206 Ga0207703_10029110 3300026035 Bacteria 4357
207 Ga0207703_10261162 3300026035 Bacteria 1565
208 Ga0207639_10014086 3300026041 Bacteria 5613
209 Ga0207639_10113674 3300026041 Bacteria 2211
210 Ga0207678_10019391 3300026067 Bacteria 5975
211 Ga0207678_10254797 3300026067 Bacteria 1503
212 Ga0207708_10004354 3300026075 Bacteria 10433
213 Ga0207641_10001081 3300026088 Bacteria 27425
214 Ga0207648_10000555 3300026089 Bacteria 41800
215 Ga0207648_10069316 3300026089 Bacteria 3073
216 Ga0207676_10104599 3300026095 Bacteria 2355
217 Ga0207675_100000629 3300026118 Bacteria 34577
218 Ga0207675_100027115 3300026118 Bacteria 5335
219 Ga0207683_10000731 3300026121 Bacteria 29866
220 Ga0207683_10013618 3300026121 Bacteria 6937
221 Ga0207698_10397378 3300026142 Bacteria 1316
222 Ga0268266_10002019 3300028379 Bacteria 22623
223 Ga0268266_10022918 3300028379 Bacteria 5313
224 Ga0268265_10000005 3300028380 Bacteria 535350
225 Ga0268265_10016023 3300028380 Bacteria 5143
226 Ga0268264_10000177 3300028381 Bacteria 135644
227 Ga0265327_10000246 3300031251 Bacteria 107698
228 Ga0265327_10009361 3300031251 Bacteria 7080
229 Ga0316576_10017763 3300031727 Bacteria 4842
230 Ga0307406_10121279 3300031901 Bacteria 1818
231 Ga0307407_10068183 3300031903 Bacteria 2106
232 Ga0307416_100016759 3300032002 Bacteria 5105
233 Ga0307416_100490438 3300032002 Bacteria 1291
234 Ga0373941_0025903 3300035115 Bacteria 1699
235 Ga0373945_0030235 3300035116 Bacteria 1908
236 Ga0373956_0196118 3300035119 Bacteria 957
237 Ga0373943_0211361 3300035170 Bacteria 1077
238 Ga0373935_0091868 3300035692 Bacteria 1988
239 Ga0373947_0025576 3300035725 Bacteria 3444
240 Ga0373925_0031638 3300037068 Bacteria 3889
241 Ga0436364_0712380 3300037853 Bacteria 2701
242 Ga0400483_268052 3300039062 Bacteria 5187
243 Ga0436365_0124560 3300039437 Bacteria 70307
244 Ga0436365_1106450 3300039437 Bacteria 3651
245 Ga0436363_0119614 3300039450 Bacteria 4190
246 Ga0439436_0005061 3300041404 Bacteria 4037
247 Ga0439439_0017816 3300041406 Bacteria 1750
248 Ga0439461_0000386 3300041410 Bacteria 6298
249 Ga0439461_0038193 3300041410 Bacteria 1028
250 Ga0439466_0002934 3300041411 Bacteria 6666
251 Ga0439465_0007406 3300041413 Bacteria 3487
252 Ga0439465_0032984 3300041413 Bacteria 1654
253 Ga0439465_0039800 3300041413 Bacteria 1518
254 Ga0451841_0059605 3300041498 Bacteria 1230
255 Ga0439431_0007193 3300041997 Bacteria 2479
256 Ga0439433_0005861 3300041999 Bacteria 2641
257 Ga0439457_000450 3300042014 Bacteria 11865
258 Ga0439434_0004334 3300042435 Bacteria 4150
259 Ga0439434_0019350 3300042435 Bacteria 2042
260 Ga0439434_0060809 3300042435 Bacteria 1181
261 Ga0450918_008834 3300042531 Bacteria 1768
262 Ga0466969_0004898 3300044656 Bacteria 7132
263 Ga0466969_0047981 3300044656 Bacteria 2113
264 Ga0466972_0005393 3300044658 Bacteria 6405
265 Ga0466972_0010080 3300044658 Bacteria 4748
266 Ga0466972_0034129 3300044658 Bacteria 2495
267 Ga0466965_0006292 3300044683 Bacteria 5377
268 Ga0466965_0055422 3300044683 Bacteria 1973
269 Ga0466965_0095308 3300044683 Bacteria 1517
270 Ga0466965_0106815 3300044683 Bacteria 1436
271 Ga0466966_0010352 3300044684 Bacteria 6192
272 Ga0466966_0013398 3300044684 Bacteria 5427
273 Ga0466961_0004722 3300044693 Bacteria 8570
274 Ga0466961_0017975 3300044693 Bacteria 4546
275 Ga0466961_0023506 3300044693 Bacteria 3965
276 Ga0466963_0045834 3300044694 Bacteria 2881
277 Ga0466963_0070726 3300044694 Bacteria 2347
278 Ga0466964_0069415 3300044706 Bacteria 1486
279 Ga0466971_0012227 3300044719 Bacteria 3760
280 Ga0466971_0058595 3300044719 Bacteria 1738
281 Ga0466968_0004719 3300044735 Bacteria 5105
282 Ga0466968_0005174 3300044735 Bacteria 4879
283 Ga0466968_0063232 3300044735 Bacteria 1599
284 Ga0466970_0006698 3300044765 Bacteria 5764
285 Ga0466970_0008427 3300044765 Bacteria 5188
286 Ga0466970_0038945 3300044765 Bacteria 2522
287 Ga0466957_0013454 3300044842 Bacteria 4744
288 Ga0466957_0022358 3300044842 Bacteria 3731
289 Ga0466957_0032676 3300044842 Bacteria 3117
290 Ga0466957_0149055 3300044842 Bacteria 1512
291 Ga0466960_0000280 3300044901 Bacteria 17752
292 Ga0466960_0001648 3300044901 Bacteria 8175
293 Ga0466960_0152629 3300044901 Bacteria 1235
294 Ga0466959_0016479 3300045049 Bacteria 5400
295 Ga0466959_0036266 3300045049 Bacteria 3643
296 Ga0466959_0056005 3300045049 Bacteria 2877
297 Ga0466959_0173913 3300045049 Bacteria 1509
298 Ga0466959_0230330 3300045049 Bacteria 1282
299 Ga0466958_0002178 3300045836 Bacteria 9764
300 Ga0466958_0005975 3300045836 Bacteria 6587
301 Ga0466958_0024408 3300045836 Bacteria 3558
302 Ga0466958_0057203 3300045836 Bacteria 2370
303 Ga0466958_0223898 3300045836 Bacteria 1200
304 Ga0466967_0009166 3300045976 Bacteria 7323
305 Ga0466967_0012955 3300045976 Bacteria 6414
306 Ga0466967_0013893 3300045976 Bacteria 6245
307 Ga0466967_0017938 3300045976 Bacteria 5640
308 Ga0466967_0044159 3300045976 Bacteria 3864
309 Ga0466967_0152881 3300045976 Bacteria 2159
310 Ga0466967_0217242 3300045976 Bacteria 1815
311 Ga0495603_0041427 3300046455 Bacteria 2754
312 Ga0495638_0004619 3300046460 Bacteria 10418
313 Ga0495641_0036902 3300046461 Bacteria 2294
314 Ga0495641_0051408 3300046461 Bacteria 1882
315 Ga0495582_0013040 3300046473 Bacteria 4577
316 Ga0495662_0080691 3300046476 Bacteria 1582
317 Ga0495606_0027537 3300046507 Bacteria 4028
318 Ga0495630_0104580 3300046517 Bacteria 2143
319 Ga0495668_0014678 3300046616 Bacteria 4588
320 Ga0495581_0011744 3300047315 Bacteria 5071
321 Ga0495674_0044720 3300047319 Bacteria 3935
322 Ga0495672_0004283 3300047320 Bacteria 11776
323 Ga0495672_0045088 3300047320 Bacteria 2642
324 Ga0495676_0109810 3300047321 Bacteria 2026
325 Ga0495676_0172152 3300047321 Bacteria 1523
326 Ga0495676_0192408 3300047321 Bacteria 1422
327 Ga0495673_0000473 3300047469 Bacteria 43497
328 Ga0496100_0001754 3300048903 Bacteria 10820
329 Ga0496100_0017857 3300048903 Bacteria 4197
330 Ga0496100_0219211 3300048903 Bacteria 1395
331 Ga0496101_0000014 3300048904 Bacteria 253487
332 Ga0496101_0014192 3300048904 Bacteria 5351
333 Ga0496101_0021563 3300048904 Bacteria 4427
334 Ga0496101_0025435 3300048904 Bacteria 4108
335 Ga0496101_0037526 3300048904 Bacteria 3438
336 Ga0496102_0000003 3300048905 Bacteria 592263
337 Ga0496102_0001526 3300048905 Bacteria 20433
338 Ga0496102_0005358 3300048905 Bacteria 10891
339 Ga0496102_0011183 3300048905 Bacteria 7728
340 Ga0496102_0028065 3300048905 Bacteria 5029
341 Ga0496102_0199077 3300048905 Bacteria 1888
342 Ga0496102_0260068 3300048905 Bacteria 1636
343 Ga0496103_0000012 3300048906 Bacteria 301778
344 Ga0496103_0001559 3300048906 Bacteria 15172
345 Ga0496103_0002771 3300048906 Bacteria 10901
346 Ga0496103_0181694 3300048906 Bacteria 1352
347 Ga0496104_0001970 3300048907 Bacteria 17790
348 Ga0496106_0000292 3300048909 Bacteria 35222
349 Ga0496106_0032484 3300048909 Bacteria 3892
350 Ga0496106_0047756 3300048909 Bacteria 3222
351 Ga0496106_0417728 3300048909 Bacteria 1078
352 Ga0496107_0000414 3300048910 Bacteria 23207
353 Ga0496107_0000926 3300048910 Bacteria 17304
354 Ga0496107_0014089 3300048910 Bacteria 5597
355 Ga0496107_0206857 3300048910 Bacteria 1459
356 Ga0496108_0002588 3300048911 Bacteria 14492
357 Ga0496108_0051595 3300048911 Bacteria 3446
358 Ga0496109_0000816 3300048912 Bacteria 25973
359 Ga0496109_0056460 3300048912 Bacteria 3583
360 Ga0496109_0115279 3300048912 Bacteria 2500
361 Ga0496110_0040098 3300048913 Bacteria 4081
362 Ga0496110_0288622 3300048913 Bacteria 1494
363 Ga0496111_0178355 3300048914 Bacteria 1579
364 Ga0496112_0083205 3300048915 Bacteria 3165
365 Ga0496112_0154887 3300048915 Bacteria 2259
366 Ga0496112_0157754 3300048915 Bacteria 2236
367 Ga0496112_0260009 3300048915 Bacteria 1685
368 Ga0496113_0247485 3300048916 Bacteria 1423
369 Ga0496114_0000779 3300048917 Bacteria 23779
370 Ga0496115_0005881 3300048918 Bacteria 8942
371 Ga0496115_0158388 3300048918 Bacteria 1871
372 Ga0496116_0000040 3300048919 Bacteria 346900
373 Ga0496117_0000003 3300048920 Bacteria 1881097
374 Ga0496117_0001183 3300048920 Bacteria 39206
375 Ga0496118_0000001 3300048921 Bacteria 1881100
376 Ga0496118_0000222 3300048921 Bacteria 99509
377 Ga0496118_0007598 3300048921 Bacteria 11427
378 Ga0496118_0091679 3300048921 Bacteria 2089
379 Ga0496119_0002925 3300048922 Bacteria 18197
380 Ga0496120_0031456 3300048923 Bacteria 3212
381 Ga0496121_0000611 3300048924 Bacteria 66753
382 Ga0496121_0001471 3300048924 Bacteria 39662
383 Ga0496123_0012284 3300048926 Bacteria 7318
384 Ga0496124_0015882 3300048927 Bacteria 7191
385 Ga0496126_0000567 3300048929 Bacteria 70888
386 Ga0496126_0001187 3300048929 Bacteria 42635
387 Ga0496126_0009834 3300048929 Bacteria 10122
388 Ga0496126_0011564 3300048929 Bacteria 9114
389 Ga0496126_0038366 3300048929 Bacteria 4459
390 Ga0501033_0025590 3300049570 Bacteria 4446
391 Ga0501034_0006085 3300049571 Bacteria 13026
392 Ga0501034_0047264 3300049571 Bacteria 4347
393 Ga0501037_0002462 3300049573 Bacteria 13378
394 Ga0501038_0027455 3300049574 Bacteria 5063
395 Ga0501039_0002444 3300049575 Bacteria 13832
396 Ga0501041_0126926 3300049577 Bacteria 1588
397 Ga0501043_0001466 3300049579 Bacteria 20632
398 Ga0501043_0150247 3300049579 Bacteria 1823
399 Ga0501047_0027757 3300049581 Bacteria 5454
400 Ga0501047_0036715 3300049581 Bacteria 4737
401 Ga0501048_0144890 3300049582 Bacteria 1680
402 Ga0501068_0002230 3300049584 Bacteria 10312
403 Ga0501070_0004440 3300049586 Bacteria 12050
404 Ga0501070_0010544 3300049586 Bacteria 7812
405 Ga0501072_0126515 3300049588 Bacteria 2036
406 Ga0501073_0060870 3300049589 Bacteria 2635
407 Ga0501076_0125930 3300049592 Bacteria 2076
408 Ga0501035_0000602 3300049822 Bacteria 39639
409 Ga0501044_0003682 3300049823 Bacteria 17229
410 Ga0501044_0252495 3300049823 Bacteria 1704
411 nmdc:mga03683_9605_c1 3300050489 Bacteria 3447
412 nmdc:mga03n38_18860_c1 3300050490 Bacteria 2730
413 nmdc:mga03n38_24742_c1 3300050490 Bacteria 2458
414 nmdc:mga03n38_32549_c1 3300050490 Bacteria 2210
415 nmdc:mga03n38_3706_c1 3300050490 Bacteria 4944
416 nmdc:mga03n38_69777_c1 3300050490 Bacteria 1624
417 nmdc:mga03n38_698_c2 3300050490 Bacteria 8043
418 nmdc:mga00v17_110989_c1 3300050491 Bacteria 1740
419 nmdc:mga00v17_15081_c1 3300050491 Bacteria 4332
420 nmdc:mga00v17_23021_c1 3300050491 Bacteria 3601
421 nmdc:mga00v17_239296_c1 3300050491 Bacteria 1177
422 nmdc:mga00v17_35965_c1 3300050491 Bacteria 2950
423 nmdc:mga00v17_39756_c1 3300050491 Bacteria 2061
424 nmdc:mga00v17_40804_c1 3300050491 Bacteria 2786
425 nmdc:mga00v17_9093_c1 3300050491 Bacteria 5362
426 nmdc:mga0yw44_162147_c1 3300050492 Bacteria 1464
427 nmdc:mga0yw44_170966_c1 3300050492 Bacteria 1427
428 nmdc:mga0yw44_172939_c2 3300050492 Bacteria 1056
429 nmdc:mga0yw44_227482_c1 3300050492 Bacteria 1237
430 nmdc:mga0yw44_43692_c1 3300050492 Bacteria 2677
431 nmdc:mga0yw44_83642_c1 3300050492 Bacteria 2005
432 nmdc:mga0yw44_87004_c1 3300050492 Bacteria 1969
433 nmdc:mga06z11_232786_c1 3300050494 Bacteria 1080
434 nmdc:mga04h51_25573_c1 3300050495 Bacteria 1818
435 nmdc:mga07m45_1337_c2 3300050496 Bacteria 9663
436 nmdc:mga07m45_21646_c1 3300050496 Bacteria 3502
437 nmdc:mga07m45_44916_c1 3300050496 Bacteria 2480
438 nmdc:mga05p37_9126_c1 3300050507 Bacteria 11722
439 nmdc:mga0qj67_41420_c1 3300050509 Bacteria 3623
440 nmdc:mga0qj67_86497_c1 3300050509 Bacteria 2515
441 nmdc:mga0n895_45156_c1 3300050512 Bacteria 4299
442 nmdc:mga0rr50_59161_c1 3300050513 Bacteria 2876
443 nmdc:mga08x19_10538_c1 3300050514 Bacteria 5554
444 nmdc:mga0sz30_116463_c1 3300050516 Bacteria 1173
445 nmdc:mga0sz30_15744_c1 3300050516 Bacteria 2992
446 nmdc:mga0sz30_52176_c1 3300050516 Bacteria 1736
447 nmdc:mga0sz30_54961_c1 3300050516 Bacteria 1694
448 nmdc:mga0sz30_74415_c1 3300050516 Bacteria 1465
449 nmdc:mga0sz30_9883_c1 3300050516 Bacteria 3641
450 Ga0500610_0070764 3300053079 Bacteria 1819
451 Ga0500635_0060458 3300053080 Bacteria 1321
452 Ga0500643_000502 3300053087 Bacteria 27898
453 Ga0500556_0003543 3300053104 Bacteria 4564
454 Ga0500652_005855 3300053131 Bacteria 3910
455 Ga0500652_112137 3300053131 Bacteria 1140
456 Ga0500616_0059405 3300053153 Bacteria 1986
457 Ga0500627_0002891 3300053158 Bacteria 5196
458 Ga0500645_000029 3300053730 Bacteria 122362
459 Ga0501084_0054487 3300054114 Bacteria 3346
460 Ga0501084_0311977 3300054114 Bacteria 1328
461 Ga0466962_0009264 3300061719 Bacteria 4717
462 Ga0466962_0010389 3300061719 Bacteria 4474
463 Ga0466962_0011756 3300061719 Bacteria 4217
464 Ga0530510_0069242 3300061734 Bacteria 2561
465 2644036212 2643221604 Bacteria 5014917
466 2644635048 2643221715 Bacteria 6671032
467 2738702788 2738541274 Bacteria 6909446
468 2739329698 2738543028 Bacteria 6917070
469 2812354112 2811994879 Bacteria 9313447
470 2842135004 2842134933 Bacteria 5847019
471 2862186027 2862178590 Bacteria 8583590
472 2895430061 2895427314 Bacteria 13147766
473 2902794578 2902792274 Bacteria 7270173
474 2902803068 2902799365 Bacteria 5419524
475 2902813909 2902810491 Bacteria 6794147
476 2912758179 2912757875 Bacteria 7940295
477 2939586909 2939582691 Bacteria 7088898
478 2946071588 2946064051 Bacteria 8957905
479 2947225129 2947224130 Bacteria 9938529
480 8053948328 8053945823 Bacteria 8962862
481 Ga0501039_0169076
482 LJNas_1004774
483 JGI24744J21845_10006017
484 rootH2_10331403
485 Ga0055540_1005091
486 Ga0070683_100079781
487 Ga0068869_100017408
488 Ga0068868_100047209
489 Ga0070689_100028720
490 Ga0070691_10001512
491 Ga0070668_100001541
492 Ga0070675_100234574
493 Ga0070671_100019376
494 Ga0070671_100034380
495 Ga0070671_100069861
496 Ga0070674_100003576
497 Ga0070673_100179057
498 Ga0070688_100003497
499 Ga0070667_100002436
500 Ga0070667_100003582
501 Ga0070667_100030427
502 Ga0070709_10064378
503 Ga0070714_100030383
504 Ga0070714_100054636
505 Ga0070713_100036948
506 Ga0070713_100186877
507 Ga0070710_10002663
508 Ga0070710_10004600
509 Ga0070710_10025012
510 Ga0070710_10055701
511 Ga0070701_10000600
512 Ga0070711_100009210
513 Ga0070711_100012587
514 Ga0070705_100343282
515 Ga0070700_100017095
516 Ga0070694_100008566
517 Ga0070694_100298393
518 Ga0070663_100044350
519 Ga0070678_100011278
520 Ga0068867_100015025
521 Ga0068867_100091162
522 Ga0068853_100012408
523 Ga0068853_100018680
524 Ga0070693_100174958
525 Ga0070665_100002411
526 Ga0070665_100025250
527 Ga0070665_100085320
528 Ga0070665_100099220
529 Ga0068852_100168671
530 Ga0068859_100004954
531 Ga0068859_100008300
532 Ga0068864_100124974
533 Ga0068866_10000656
534 Ga0068861_100017259
535 Ga0068861_100286126
536 Ga0068863_100001051
537 Ga0068858_100005490
538 Ga0068858_100009724
539 Ga0068860_100000186
540 Ga0068860_100008830
541 Ga0068860_100090127
542 Ga0068862_100000018
543 Ga0068862_100005177
544 Ga0068862_100111139
545 Ga0081455_10091271
546 Ga0081455_10119870
547 Ga0081540_1052814
548 Ga0070717_10007822
549 Ga0075365_10003191
550 Ga0075365_10017329
551 Ga0075365_10028236
552 Ga0075365_10028747
553 Ga0075365_10070436
554 Ga0075368_10087039
555 Ga0075363_100001297
556 Ga0075363_100030839
557 Ga0075363_100034462
558 Ga0075363_100036510
559 Ga0075363_100066450
560 Ga0075363_100070170
561 Ga0075364_10000848
562 Ga0075364_10008835
563 Ga0075364_10015526
564 Ga0075364_10024283
565 Ga0075364_10109734
566 Ga0075364_10218936
567 Ga0070716_100001725
568 Ga0070712_100022539
569 Ga0070712_100026549
570 Ga0070712_100086371
571 Ga0070712_100439152
572 Ga0075362_10015483
573 Ga0075362_10024426
574 Ga0075362_10042671
575 Ga0075367_10014478
576 Ga0075369_10000879
577 Ga0075369_10007818
578 Ga0075369_10009002
579 Ga0075369_10027977
580 Ga0075369_10035317
581 Ga0075369_10052257
582 Ga0075369_10088392
583 Ga0075369_10121535
584 Ga0075370_10000392
585 Ga0075370_10000398
586 Ga0075370_10016521
587 Ga0075370_10046395
588 Ga0075370_10181284
589 Ga0075428_100003662
590 Ga0075428_100110628
591 Ga0075430_100029278
592 Ga0075430_100051278
593 Ga0075431_100107103
594 Ga0075434_100082389
595 Ga0075436_100051762
596 Ga0097620_100004954
597 Ga0097620_100008300
598 Ga0075435_100016266
599 Ga0105245_10122008
600 Ga0105247_10000011
601 Ga0105247_10145054
602 Ga0114129_10010447
603 Ga0105243_10011193
604 Ga0105242_10000903
605 Ga0105242_10059673
606 Ga0105248_10000370
607 Ga0105248_10001286
608 Ga0105248_10547143
609 Ga0105237_10007419
610 Ga0105237_10010308
611 Ga0105249_10000091
612 Ga0105249_10001187
613 Ga0105249_10055711
614 Ga0105033_101116
615 Ga0105239_10003250
616 Ga0105239_10005756
617 Ga0105239_10054794
618 Ga0105239_10310594
619 Ga0157378_10004710
620 Ga0163162_10010156
621 Ga0163162_10170749
622 Ga0157372_10125331
623 Ga0157375_10002646
624 Ga0163163_10589443
625 Ga0157379_10042829
626 Ga0157379_10043015
627 Ga0157376_10069910
628 Ga0157376_10271723
629 Ga0163161_10001083
630 Ga0163161_10027293
631 Ga0213876_10005156
632 Ga0213876_10009045
633 Ga0213875_10028800
634 Ga0209051_1030827
635 Ga0207692_10014535
636 Ga0207692_10023531
637 Ga0207692_10050302
638 Ga0207642_10000620
639 Ga0207642_10009491
640 Ga0207710_10000006
641 Ga0207710_10016334
642 Ga0207688_10000257
643 Ga0207688_10009346
644 Ga0207647_10020145
645 Ga0207645_10065782
646 Ga0207671_10000177
647 Ga0207693_10001089
648 Ga0207693_10003989
649 Ga0207693_10056058
650 Ga0207681_10057332
651 Ga0207681_10069005
652 Ga0207687_10000655
653 Ga0207687_10313189
654 Ga0207700_10141650
655 Ga0207664_10006593
656 Ga0207664_10020870
657 Ga0207644_10049501
658 Ga0207644_10089656
659 Ga0207644_10128448
660 Ga0207690_10004951
661 Ga0207690_10047930
662 Ga0207706_10001480
663 Ga0207706_10032368
664 Ga0207686_10007135
665 Ga0207709_10006201
666 Ga0207670_10073642
667 Ga0207669_10001190
668 Ga0207665_10002679
669 Ga0207665_10012133
670 Ga0207691_10103195
671 Ga0207711_10000080
672 Ga0207711_10007470
673 Ga0207689_10005414
674 Ga0207689_10032244
675 Ga0207661_10259888
676 Ga0207651_10110191
677 Ga0207712_10000061
678 Ga0207712_10124408
679 Ga0207668_10036731
680 Ga0207658_10000123
681 Ga0207658_10007674
682 Ga0207658_10012443
683 Ga0207658_10084684
684 Ga0207677_10025746
685 Ga0207677_10095617
686 Ga0207703_10029110
687 Ga0207703_10261162
688 Ga0207639_10014086
689 Ga0207639_10113674
690 Ga0207678_10019391
691 Ga0207678_10254797
692 Ga0207708_10004354
693 Ga0207641_10001081
694 Ga0207648_10000555
695 Ga0207648_10069316
696 Ga0207676_10104599
697 Ga0207675_100000629
698 Ga0207675_100027115
699 Ga0207683_10000731
700 Ga0207683_10013618
701 Ga0207698_10397378
702 Ga0268266_10002019
703 Ga0268266_10022918
704 Ga0268265_10000005
705 Ga0268265_10016023
706 Ga0268264_10000177
707 Ga0265327_10000246
708 Ga0265327_10009361
709 Ga0316576_10017763
710 Ga0307406_10121279
711 Ga0307407_10068183
712 Ga0307416_100016759
713 Ga0307416_100490438
714 Ga0373941_0025903
715 Ga0373945_0030235
716 Ga0373956_0196118
717 Ga0373943_0211361
718 Ga0373935_0091868
719 Ga0373947_0025576
720 Ga0373925_0031638
721 Ga0436364_0712380
722 Ga0400483_268052
723 Ga0436365_0124560
724 Ga0436365_1106450
725 Ga0436363_0119614
726 Ga0439436_0005061
727 Ga0439439_0017816
728 Ga0439461_0000386
729 Ga0439461_0038193
730 Ga0439466_0002934
731 Ga0439465_0007406
732 Ga0439465_0032984
733 Ga0439465_0039800
734 Ga0451841_0059605
735 Ga0439431_0007193
736 Ga0439433_0005861
737 Ga0439457_000450
738 Ga0439434_0004334
739 Ga0439434_0019350
740 Ga0439434_0060809
741 Ga0450918_008834
742 Ga0466969_0004898
743 Ga0466969_0047981
744 Ga0466972_0005393
745 Ga0466972_0010080
746 Ga0466972_0034129
747 Ga0466965_0006292
748 Ga0466965_0055422
749 Ga0466965_0095308
750 Ga0466965_0106815
751 Ga0466966_0010352
752 Ga0466966_0013398
753 Ga0466961_0004722
754 Ga0466961_0017975
755 Ga0466961_0023506
756 Ga0466963_0045834
757 Ga0466963_0070726
758 Ga0466964_0069415
759 Ga0466971_0012227
760 Ga0466971_0058595
761 Ga0466968_0004719
762 Ga0466968_0005174
763 Ga0466968_0063232
764 Ga0466970_0006698
765 Ga0466970_0008427
766 Ga0466970_0038945
767 Ga0466957_0013454
768 Ga0466957_0022358
769 Ga0466957_0032676
770 Ga0466957_0149055
771 Ga0466960_0000280
772 Ga0466960_0001648
773 Ga0466960_0152629
774 Ga0466959_0016479
775 Ga0466959_0036266
776 Ga0466959_0056005
777 Ga0466959_0173913
778 Ga0466959_0230330
779 Ga0466958_0002178
780 Ga0466958_0005975
781 Ga0466958_0024408
782 Ga0466958_0057203
783 Ga0466958_0223898
784 Ga0466967_0009166
785 Ga0466967_0012955
786 Ga0466967_0013893
787 Ga0466967_0017938
788 Ga0466967_0044159
789 Ga0466967_0152881
790 Ga0466967_0217242
791 Ga0495603_0041427
792 Ga0495638_0004619
793 Ga0495641_0036902
794 Ga0495641_0051408
795 Ga0495582_0013040
796 Ga0495662_0080691
797 Ga0495606_0027537
798 Ga0495630_0104580
799 Ga0495668_0014678
800 Ga0495581_0011744
801 Ga0495674_0044720
802 Ga0495672_0004283
803 Ga0495672_0045088
804 Ga0495676_0109810
805 Ga0495676_0172152
806 Ga0495676_0192408
807 Ga0495673_0000473
808 Ga0496100_0001754
809 Ga0496100_0017857
810 Ga0496100_0219211
811 Ga0496101_0000014
812 Ga0496101_0014192
813 Ga0496101_0021563
814 Ga0496101_0025435
815 Ga0496101_0037526
816 Ga0496102_0000003
817 Ga0496102_0001526
818 Ga0496102_0005358
819 Ga0496102_0011183
820 Ga0496102_0028065
821 Ga0496102_0199077
822 Ga0496102_0260068
823 Ga0496103_0000012
824 Ga0496103_0001559
825 Ga0496103_0002771
826 Ga0496103_0181694
827 Ga0496104_0001970
828 Ga0496106_0000292
829 Ga0496106_0032484
830 Ga0496106_0047756
831 Ga0496106_0417728
832 Ga0496107_0000414
833 Ga0496107_0000926
834 Ga0496107_0014089
835 Ga0496107_0206857
836 Ga0496108_0002588
837 Ga0496108_0051595
838 Ga0496109_0000816
839 Ga0496109_0056460
840 Ga0496109_0115279
841 Ga0496110_0040098
842 Ga0496110_0288622
843 Ga0496111_0178355
844 Ga0496112_0083205
845 Ga0496112_0154887
846 Ga0496112_0157754
847 Ga0496112_0260009
848 Ga0496113_0247485
849 Ga0496114_0000779
850 Ga0496115_0005881
851 Ga0496115_0158388
852 Ga0496116_0000040
853 Ga0496117_0000003
854 Ga0496117_0001183
855 Ga0496118_0000001
856 Ga0496118_0000222
857 Ga0496118_0007598
858 Ga0496118_0091679
859 Ga0496119_0002925
860 Ga0496120_0031456
861 Ga0496121_0000611
862 Ga0496121_0001471
863 Ga0496123_0012284
864 Ga0496124_0015882
865 Ga0496126_0000567
866 Ga0496126_0001187
867 Ga0496126_0009834
868 Ga0496126_0011564
869 Ga0496126_0038366
870 Ga0501033_0025590
871 Ga0501034_0006085
872 Ga0501034_0047264
873 Ga0501037_0002462
874 Ga0501038_0027455
875 Ga0501039_0002444
876 Ga0501041_0126926
877 Ga0501043_0001466
878 Ga0501043_0150247
879 Ga0501047_0027757
880 Ga0501047_0036715
881 Ga0501048_0144890
882 Ga0501068_0002230
883 Ga0501070_0004440
884 Ga0501070_0010544
885 Ga0501072_0126515
886 Ga0501073_0060870
887 Ga0501076_0125930
888 Ga0501035_0000602
889 Ga0501044_0003682
890 Ga0501044_0252495
891 nmdc:mga03683_9605_c1
892 nmdc:mga03n38_18860_c1
893 nmdc:mga03n38_24742_c1
894 nmdc:mga03n38_32549_c1
895 nmdc:mga03n38_3706_c1
896 nmdc:mga03n38_69777_c1
897 nmdc:mga03n38_698_c2
898 nmdc:mga00v17_110989_c1
899 nmdc:mga00v17_15081_c1
900 nmdc:mga00v17_23021_c1
901 nmdc:mga00v17_239296_c1
902 nmdc:mga00v17_35965_c1
903 nmdc:mga00v17_39756_c1
904 nmdc:mga00v17_40804_c1
905 nmdc:mga00v17_9093_c1
906 nmdc:mga0yw44_162147_c1
907 nmdc:mga0yw44_170966_c1
908 nmdc:mga0yw44_172939_c2
909 nmdc:mga0yw44_227482_c1
910 nmdc:mga0yw44_43692_c1
911 nmdc:mga0yw44_83642_c1
912 nmdc:mga0yw44_87004_c1
913 nmdc:mga06z11_232786_c1
914 nmdc:mga04h51_25573_c1
915 nmdc:mga07m45_1337_c2
916 nmdc:mga07m45_21646_c1
917 nmdc:mga07m45_44916_c1
918 nmdc:mga05p37_9126_c1
919 nmdc:mga0qj67_41420_c1
920 nmdc:mga0qj67_86497_c1
921 nmdc:mga0n895_45156_c1
922 nmdc:mga0rr50_59161_c1
923 nmdc:mga08x19_10538_c1
924 nmdc:mga0sz30_116463_c1
925 nmdc:mga0sz30_15744_c1
926 nmdc:mga0sz30_52176_c1
927 nmdc:mga0sz30_54961_c1
928 nmdc:mga0sz30_74415_c1
929 nmdc:mga0sz30_9883_c1
930 Ga0500610_0070764
931 Ga0500635_0060458
932 Ga0500643_000502
933 Ga0500556_0003543
934 Ga0500652_005855
935 Ga0500652_112137
936 Ga0500616_0059405
937 Ga0500627_0002891
938 Ga0500645_000029
939 Ga0501084_0054487
940 Ga0501084_0311977
941 Ga0466962_0009264
942 Ga0466962_0010389
943 Ga0466962_0011756
944 Ga0530510_0069242
945 2644036212
946 2644635048
947 2738702788
948 2739329698
949 2812354112
950 2842135004
951 2862186027
952 2895430061
953 2902794578
954 2902803068
955 2902813909
956 2912758179
957 2939586909
958 2946071588
959 2947225129
960 8053948328

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

259

338

0.98

PF01965

DJ-1_PfpI

DJ-1/PfpI family

23

198

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9682 213 314
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9388 211 313
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9342 217 311
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9173 213 315
3mgk-assembly1.cif.gz_A crystal structure of probable protease/amidase from clostridium acetobutylicum atcc 824 0.9167 3 187
ID Description Score Start End Superfamily
3w6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9682 213 314 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9668 217 314 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.96 263 314 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9533 267 311 1.10.10.60
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.947 213 314 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A5Q4T4C4-F1-model_v4 AraC family transcriptional regulator 0.9821 211 312 GO:0003700
GO:0043565
AF-A0A644U0M6-F1-model_v4 DNA gyrase inhibitor 0.969 213 312 GO:0003700
GO:0043565
AF-U2DEG8-F1-model_v4 deleted 0.9676 213 312
AF-F1TEY5-F1-model_v4 Transcriptional regulator, AraC family 0.9675 213 313 GO:0003700
GO:0043565
AF-A0A7X0Q335-F1-model_v4 deleted 0.9665 213 312

Map