F452341

General Info

Members Datasets Scaffolds Average Seq Length
481 251 436 275

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10014085|JGI25406J46586_100140852
Length 302
Sequence MRVMVDNPVAFVLGGGGVLGAVEVGMLRALFRAGFRPDLVVGTSIGAVNGALVAADPSEAVTDRLVRLWTSPEAAAVYGDSIGRQMRRFATRTHLHSPLPLRRLLEGELGEQSTFADLKIPFRCCAASIERAAEHWFDSGPLVDAVIASSAVPGLLPPMEIEGEHFVDGGIVNSIPIGEAVRMGAKLILVLQVGRVERPLTVPRRPWEVAQVAFEIARRHRFARELASLPDDVRVHVLPSGGGESRDDSPWAYRDMAAVGRRISRAYTASRRYLAXNVNPLPTAPPTALRRTDGSSPGSVVR

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
8 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
9 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
10 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
11 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
12 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
13 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
14 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
15 2855683550 Micromonospora sp. RP3T Isolate Unclassified
16 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
17 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
18 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
19 2858868258 Micromonospora sp. MH33 Isolate Unclassified
20 2858882152 Micromonospora noduli MED15 Isolate Nodule
21 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
22 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
23 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
24 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
25 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
26 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
27 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
28 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
29 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
30 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
31 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
32 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
33 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
34 2902582711 Micromonospora sp. AP08 Isolate Unclassified
35 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
36 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
37 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
38 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
136 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
241 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
242 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
243 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
244 649633069 Micromonospora sp. L5 Isolate Unclassified
245 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
246 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
247 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
248 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
249 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
250 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
251 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.64
Metatranscriptomes 0
Isolates 9.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 1.25
Rhizoplane 4.99
Rhizosphere 82.54
Stem 0
Stem Tuber 0
Unclassified 9.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10014085 3300003203 Bacteria 3409
2 JGI25406J46586_10054899 3300003203 Bacteria 1315
3 rootL2_10223346 3300003322 Bacteria 1315
4 Ga0070683_100195959 3300005329 Bacteria 1918
5 Ga0070683_100350827 3300005329 Bacteria 1405
6 Ga0068868_100175715 3300005338 Bacteria 1775
7 Ga0070668_100000410 3300005347 Bacteria 28490
8 Ga0070668_100036047 3300005347 Bacteria 3774
9 Ga0070667_100240619 3300005367 Bacteria 1616
10 Ga0070709_10007559 3300005434 Bacteria 5964
11 Ga0070709_10192887 3300005434 Unclassified 1438
12 Ga0070709_10278097 3300005434 Bacteria 1215
13 Ga0070714_100006105 3300005435 Bacteria 9256
14 Ga0070714_100313857 3300005435 Bacteria 1464
15 Ga0070713_100050298 3300005436 Bacteria 3442
16 Ga0070713_100078104 3300005436 Bacteria 2817
17 Ga0070713_100139942 3300005436 Bacteria 2143
18 Ga0070713_100185008 3300005436 Bacteria 1874
19 Ga0070710_10030888 3300005437 Bacteria 2886
20 Ga0070710_10127386 3300005437 Bacteria 1548
21 Ga0070710_10186936 3300005437 Bacteria 1300
22 Ga0070711_100036708 3300005439 Bacteria 3284
23 Ga0070711_100112375 3300005439 Bacteria 2001
24 Ga0070711_100228992 3300005439 Bacteria 1448
25 Ga0070708_100002827 3300005445 Bacteria 13481
26 Ga0070708_100018460 3300005445 Bacteria 5838
27 Ga0070708_100190295 3300005445 Bacteria 1919
28 Ga0070708_100196182 3300005445 Bacteria 1889
29 Ga0070708_100262345 3300005445 Bacteria 1624
30 Ga0070708_100302890 3300005445 Unclassified 1505
31 Ga0070708_100487447 3300005445 Bacteria 1163
32 Ga0070678_100185400 3300005456 Bacteria 1707
33 Ga0070706_100000581 3300005467 Bacteria 42452
34 Ga0070706_100017165 3300005467 Bacteria 6686
35 Ga0070706_100025822 3300005467 Bacteria 5406
36 Ga0070706_100052077 3300005467 Bacteria 3779
37 Ga0070706_100084308 3300005467 Bacteria 2944
38 Ga0070706_100109458 3300005467 Bacteria 2571
39 Ga0070706_100151134 3300005467 Bacteria 2167
40 Ga0070706_100171846 3300005467 Bacteria 2024
41 Ga0070706_100216133 3300005467 Bacteria 1789
42 Ga0070707_100000537 3300005468 Bacteria 37903
43 Ga0070707_100004393 3300005468 Bacteria 13206
44 Ga0070707_100006079 3300005468 Bacteria 11262
45 Ga0070707_100024917 3300005468 Bacteria 5671
46 Ga0070707_100045674 3300005468 Bacteria 4192
47 Ga0070698_100000006 3300005471 Bacteria 129236
48 Ga0070698_100003777 3300005471 Bacteria 16638
49 Ga0070698_100027254 3300005471 Bacteria 5945
50 Ga0070698_100032587 3300005471 Bacteria 5397
51 Ga0070698_100469103 3300005471 Unclassified 1195
52 Ga0070699_100043566 3300005518 Bacteria 3884
53 Ga0070699_100131835 3300005518 Bacteria 2203
54 Ga0070699_100660859 3300005518 Bacteria 954
55 Ga0070684_100003933 3300005535 Bacteria 11252
56 Ga0070665_100165915 3300005548 Bacteria 2211
57 Ga0068855_100131673 3300005563 Bacteria 2856
58 Ga0068855_100188589 3300005563 Bacteria 2327
59 Ga0068857_100116271 3300005577 Bacteria 2406
60 Ga0068856_100005337 3300005614 Bacteria 12684
61 Ga0068856_100023941 3300005614 Bacteria 5938
62 Ga0070702_100023817 3300005615 Bacteria 3258
63 Ga0070702_100226764 3300005615 Bacteria 1253
64 Ga0068858_100073621 3300005842 Bacteria 3171
65 Ga0068858_100138217 3300005842 Bacteria 2287
66 Ga0068860_100603679 3300005843 Bacteria 1103
67 Ga0081540_1000527 3300005983 Bacteria 37363
68 Ga0081540_1008415 3300005983 Bacteria 7213
69 Ga0081539_10000333 3300005985 Bacteria 104623
70 Ga0081539_10000657 3300005985 Bacteria 69568
71 Ga0081539_10001151 3300005985 Bacteria 47918
72 Ga0081539_10013060 3300005985 Bacteria 6300
73 Ga0070717_10017856 3300006028 Bacteria 5531
74 Ga0070717_10046907 3300006028 Bacteria 3537
75 Ga0070715_10012598 3300006163 Bacteria 3083
76 Ga0070716_100002257 3300006173 Bacteria 8884
77 Ga0070716_100319700 3300006173 Bacteria 1087
78 Ga0070712_100162548 3300006175 Bacteria 1725
79 Ga0097621_100121557 3300006237 Bacteria 2215
80 Ga0068871_100029021 3300006358 Bacteria 4343
81 Ga0068871_100114984 3300006358 Bacteria 2267
82 Ga0075428_100117445 3300006844 Bacteria 2898
83 Ga0075428_100210219 3300006844 Bacteria 2102
84 Ga0075428_100239860 3300006844 Bacteria 1956
85 Ga0075430_100040534 3300006846 Bacteria 3942
86 Ga0075430_100089398 3300006846 Bacteria 2577
87 Ga0075431_100351713 3300006847 Bacteria 1481
88 Ga0075433_10006448 3300006852 Bacteria 9279
89 Ga0075434_100147054 3300006871 Bacteria 2377
90 Ga0075429_100052798 3300006880 Bacteria 3536
91 Ga0075429_100214550 3300006880 Bacteria 1686
92 Ga0075436_100018901 3300006914 Bacteria 4719
93 Ga0075436_100032364 3300006914 Bacteria 3604
94 Ga0075435_100016894 3300007076 Bacteria 5509
95 Ga0075435_100054696 3300007076 Bacteria 3222
96 Ga0075435_100164749 3300007076 Bacteria 1869
97 Ga0111539_10153826 3300009094 Bacteria 2692
98 Ga0105245_10067797 3300009098 Bacteria 3232
99 Ga0114129_10000010 3300009147 Bacteria 147651
100 Ga0114129_10004992 3300009147 Bacteria 18701
101 Ga0114129_10010765 3300009147 Bacteria 13035
102 Ga0105241_10044776 3300009174 Bacteria 3354
103 Ga0105248_10325822 3300009177 Bacteria 1730
104 Ga0105237_10020427 3300009545 Bacteria 6827
105 Ga0105246_10558786 3300011119 Bacteria 982
106 Ga0157374_10008804 3300013296 Bacteria 8639
107 Ga0163162_10145892 3300013306 Bacteria 2483
108 Ga0157375_10630080 3300013308 Bacteria 1230
109 Ga0163163_10030642 3300014325 Bacteria 5185
110 Ga0163163_10218429 3300014325 Bacteria 1955
111 Ga0157379_10107941 3300014968 Bacteria 2499
112 Ga0157379_10216801 3300014968 Bacteria 1734
113 Ga0157376_10026143 3300014969 Bacteria 4608
114 Ga0207692_10028853 3300025898 Bacteria 2630
115 Ga0207692_10066291 3300025898 Bacteria 1887
116 Ga0207692_10067180 3300025898 Bacteria 1876
117 Ga0207685_10015401 3300025905 Bacteria 2421
118 Ga0207685_10078903 3300025905 Bacteria 1357
119 Ga0207699_10004801 3300025906 Bacteria 6469
120 Ga0207699_10125977 3300025906 Bacteria 1663
121 Ga0207684_10005567 3300025910 Bacteria 11597
122 Ga0207684_10018945 3300025910 Bacteria 5887
123 Ga0207684_10035792 3300025910 Bacteria 4215
124 Ga0207684_10042766 3300025910 Bacteria 3842
125 Ga0207684_10165763 3300025910 Bacteria 1904
126 Ga0207684_10169490 3300025910 Bacteria 1882
127 Ga0207671_10447494 3300025914 Bacteria 1029
128 Ga0207693_10069998 3300025915 Bacteria 2746
129 Ga0207663_10014912 3300025916 Bacteria 4272
130 Ga0207646_10000049 3300025922 Bacteria 171680
131 Ga0207646_10001043 3300025922 Bacteria 35345
132 Ga0207646_10002991 3300025922 Bacteria 19520
133 Ga0207646_10008536 3300025922 Bacteria 10252
134 Ga0207646_10064576 3300025922 Bacteria 3268
135 Ga0207646_10072279 3300025922 Bacteria 3081
136 Ga0207646_10106764 3300025922 Bacteria 2512
137 Ga0207700_10092159 3300025928 Bacteria 2395
138 Ga0207700_10092539 3300025928 Bacteria 2391
139 Ga0207700_10180654 3300025928 Unclassified 1766
140 Ga0207700_10316110 3300025928 Bacteria 1352
141 Ga0207700_10414263 3300025928 Bacteria 1182
142 Ga0207664_10046602 3300025929 Bacteria 3403
143 Ga0207664_10050453 3300025929 Bacteria 3281
144 Ga0207664_10186991 3300025929 Bacteria 1781
145 Ga0207664_10187143 3300025929 Bacteria 1781
146 Ga0207665_10002271 3300025939 Bacteria 12970
147 Ga0207665_10013484 3300025939 Bacteria 5375
148 Ga0207665_10083991 3300025939 Bacteria 2197
149 Ga0207679_10514273 3300025945 Bacteria 1070
150 Ga0207667_10088197 3300025949 Bacteria 3209
151 Ga0207668_10002557 3300025972 Bacteria 10629
152 Ga0207668_10029174 3300025972 Bacteria 3614
153 Ga0207677_10074290 3300026023 Bacteria 2411
154 Ga0207677_10275258 3300026023 Bacteria 1379
155 Ga0207703_10060435 3300026035 Bacteria 3099
156 Ga0207703_10103541 3300026035 Bacteria 2416
157 Ga0207702_10025859 3300026078 Bacteria 4872
158 Ga0207702_10032888 3300026078 Bacteria 4329
159 Ga0207702_10047927 3300026078 Bacteria 3602
160 Ga0207648_10368998 3300026089 Bacteria 1296
161 Ga0207676_10457575 3300026095 Bacteria 1204
162 Ga0207674_10037290 3300026116 Bacteria 5057
163 Ga0207428_10070596 3300027907 Bacteria 2745
164 Ga0268264_10005255 3300028381 Bacteria 10958
165 Ga0265336_10006575 3300028666 Bacteria 4176
166 Ga0307517_10064524 3300028786 Bacteria 3403
167 Ga0307517_10116144 3300028786 Bacteria 2005
168 Ga0307515_10000065 3300028794 Bacteria 244497
169 Ga0307515_10014253 3300028794 Bacteria 14765
170 Ga0307515_10036058 3300028794 Bacteria 8018
171 Ga0307515_10086391 3300028794 Bacteria 3999
172 Ga0265338_10003404 3300028800 Bacteria 22431
173 Ga0307512_10002293 3300030522 Bacteria 24745
174 Ga0307512_10005567 3300030522 Bacteria 13089
175 Ga0307513_10017579 3300031456 Bacteria 8573
176 Ga0307509_10056958 3300031507 Bacteria 4146
177 Ga0307509_10204778 3300031507 Bacteria 1805
178 Ga0307408_100043675 3300031548 Bacteria 3190
179 Ga0307508_10014221 3300031616 Bacteria 7257
180 Ga0307508_10101764 3300031616 Bacteria 2469
181 Ga0307516_10004210 3300031730 Bacteria 17917
182 Ga0307516_10124572 3300031730 Bacteria 2363
183 Ga0307516_10133523 3300031730 Bacteria 2259
184 Ga0307516_10372704 3300031730 Bacteria 1090
185 Ga0307405_10038622 3300031731 Bacteria 2880
186 Ga0307405_10053082 3300031731 Bacteria 2523
187 Ga0307413_10054612 3300031824 Bacteria 2425
188 Ga0307413_10067859 3300031824 Bacteria 2232
189 Ga0307410_10238619 3300031852 Bacteria 1408
190 Ga0326468_10001057 3300031889 Bacteria 2588
191 Ga0307406_10052811 3300031901 Bacteria 2586
192 Ga0307412_10083194 3300031911 Bacteria 2218
193 Ga0307409_100006475 3300031995 Bacteria 6885
194 Ga0307409_100080257 3300031995 Bacteria 2632
195 Ga0307416_100015727 3300032002 Bacteria 5235
196 Ga0307414_10436093 3300032004 Bacteria 1146
197 Ga0307415_100004302 3300032126 Bacteria 7369
198 Ga0307415_100161699 3300032126 Bacteria 1736
199 Ga0307415_100163752 3300032126 Bacteria 1727
200 Ga0307415_100182904 3300032126 Bacteria 1646
201 Ga0307415_100215829 3300032126 Bacteria 1534
202 Ga0307507_10025671 3300033179 Bacteria 6381
203 Ga0373926_0013680 3300035083 Bacteria 2754
204 Ga0373926_0063834 3300035083 Bacteria 1345
205 Ga0373929_0016512 3300035085 Bacteria 1447
206 Ga0373934_0003196 3300035086 Bacteria 5989
207 Ga0373934_0015045 3300035086 Bacteria 2933
208 Ga0373934_0023605 3300035086 Bacteria 2376
209 Ga0373934_0091845 3300035086 Bacteria 1224
210 Ga0373934_0188032 3300035086 Bacteria 849
211 Ga0373944_0003813 3300035089 Bacteria 3904
212 Ga0373944_0055630 3300035089 Bacteria 1257
213 Ga0373951_0000316 3300035091 Bacteria 15083
214 Ga0373923_0013272 3300035111 Bacteria 3067
215 Ga0373923_0130090 3300035111 Bacteria 1130
216 Ga0373923_0187661 3300035111 Bacteria 952
217 Ga0373936_0151082 3300035113 Bacteria 1007
218 Ga0373936_0189687 3300035113 Bacteria 904
219 Ga0373941_0033467 3300035115 Bacteria 1545
220 Ga0373945_0079274 3300035116 Bacteria 1255
221 Ga0373953_0000067 3300035117 Bacteria 25799
222 Ga0373953_0037987 3300035117 Bacteria 1903
223 Ga0373953_0050051 3300035117 Bacteria 1687
224 Ga0373954_0001177 3300035118 Bacteria 10534
225 Ga0373954_0055241 3300035118 Bacteria 1868
226 Ga0373954_0076534 3300035118 Bacteria 1595
227 Ga0373956_0010282 3300035119 Bacteria 3830
228 Ga0373956_0146867 3300035119 Bacteria 1108
229 Ga0373957_0000390 3300035120 Bacteria 11103
230 Ga0373957_0027726 3300035120 Bacteria 2059
231 Ga0373957_0037832 3300035120 Bacteria 1804
232 Ga0373943_0049296 3300035170 Bacteria 2066
233 Ga0373943_0245360 3300035170 Bacteria 1004
234 Ga0373946_0031308 3300035171 Bacteria 2129
235 Ga0373955_0000410 3300035172 Bacteria 18226
236 Ga0373955_0009956 3300035172 Bacteria 4474
237 Ga0373955_0022219 3300035172 Bacteria 3215
238 Ga0373942_0000159 3300035207 Bacteria 16318
239 Ga0373962_0032158 3300035242 Bacteria 1442
240 Ga0373924_0006589 3300035410 Bacteria 4163
241 Ga0373924_0012670 3300035410 Bacteria 3154
242 Ga0373924_0210008 3300035410 Bacteria 859
243 Ga0373935_0005998 3300035692 Bacteria 7216
244 Ga0373935_0185180 3300035692 Bacteria 1431
245 Ga0373927_0042318 3300035695 Bacteria 2951
246 Ga0373933_0000051 3300035724 Bacteria 71384
247 Ga0373933_0002280 3300035724 Bacteria 10921
248 Ga0373933_0010938 3300035724 Bacteria 4983
249 Ga0373933_0280265 3300035724 Bacteria 1077
250 Ga0373933_0404868 3300035724 Bacteria 890
251 Ga0373947_0000004 3300035725 Bacteria 248228
252 Ga0373947_0134845 3300035725 Bacteria 1579
253 Ga0373947_0230615 3300035725 Bacteria 1219
254 Ga0373947_0254773 3300035725 Bacteria 1161
255 Ga0373937_0000289 3300036401 Bacteria 47874
256 Ga0373937_0006428 3300036401 Bacteria 10144
257 Ga0373937_0055141 3300036401 Bacteria 3648
258 Ga0373937_0125355 3300036401 Bacteria 2395
259 Ga0373937_0195840 3300036401 Bacteria 1899
260 Ga0373925_0005596 3300037068 Bacteria 9354
261 Ga0373925_0161860 3300037068 Bacteria 1763
262 Ga0373925_0308577 3300037068 Bacteria 1278
263 Ga0395899_0087831 3300037312 Bacteria 2256
264 Ga0395899_0327726 3300037312 Bacteria 1030
265 Ga0395900_0185710 3300037418 Bacteria 2110
266 Ga0395898_0004207 3300037466 Bacteria 15775
267 Ga0395905_0095542 3300037471 Bacteria 2789
268 Ga0395905_0244334 3300037471 Bacteria 1677
269 Ga0395901_0002584 3300038443 Bacteria 18357
270 Ga0395901_0090855 3300038443 Bacteria 3196
271 Ga0395901_0097395 3300038443 Bacteria 3083
272 Ga0466957_0236686 3300044842 Bacteria 1210
273 Ga0466959_0333237 3300045049 Bacteria 1036
274 Ga0466967_0155309 3300045976 Bacteria 2142
275 Ga0495592_0000111 3300046454 Bacteria 71400
276 Ga0495592_0008759 3300046454 Bacteria 7596
277 Ga0495592_0018560 3300046454 Bacteria 5292
278 Ga0495592_0108941 3300046454 Bacteria 1963
279 Ga0495629_0028953 3300046459 Bacteria 3931
280 Ga0495629_0054952 3300046459 Bacteria 2784
281 Ga0495638_0191337 3300046460 Bacteria 1161
282 Ga0495651_0000068 3300046462 Bacteria 76489
283 Ga0495651_0000464 3300046462 Bacteria 31122
284 Ga0495651_0019515 3300046462 Bacteria 5256
285 Ga0495653_0004487 3300046463 Bacteria 11271
286 Ga0495653_0017631 3300046463 Bacteria 5805
287 Ga0495653_0041015 3300046463 Bacteria 3615
288 Ga0495653_0177165 3300046463 Bacteria 1466
289 Ga0495580_0072366 3300046472 Bacteria 2407
290 Ga0495582_0019517 3300046473 Bacteria 3707
291 Ga0495582_0080609 3300046473 Bacteria 1807
292 Ga0495582_0134689 3300046473 Bacteria 1397
293 Ga0495662_0023984 3300046476 Bacteria 2944
294 Ga0495664_0003359 3300046477 Bacteria 8699
295 Ga0495664_0020747 3300046477 Bacteria 3792
296 Ga0495664_0070777 3300046477 Bacteria 2083
297 Ga0495608_0000160 3300046511 Bacteria 48626
298 Ga0495608_0003186 3300046511 Bacteria 11744
299 Ga0495608_0107669 3300046511 Bacteria 1793
300 Ga0495608_0116310 3300046511 Bacteria 1716
301 Ga0495618_0063132 3300046514 Bacteria 2351
302 Ga0495628_0000250 3300046516 Bacteria 47359
303 Ga0495628_0025921 3300046516 Bacteria 4787
304 Ga0495628_0058891 3300046516 Bacteria 3017
305 Ga0495628_0109368 3300046516 Bacteria 2127
306 Ga0495628_0125777 3300046516 Bacteria 1964
307 Ga0495630_0074960 3300046517 Bacteria 2550
308 Ga0495630_0075409 3300046517 Bacteria 2541
309 Ga0495630_0278204 3300046517 Bacteria 1278
310 Ga0495666_0071096 3300046526 Bacteria 1654
311 Ga0495652_0000440 3300046529 Bacteria 48629
312 Ga0495652_0002550 3300046529 Bacteria 18667
313 Ga0495652_0067666 3300046529 Bacteria 2994
314 Ga0495652_0154617 3300046529 Bacteria 1787
315 Ga0495652_0252370 3300046529 Bacteria 1306
316 Ga0495665_0046291 3300046531 Bacteria 2310
317 Ga0495665_0101896 3300046531 Bacteria 1506
318 Ga0495640_0029710 3300046533 Bacteria 3920
319 Ga0495640_0049799 3300046533 Bacteria 2887
320 Ga0495586_0030594 3300046535 Bacteria 2881
321 Ga0495587_0000056 3300046536 Bacteria 96726
322 Ga0495587_0001286 3300046536 Bacteria 16675
323 Ga0495587_0003041 3300046536 Bacteria 11200
324 Ga0495645_0016720 3300046543 Bacteria 5246
325 Ga0495645_0026979 3300046543 Bacteria 4172
326 Ga0495645_0033762 3300046543 Bacteria 3732
327 Ga0495645_0057065 3300046543 Bacteria 2835
328 Ga0495645_0070496 3300046543 Bacteria 2522
329 Ga0495645_0101390 3300046543 Bacteria 2046
330 Ga0495667_0000078 3300046559 Bacteria 71356
331 Ga0495667_0021367 3300046559 Bacteria 4367
332 Ga0495667_0021519 3300046559 Bacteria 4352
333 Ga0495667_0067557 3300046559 Bacteria 2335
334 Ga0495667_0220503 3300046559 Bacteria 1210
335 Ga0495634_0009102 3300046642 Bacteria 7339
336 Ga0495634_0034418 3300046642 Bacteria 3476
337 Ga0495634_0050020 3300046642 Bacteria 2808
338 Ga0495634_0117770 3300046642 Bacteria 1703
339 Ga0495635_0010957 3300046663 Bacteria 6353
340 Ga0495635_0022837 3300046663 Bacteria 4360
341 Ga0495657_0000043 3300046675 Bacteria 114089
342 Ga0495657_0021140 3300046675 Bacteria 4671
343 Ga0495657_0088884 3300046675 Bacteria 1985
344 Ga0495599_0002010 3300046678 Bacteria 11757
345 Ga0495599_0013139 3300046678 Bacteria 5117
346 Ga0495599_0036643 3300046678 Bacteria 3081
347 Ga0495599_0079380 3300046678 Bacteria 2049
348 Ga0495623_0000431 3300046679 Bacteria 27624
349 Ga0495623_0051265 3300046679 Bacteria 2611
350 Ga0495646_0013974 3300046680 Bacteria 5102
351 Ga0495646_0256715 3300046680 Bacteria 935
352 Ga0495647_0039383 3300046681 Bacteria 1791
353 Ga0495613_0083578 3300046689 Bacteria 2318
354 Ga0495613_0294516 3300046689 Bacteria 1124
355 Ga0495624_0035880 3300046690 Bacteria 3199
356 Ga0495624_0318515 3300046690 Bacteria 937
357 Ga0495600_0038298 3300046809 Bacteria 3119
358 Ga0495581_0020278 3300047315 Bacteria 3859
359 Ga0495604_0000105 3300047317 Bacteria 71375
360 Ga0495604_0038829 3300047317 Bacteria 3746
361 Ga0495604_0060468 3300047317 Bacteria 2901
362 Ga0495674_0040474 3300047319 Bacteria 4168
363 Ga0495674_0042218 3300047319 Bacteria 4069
364 Ga0495674_0061594 3300047319 Bacteria 3269
365 Ga0495676_0103312 3300047321 Bacteria 2104
366 Ga0495676_0220527 3300047321 Bacteria 1307
367 Ga0495680_0000115 3300047322 Bacteria 76480
368 Ga0495680_0006579 3300047322 Bacteria 10781
369 Ga0495680_0014856 3300047322 Bacteria 6731
370 Ga0495680_0033870 3300047322 Bacteria 4132
371 Ga0495680_0041254 3300047322 Bacteria 3671
372 Ga0495675_0002486 3300047444 Bacteria 11026
373 Ga0495675_0031861 3300047444 Bacteria 3366
374 Ga0495675_0049237 3300047444 Bacteria 2679
375 Ga0495684_0182932 3300047471 Bacteria 1553
376 Ga0495593_0007813 3300047673 Bacteria 6235
377 Ga0495593_0190135 3300047673 Bacteria 1033
378 Ga0495602_0000114 3300048088 Bacteria 76491
379 Ga0495602_0009419 3300048088 Bacteria 10159
380 Ga0495602_0024548 3300048088 Bacteria 5848
381 Ga0495602_0041899 3300048088 Bacteria 4177
382 Ga0495602_0158163 3300048088 Bacteria 1772
383 Ga0495602_0171380 3300048088 Bacteria 1684
384 Ga0495614_0059053 3300048089 Bacteria 1647
385 Ga0496100_0206494 3300048903 Bacteria 1435
386 Ga0496101_0107657 3300048904 Bacteria 2095
387 Ga0496102_0066240 3300048905 Bacteria 3310
388 Ga0496102_0218355 3300048905 Bacteria 1797
389 Ga0496104_0001309 3300048907 Bacteria 21482
390 Ga0496104_0017259 3300048907 Bacteria 6568
391 Ga0496105_0002837 3300048908 Bacteria 12680
392 Ga0496105_0008266 3300048908 Bacteria 8092
393 Ga0496105_0129761 3300048908 Bacteria 2078
394 Ga0496106_0121256 3300048909 Unclassified 2044
395 Ga0496107_0031328 3300048910 Bacteria 3794
396 Ga0496108_0000010 3300048911 Bacteria 273269
397 Ga0496108_0004955 3300048911 Bacteria 10757
398 Ga0496108_0096252 3300048911 Bacteria 2521
399 Ga0496109_0066969 3300048912 Bacteria 3289
400 Ga0496109_0092002 3300048912 Bacteria 2805
401 Ga0496109_0331273 3300048912 Bacteria 1437
402 Ga0496110_0028481 3300048913 Bacteria 4798
403 Ga0496111_0021912 3300048914 Bacteria 4467
404 Ga0496112_0001084 3300048915 Bacteria 20135
405 Ga0496112_0033219 3300048915 Bacteria 5014
406 Ga0496113_0032553 3300048916 Bacteria 3789
407 Ga0496113_0129573 3300048916 Bacteria 1978
408 Ga0496115_0111218 3300048918 Bacteria 2250
409 Ga0501068_0266117 3300049584 Bacteria 1094
410 nmdc:mga05p37_15752_c1 3300050507 Bacteria 9091
411 nmdc:mga05p37_422868_c1 3300050507 Bacteria 1550
412 nmdc:mga05p37_9973_c1 3300050507 Bacteria 11280
413 nmdc:mga09592_353013_c1 3300050508 Bacteria 1272
414 nmdc:mga09592_41248_c1 3300050508 Bacteria 3880
415 nmdc:mga0qj67_12039_c1 3300050509 Bacteria 6502
416 nmdc:mga06r32_232013_c1 3300050510 Bacteria 1833
417 nmdc:mga08y16_289204_c1 3300050511 Bacteria 1690
418 nmdc:mga0n895_187962_c1 3300050512 Bacteria 2097
419 nmdc:mga0n895_311863_c1 3300050512 Bacteria 1594
420 nmdc:mga0rr50_46662_c1 3300050513 Bacteria 3191
421 nmdc:mga08x19_193193_c1 3300050514 Bacteria 1393
422 nmdc:mga08x19_26865_c1 3300050514 Bacteria 3596
423 nmdc:mga0a205_178018_c1 3300050515 Bacteria 2022
424 Ga0495601_0014123 3300053077 Bacteria 4811
425 Ga0495601_0139959 3300053077 Bacteria 1578
426 Ga0495612_0034654 3300053078 Bacteria 2044
427 Ga0495612_0039312 3300053078 Bacteria 1924
428 Ga0495595_0001328 3300053084 Bacteria 9618
429 Ga0495619_0052680 3300053085 Bacteria 2690
430 Ga0500644_0002336 3300053088 Bacteria 4774
431 Ga0500651_0076455 3300053093 Bacteria 2079
432 Ga0500641_0053606 3300053096 Bacteria 1665
433 Ga0500650_0088716 3300053098 Bacteria 1447
434 Ga0500569_003510 3300053109 Bacteria 3212
435 Ga0500594_0005151 3300053118 Bacteria 2892
436 Ga0500600_0049907 3300053149 Bacteria 2377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_100185400 Ga0070678_1001854002 246
2 3300005615 Ga0070702_100226764 Ga0070702_1002267641 246
3 3300009174 Ga0105241_10044776 Ga0105241_100447761 246
4 3300025898 Ga0207692_10066291 Ga0207692_100662912 246
5 3300025905 Ga0207685_10078903 Ga0207685_100789032 246
6 3300025906 Ga0207699_10004801 Ga0207699_100048012 246
7 3300035085 Ga0373929_0016512 Ga0373929_0016512_32_856 246
8 3300035242 Ga0373962_0032158 Ga0373962_0032158_137_961 246
9 3300048908 Ga0496105_0129761 Ga0496105_0129761_516_1340 246
10 3300006028 Ga0070717_10017856 Ga0070717_100178562 247
11 3300006844 Ga0075428_100210219 Ga0075428_1002102192 247
12 3300006880 Ga0075429_100214550 Ga0075429_1002145502 247
13 3300035724 Ga0373933_0280265 Ga0373933_0280265_142_903 247
14 3300005563 Ga0068855_100188589 Ga0068855_1001885892 249
15 3300006844 Ga0075428_100117445 Ga0075428_1001174452 249
16 3300006852 Ga0075433_10006448 Ga0075433_100064485 249
17 3300006914 Ga0075436_100032364 Ga0075436_1000323642 249
18 3300007076 Ga0075435_100016894 Ga0075435_1000168942 249
19 3300026095 Ga0207676_10457575 Ga0207676_104575752 249
20 3300027907 Ga0207428_10070596 Ga0207428_100705962 249
21 3300048910 Ga0496107_0031328 Ga0496107_0031328_2460_3299 251
22 3300048912 Ga0496109_0092002 Ga0496109_0092002_1606_2445 251
23 3300048918 Ga0496115_0111218 Ga0496115_0111218_880_1719 251
24 3300005614 Ga0068856_100023941 Ga0068856_1000239412 252
25 3300005843 Ga0068860_100603679 Ga0068860_1006036791 252
26 3300006358 Ga0068871_100114984 Ga0068871_1001149841 252
27 3300025928 Ga0207700_10092159 Ga0207700_100921592 252
28 3300026078 Ga0207702_10025859 Ga0207702_100258594 252
29 3300046559 Ga0495667_0021367 Ga0495667_0021367_2794_3699 252
30 3300044842 Ga0466957_0236686 Ga0466957_0236686_434_1195 253
31 3300005434 Ga0070709_10007559 Ga0070709_100075593 257
32 3300005436 Ga0070713_100050298 Ga0070713_1000502983 257
33 3300005439 Ga0070711_100036708 Ga0070711_1000367082 257
34 3300005614 Ga0068856_100005337 Ga0068856_1000053374 257
35 3300006163 Ga0070715_10012598 Ga0070715_100125982 257
36 3300025905 Ga0207685_10015401 Ga0207685_100154012 257
37 3300025916 Ga0207663_10014912 Ga0207663_100149123 257
38 3300025928 Ga0207700_10180654 Ga0207700_101806542 257
39 3300026078 Ga0207702_10047927 Ga0207702_100479272 257
40 3300035113 Ga0373936_0189687 Ga0373936_0189687_101_892 257
41 3300048903 Ga0496100_0206494 Ga0496100_0206494_163_987 257
42 3300048904 Ga0496101_0107657 Ga0496101_0107657_806_1630 257
43 3300048905 Ga0496102_0066240 Ga0496102_0066240_1909_2733 257
44 3300048907 Ga0496104_0001309 Ga0496104_0001309_8475_9299 257
45 3300048908 Ga0496105_0008266 Ga0496105_0008266_1910_2734 257
46 3300048909 Ga0496106_0121256 Ga0496106_0121256_712_1536 257
47 3300048911 Ga0496108_0096252 Ga0496108_0096252_1106_1930 257
48 3300048912 Ga0496109_0066969 Ga0496109_0066969_668_1492 257
49 3300048915 Ga0496112_0001084 Ga0496112_0001084_18730_19554 257
50 3300048916 Ga0496113_0129573 Ga0496113_0129573_67_891 257
51 3300046689 Ga0495613_0083578 Ga0495613_0083578_178_1083 259
52 3300047321 Ga0495676_0220527 Ga0495676_0220527_347_1252 259
53 3300005471 Ga0070698_100032587 Ga0070698_1000325873 263
54 3300046473 Ga0495582_0080609 Ga0495582_0080609_622_1527 264
55 3300046533 Ga0495640_0029710 Ga0495640_0029710_522_1427 264
56 3300046675 Ga0495657_0088884 Ga0495657_0088884_870_1775 264
57 3300005445 Ga0070708_100018460 Ga0070708_1000184603 265
58 3300005467 Ga0070706_100216133 Ga0070706_1002161332 265
59 3300005468 Ga0070707_100004393 Ga0070707_1000043932 265
60 3300005468 Ga0070707_100045674 Ga0070707_1000456742 265
61 3300005471 Ga0070698_100003777 Ga0070698_1000037777 265
62 3300025910 Ga0207684_10035792 Ga0207684_100357925 265
63 3300025922 Ga0207646_10001043 Ga0207646_1000104321 265
64 3300025922 Ga0207646_10106764 Ga0207646_101067642 265
65 3300035086 Ga0373934_0003196 Ga0373934_0003196_2139_2978 265
66 3300035111 Ga0373923_0013272 Ga0373923_0013272_220_1059 265
67 3300035117 Ga0373953_0000067 Ga0373953_0000067_3451_4290 265
68 3300035117 Ga0373953_0050051 Ga0373953_0050051_630_1535 265
69 3300035118 Ga0373954_0001177 Ga0373954_0001177_1233_2072 265
70 3300035118 Ga0373954_0076534 Ga0373954_0076534_36_941 265
71 3300035119 Ga0373956_0146867 Ga0373956_0146867_10_849 265
72 3300035120 Ga0373957_0000390 Ga0373957_0000390_7525_8364 265
73 3300035120 Ga0373957_0027726 Ga0373957_0027726_35_940 265
74 3300035172 Ga0373955_0000410 Ga0373955_0000410_11883_12722 265
75 3300035410 Ga0373924_0006589 Ga0373924_0006589_2523_3362 265
76 3300035724 Ga0373933_0000051 Ga0373933_0000051_25340_26179 265
77 3300035724 Ga0373933_0002280 Ga0373933_0002280_943_1848 265
78 3300036401 Ga0373937_0000289 Ga0373937_0000289_45206_46045 265
79 3300036401 Ga0373937_0006428 Ga0373937_0006428_166_1071 265
80 3300045049 Ga0466959_0333237 Ga0466959_0333237_125_940 265
81 3300046454 Ga0495592_0000111 Ga0495592_0000111_25356_26195 265
82 3300046459 Ga0495629_0028953 Ga0495629_0028953_489_1394 265
83 3300046462 Ga0495651_0000068 Ga0495651_0000068_30445_31284 265
84 3300046463 Ga0495653_0004487 Ga0495653_0004487_2239_3078 265
85 3300046463 Ga0495653_0041015 Ga0495653_0041015_2580_3485 265
86 3300046477 Ga0495664_0003359 Ga0495664_0003359_5301_6206 265
87 3300046511 Ga0495608_0000160 Ga0495608_0000160_45193_46032 265
88 3300046511 Ga0495608_0003186 Ga0495608_0003186_951_1856 265
89 3300046516 Ga0495628_0000250 Ga0495628_0000250_27432_28271 265
90 3300046516 Ga0495628_0058891 Ga0495628_0058891_669_1574 265
91 3300046517 Ga0495630_0075409 Ga0495630_0075409_109_1014 265
92 3300046529 Ga0495652_0000440 Ga0495652_0000440_45166_46005 265
93 3300046529 Ga0495652_0154617 Ga0495652_0154617_412_1317 265
94 3300046536 Ga0495587_0000056 Ga0495587_0000056_45206_46045 265
95 3300046536 Ga0495587_0003041 Ga0495587_0003041_9658_10563 265
96 3300046543 Ga0495645_0016720 Ga0495645_0016720_2855_3760 265
97 3300046543 Ga0495645_0026979 Ga0495645_0026979_634_1473 265
98 3300046559 Ga0495667_0000078 Ga0495667_0000078_45184_46023 265
99 3300046642 Ga0495634_0009102 Ga0495634_0009102_3682_4587 265
100 3300046663 Ga0495635_0022837 Ga0495635_0022837_2658_3563 265
101 3300046675 Ga0495657_0000043 Ga0495657_0000043_107846_108685 265
102 3300046678 Ga0495599_0002010 Ga0495599_0002010_8317_9156 265
103 3300046678 Ga0495599_0036643 Ga0495599_0036643_1068_1973 265
104 3300046679 Ga0495623_0000431 Ga0495623_0000431_1444_2283 265
105 3300046680 Ga0495646_0013974 Ga0495646_0013974_1646_2485 265
106 3300046809 Ga0495600_0038298 Ga0495600_0038298_1592_2497 265
107 3300047317 Ga0495604_0000105 Ga0495604_0000105_25331_26170 265
108 3300047322 Ga0495680_0000115 Ga0495680_0000115_30445_31284 265
109 3300047322 Ga0495680_0041254 Ga0495680_0041254_2494_3399 265
110 3300047444 Ga0495675_0002486 Ga0495675_0002486_8171_9010 265
111 3300047444 Ga0495675_0031861 Ga0495675_0031861_1722_2627 265
112 3300048088 Ga0495602_0000114 Ga0495602_0000114_30445_31284 265
113 3300053078 Ga0495612_0034654 Ga0495612_0034654_631_1536 265
114 3300053084 Ga0495595_0001328 Ga0495595_0001328_6121_6960 265
115 3300005436 Ga0070713_100139942 Ga0070713_1001399422 266
116 3300005445 Ga0070708_100002827 Ga0070708_1000028277 266
117 3300005467 Ga0070706_100000581 Ga0070706_10000058131 266
118 3300005467 Ga0070706_100017165 Ga0070706_1000171655 266
119 3300005467 Ga0070706_100171846 Ga0070706_1001718462 266
120 3300005468 Ga0070707_100000537 Ga0070707_10000053731 266
121 3300005468 Ga0070707_100024917 Ga0070707_1000249173 266
122 3300005471 Ga0070698_100000006 Ga0070698_100000006105 266
123 3300005471 Ga0070698_100027254 Ga0070698_1000272545 266
124 3300005518 Ga0070699_100131835 Ga0070699_1001318352 266
125 3300025910 Ga0207684_10005567 Ga0207684_100055676 266
126 3300025910 Ga0207684_10018945 Ga0207684_100189452 266
127 3300025922 Ga0207646_10000049 Ga0207646_1000004960 266
128 3300025922 Ga0207646_10002991 Ga0207646_1000299114 266
129 3300025928 Ga0207700_10414263 Ga0207700_104142631 266
130 3300035086 Ga0373934_0188032 Ga0373934_0188032_13_831 266
131 3300035111 Ga0373923_0187661 Ga0373923_0187661_60_878 266
132 3300035118 Ga0373954_0055241 Ga0373954_0055241_600_1418 266
133 3300035725 Ga0373947_0134845 Ga0373947_0134845_386_1204 266
134 3300036401 Ga0373937_0125355 Ga0373937_0125355_1054_1872 266
135 3300046533 Ga0495640_0049799 Ga0495640_0049799_411_1229 266
136 3300046543 Ga0495645_0057065 Ga0495645_0057065_540_1358 266
137 3300046642 Ga0495634_0117770 Ga0495634_0117770_532_1350 266
138 3300047319 Ga0495674_0042218 Ga0495674_0042218_1673_2491 266
139 3300048088 Ga0495602_0171380 Ga0495602_0171380_722_1540 266
140 3300053077 Ga0495601_0139959 Ga0495601_0139959_320_1138 266
141 3300005434 Ga0070709_10192887 Ga0070709_101928871 268
142 3300005434 Ga0070709_10278097 Ga0070709_102780972 268
143 3300005435 Ga0070714_100006105 Ga0070714_1000061055 268
144 3300005435 Ga0070714_100313857 Ga0070714_1003138572 268
145 3300005436 Ga0070713_100078104 Ga0070713_1000781043 268
146 3300005436 Ga0070713_100185008 Ga0070713_1001850082 268
147 3300005437 Ga0070710_10030888 Ga0070710_100308883 268
148 3300005437 Ga0070710_10127386 Ga0070710_101273862 268
149 3300005437 Ga0070710_10186936 Ga0070710_101869362 268
150 3300005439 Ga0070711_100112375 Ga0070711_1001123752 268
151 3300005439 Ga0070711_100228992 Ga0070711_1002289922 268
152 3300005445 Ga0070708_100190295 Ga0070708_1001902952 268
153 3300005445 Ga0070708_100196182 Ga0070708_1001961822 268
154 3300005445 Ga0070708_100262345 Ga0070708_1002623451 268
155 3300005445 Ga0070708_100487447 Ga0070708_1004874472 268
156 3300005467 Ga0070706_100025822 Ga0070706_1000258223 268
157 3300005467 Ga0070706_100109458 Ga0070706_1001094582 268
158 3300005467 Ga0070706_100151134 Ga0070706_1001511342 268
159 3300005468 Ga0070707_100006079 Ga0070707_1000060795 268
160 3300005518 Ga0070699_100660859 Ga0070699_1006608591 268
161 3300005563 Ga0068855_100131673 Ga0068855_1001316732 268
162 3300005615 Ga0070702_100023817 Ga0070702_1000238173 268
163 3300005842 Ga0068858_100138217 Ga0068858_1001382173 268
164 3300005983 Ga0081540_1000527 Ga0081540_100052729 268
165 3300006028 Ga0070717_10046907 Ga0070717_100469074 268
166 3300006173 Ga0070716_100002257 Ga0070716_1000022574 268
167 3300006173 Ga0070716_100319700 Ga0070716_1003197001 268
168 3300006175 Ga0070712_100162548 Ga0070712_1001625482 268
169 3300006237 Ga0097621_100121557 Ga0097621_1001215572 268
170 3300006358 Ga0068871_100029021 Ga0068871_1000290212 268
171 3300006914 Ga0075436_100018901 Ga0075436_1000189015 268
172 3300007076 Ga0075435_100054696 Ga0075435_1000546962 268
173 3300007076 Ga0075435_100164749 Ga0075435_1001647492 268
174 3300009094 Ga0111539_10153826 Ga0111539_101538262 268
175 3300009098 Ga0105245_10067797 Ga0105245_100677973 268
176 3300009147 Ga0114129_10004992 Ga0114129_100049926 268
177 3300009177 Ga0105248_10325822 Ga0105248_103258222 268
178 3300009545 Ga0105237_10020427 Ga0105237_100204277 268
179 3300013296 Ga0157374_10008804 Ga0157374_100088043 268
180 3300013306 Ga0163162_10145892 Ga0163162_101458922 268
181 3300014325 Ga0163163_10030642 Ga0163163_100306422 268
182 3300014968 Ga0157379_10216801 Ga0157379_102168012 268
183 3300014969 Ga0157376_10026143 Ga0157376_100261432 268
184 3300025898 Ga0207692_10028853 Ga0207692_100288533 268
185 3300025898 Ga0207692_10067180 Ga0207692_100671802 268
186 3300025906 Ga0207699_10125977 Ga0207699_101259772 268
187 3300025910 Ga0207684_10165763 Ga0207684_101657632 268
188 3300025914 Ga0207671_10447494 Ga0207671_104474942 268
189 3300025915 Ga0207693_10069998 Ga0207693_100699983 268
190 3300025922 Ga0207646_10008536 Ga0207646_100085362 268
191 3300025928 Ga0207700_10092539 Ga0207700_100925393 268
192 3300025928 Ga0207700_10316110 Ga0207700_103161102 268
193 3300025929 Ga0207664_10046602 Ga0207664_100466023 268
194 3300025929 Ga0207664_10050453 Ga0207664_100504533 268
195 3300025929 Ga0207664_10186991 Ga0207664_101869912 268
196 3300025929 Ga0207664_10187143 Ga0207664_101871432 268
197 3300025939 Ga0207665_10002271 Ga0207665_100022717 268
198 3300025939 Ga0207665_10013484 Ga0207665_100134842 268
199 3300025939 Ga0207665_10083991 Ga0207665_100839913 268
200 3300025945 Ga0207679_10514273 Ga0207679_105142732 268
201 3300025949 Ga0207667_10088197 Ga0207667_100881973 268
202 3300026023 Ga0207677_10074290 Ga0207677_100742902 268
203 3300026035 Ga0207703_10060435 Ga0207703_100604353 268
204 3300026078 Ga0207702_10032888 Ga0207702_100328885 268
205 3300026089 Ga0207648_10368998 Ga0207648_103689981 268
206 3300026116 Ga0207674_10037290 Ga0207674_100372903 268
207 3300028666 Ga0265336_10006575 Ga0265336_100065754 268
208 3300028800 Ga0265338_10003404 Ga0265338_1000340410 268
209 3300035083 Ga0373926_0063834 Ga0373926_0063834_94_918 268
210 3300035086 Ga0373934_0015045 Ga0373934_0015045_1082_1987 268
211 3300035086 Ga0373934_0023605 Ga0373934_0023605_332_1156 268
212 3300035086 Ga0373934_0091845 Ga0373934_0091845_67_891 268
213 3300035089 Ga0373944_0055630 Ga0373944_0055630_90_914 268
214 3300035111 Ga0373923_0130090 Ga0373923_0130090_282_1106 268
215 3300035113 Ga0373936_0151082 Ga0373936_0151082_123_947 268
216 3300035116 Ga0373945_0079274 Ga0373945_0079274_53_877 268
217 3300035117 Ga0373953_0037987 Ga0373953_0037987_175_999 268
218 3300035119 Ga0373956_0010282 Ga0373956_0010282_54_878 268
219 3300035120 Ga0373957_0037832 Ga0373957_0037832_332_1156 268
220 3300035170 Ga0373943_0049296 Ga0373943_0049296_703_1527 268
221 3300035172 Ga0373955_0022219 Ga0373955_0022219_862_1686 268
222 3300035410 Ga0373924_0012670 Ga0373924_0012670_1466_2290 268
223 3300035410 Ga0373924_0210008 Ga0373924_0210008_22_846 268
224 3300035692 Ga0373935_0185180 Ga0373935_0185180_528_1352 268
225 3300035724 Ga0373933_0010938 Ga0373933_0010938_1569_2393 268
226 3300035724 Ga0373933_0404868 Ga0373933_0404868_14_838 268
227 3300035725 Ga0373947_0254773 Ga0373947_0254773_261_1085 268
228 3300036401 Ga0373937_0055141 Ga0373937_0055141_1151_1975 268
229 3300036401 Ga0373937_0195840 Ga0373937_0195840_221_1045 268
230 3300037068 Ga0373925_0161860 Ga0373925_0161860_34_858 268
231 3300046454 Ga0495592_0008759 Ga0495592_0008759_508_1413 268
232 3300046454 Ga0495592_0018560 Ga0495592_0018560_993_1817 268
233 3300046454 Ga0495592_0108941 Ga0495592_0108941_886_1710 268
234 3300046462 Ga0495651_0000464 Ga0495651_0000464_13805_14629 268
235 3300046462 Ga0495651_0019515 Ga0495651_0019515_1917_2741 268
236 3300046463 Ga0495653_0017631 Ga0495653_0017631_1151_1975 268
237 3300046473 Ga0495582_0134689 Ga0495582_0134689_430_1254 268
238 3300046476 Ga0495662_0023984 Ga0495662_0023984_964_1788 268
239 3300046477 Ga0495664_0020747 Ga0495664_0020747_2160_2984 268
240 3300046477 Ga0495664_0070777 Ga0495664_0070777_1160_1984 268
241 3300046511 Ga0495608_0107669 Ga0495608_0107669_784_1608 268
242 3300046511 Ga0495608_0116310 Ga0495608_0116310_151_975 268
243 3300046514 Ga0495618_0063132 Ga0495618_0063132_243_1067 268
244 3300046516 Ga0495628_0025921 Ga0495628_0025921_2244_3068 268
245 3300046516 Ga0495628_0109368 Ga0495628_0109368_288_1112 268
246 3300046516 Ga0495628_0125777 Ga0495628_0125777_619_1443 268
247 3300046517 Ga0495630_0074960 Ga0495630_0074960_968_1792 268
248 3300046529 Ga0495652_0002550 Ga0495652_0002550_65_889 268
249 3300046529 Ga0495652_0067666 Ga0495652_0067666_400_1224 268
250 3300046531 Ga0495665_0046291 Ga0495665_0046291_279_1103 268
251 3300046535 Ga0495586_0030594 Ga0495586_0030594_890_1714 268
252 3300046536 Ga0495587_0001286 Ga0495587_0001286_11476_12300 268
253 3300046543 Ga0495645_0033762 Ga0495645_0033762_1929_2753 268
254 3300046543 Ga0495645_0101390 Ga0495645_0101390_720_1544 268
255 3300046559 Ga0495667_0021519 Ga0495667_0021519_1021_1845 268
256 3300046559 Ga0495667_0067557 Ga0495667_0067557_1485_2309 268
257 3300046642 Ga0495634_0034418 Ga0495634_0034418_855_1679 268
258 3300046663 Ga0495635_0010957 Ga0495635_0010957_2017_2841 268
259 3300046675 Ga0495657_0021140 Ga0495657_0021140_3780_4604 268
260 3300046678 Ga0495599_0013139 Ga0495599_0013139_2326_3150 268
261 3300046678 Ga0495599_0079380 Ga0495599_0079380_991_1815 268
262 3300046679 Ga0495623_0051265 Ga0495623_0051265_263_1087 268
263 3300046680 Ga0495646_0256715 Ga0495646_0256715_90_914 268
264 3300046689 Ga0495613_0294516 Ga0495613_0294516_48_872 268
265 3300046690 Ga0495624_0318515 Ga0495624_0318515_79_903 268
266 3300047317 Ga0495604_0038829 Ga0495604_0038829_2282_3106 268
267 3300047317 Ga0495604_0060468 Ga0495604_0060468_1931_2755 268
268 3300047319 Ga0495674_0061594 Ga0495674_0061594_1626_2450 268
269 3300047322 Ga0495680_0006579 Ga0495680_0006579_3901_4725 268
270 3300047322 Ga0495680_0033870 Ga0495680_0033870_1010_1834 268
271 3300047444 Ga0495675_0049237 Ga0495675_0049237_1249_2073 268
272 3300047471 Ga0495684_0182932 Ga0495684_0182932_234_1058 268
273 3300047673 Ga0495593_0190135 Ga0495593_0190135_19_843 268
274 3300048088 Ga0495602_0009419 Ga0495602_0009419_1273_2097 268
275 3300048088 Ga0495602_0024548 Ga0495602_0024548_4823_5728 268
276 3300048088 Ga0495602_0158163 Ga0495602_0158163_535_1359 268
277 3300048905 Ga0496102_0218355 Ga0496102_0218355_208_1032 268
278 3300048907 Ga0496104_0017259 Ga0496104_0017259_4950_5774 268
279 3300048908 Ga0496105_0002837 Ga0496105_0002837_91_915 268
280 3300048911 Ga0496108_0004955 Ga0496108_0004955_7658_8482 268
281 3300048912 Ga0496109_0331273 Ga0496109_0331273_379_1203 268
282 3300048913 Ga0496110_0028481 Ga0496110_0028481_2740_3564 268
283 3300048914 Ga0496111_0021912 Ga0496111_0021912_3252_4076 268
284 3300048915 Ga0496112_0033219 Ga0496112_0033219_521_1345 268
285 3300048916 Ga0496113_0032553 Ga0496113_0032553_1376_2200 268
286 3300050507 nmdc:mga05p37_15752_c1 nmdc:mga05p37_15752_c1_3038_3862 268
287 3300050511 nmdc:mga08y16_289204_c1 nmdc:mga08y16_289204_c1_358_1182 268
288 3300050512 nmdc:mga0n895_187962_c1 nmdc:mga0n895_187962_c1_914_1738 268
289 3300050512 nmdc:mga0n895_311863_c1 nmdc:mga0n895_311863_c1_369_1193 268
290 3300050513 nmdc:mga0rr50_46662_c1 nmdc:mga0rr50_46662_c1_1084_1908 268
291 3300050514 nmdc:mga08x19_193193_c1 nmdc:mga08x19_193193_c1_290_1114 268
292 3300050514 nmdc:mga08x19_26865_c1 nmdc:mga08x19_26865_c1_1718_2542 268
293 3300050515 nmdc:mga0a205_178018_c1 nmdc:mga0a205_178018_c1_43_867 268
294 3300053077 Ga0495601_0014123 Ga0495601_0014123_3901_4725 268
295 3300053078 Ga0495612_0039312 Ga0495612_0039312_403_1227 268
296 3300053085 Ga0495619_0052680 Ga0495619_0052680_983_1807 268
297 3300006844 Ga0075428_100239860 Ga0075428_1002398602 270
298 3300006846 Ga0075430_100040534 Ga0075430_1000405344 270
299 3300006847 Ga0075431_100351713 Ga0075431_1003517132 270
300 3300006880 Ga0075429_100052798 Ga0075429_1000527984 270
301 3300009147 Ga0114129_10000010 Ga0114129_1000001057 270
302 3300009147 Ga0114129_10010765 Ga0114129_100107657 270
303 3300050507 nmdc:mga05p37_422868_c1 nmdc:mga05p37_422868_c1_509_1339 270
304 3300050507 nmdc:mga05p37_9973_c1 nmdc:mga05p37_9973_c1_2249_3061 270
305 3300050508 nmdc:mga09592_353013_c1 nmdc:mga09592_353013_c1_296_1126 270
306 3300050508 nmdc:mga09592_41248_c1 nmdc:mga09592_41248_c1_1954_2784 270
307 3300050510 nmdc:mga06r32_232013_c1 nmdc:mga06r32_232013_c1_696_1508 270
308 3300032126 Ga0307415_100163752 Ga0307415_1001637522 271
309 3300037068 Ga0373925_0005596 Ga0373925_0005596_2728_3561 271
310 3300005445 Ga0070708_100302890 Ga0070708_1003028902 272
311 3300005467 Ga0070706_100052077 Ga0070706_1000520773 272
312 3300005471 Ga0070698_100469103 Ga0070698_1004691032 272
313 3300025910 Ga0207684_10042766 Ga0207684_100427663 272
314 3300025922 Ga0207646_10064576 Ga0207646_100645763 272
315 iso_pu_bacteria 2515154088 2515496281 272
316 iso_pu_bacteria 2515154129 2515718546 272
317 iso_pu_bacteria 2515154137 2515756558 272
318 iso_pu_bacteria 2515154202 2516082786 272
319 iso_pu_bacteria 2515154203 2516089215 272
320 iso_pu_bacteria 2831935698 2831938409 272
321 iso_pu_bacteria 2832004796 2832007205 272
322 iso_pu_bacteria 2866065130 2866069196 272
323 iso_pu_bacteria 2867302475 2867305505 272
324 iso_pu_bacteria 2867312974 2867316759 272
325 iso_pu_bacteria 2867319477 2867321952 272
326 iso_pu_bacteria 2867507094 2867512264 272
327 3300006871 Ga0075434_100147054 Ga0075434_1001470542 273
328 3300035083 Ga0373926_0013680 Ga0373926_0013680_123_962 273
329 3300035089 Ga0373944_0003813 Ga0373944_0003813_2013_2852 273
330 3300035170 Ga0373943_0245360 Ga0373943_0245360_91_930 273
331 3300035171 Ga0373946_0031308 Ga0373946_0031308_169_1008 273
332 3300035172 Ga0373955_0009956 Ga0373955_0009956_30_869 273
333 3300035692 Ga0373935_0005998 Ga0373935_0005998_3872_4711 273
334 3300035695 Ga0373927_0042318 Ga0373927_0042318_130_969 273
335 3300035725 Ga0373947_0000004 Ga0373947_0000004_61438_62277 273
336 3300035725 Ga0373947_0230615 Ga0373947_0230615_97_936 273
337 3300037068 Ga0373925_0308577 Ga0373925_0308577_394_1233 273
338 3300046459 Ga0495629_0054952 Ga0495629_0054952_305_1144 273
339 3300046463 Ga0495653_0177165 Ga0495653_0177165_394_1233 273
340 3300046472 Ga0495580_0072366 Ga0495580_0072366_997_1836 273
341 3300046473 Ga0495582_0019517 Ga0495582_0019517_2730_3569 273
342 3300046517 Ga0495630_0278204 Ga0495630_0278204_394_1233 273
343 3300046526 Ga0495666_0071096 Ga0495666_0071096_735_1574 273
344 3300046529 Ga0495652_0252370 Ga0495652_0252370_108_947 273
345 3300046531 Ga0495665_0101896 Ga0495665_0101896_90_929 273
346 3300046543 Ga0495645_0070496 Ga0495645_0070496_1636_2475 273
347 3300046559 Ga0495667_0220503 Ga0495667_0220503_332_1171 273
348 3300046642 Ga0495634_0050020 Ga0495634_0050020_1487_2326 273
349 3300046681 Ga0495647_0039383 Ga0495647_0039383_332_1171 273
350 3300047315 Ga0495581_0020278 Ga0495581_0020278_2443_3282 273
351 3300047319 Ga0495674_0040474 Ga0495674_0040474_771_1610 273
352 3300047321 Ga0495676_0103312 Ga0495676_0103312_382_1221 273
353 3300047322 Ga0495680_0014856 Ga0495680_0014856_2916_3755 273
354 3300047673 Ga0495593_0007813 Ga0495593_0007813_1277_2116 273
355 iso_pu_bacteria 2622736626 2623591522 273
356 iso_pu_bacteria 2772190715 2772645714 273
357 iso_pu_bacteria 2855670206 2855670612 273
358 iso_pu_bacteria 2855676851 2855683469 273
359 iso_pu_bacteria 2855683550 2855687260 273
360 iso_pu_bacteria 2856858025 2856858570 273
361 iso_pu_bacteria 2857288857 2857288958 273
362 iso_pu_bacteria 2858848962 2858854216 273
363 iso_pu_bacteria 2858868258 2858873408 273
364 iso_pu_bacteria 2858882152 2858887195 273
365 iso_pu_bacteria 2858888857 2858892143 273
366 iso_pu_bacteria 2858895516 2858897837 273
367 iso_pu_bacteria 2858902515 2858903226 273
368 iso_pu_bacteria 2869048445 2869049558 273
369 iso_pu_bacteria 2869061728 2869065700 273
370 iso_pu_bacteria 2869068681 2869070596 273
371 iso_pu_bacteria 2880489317 2880495567 273
372 iso_pu_bacteria 2880495981 2880496786 273
373 iso_pu_bacteria 2902582711 2902583895 273
374 iso_pu_bacteria 2929219909 2929225410 273
375 iso_pu_bacteria 2929226422 2929231613 273
376 iso_pu_bacteria 2996221748 2996224010 273
377 iso_pu_bacteria 649633069 649813248 273
378 iso_pu_bacteria 8003830390 8003835806 273
379 iso_pu_bacteria 8003856774 8003861935 273
380 iso_pu_bacteria 8003870546 8003876323 273
381 iso_pu_bacteria 8054704163 8054708297 273
382 iso_pu_bacteria 8054727385 8054734370 273
383 iso_pu_bacteria 8054734606 8054740132 273
384 iso_pu_bacteria 8055412473 8055416258 273
385 3300005467 Ga0070706_100084308 Ga0070706_1000843083 274
386 3300005518 Ga0070699_100043566 Ga0070699_1000435663 274
387 3300025910 Ga0207684_10169490 Ga0207684_101694902 274
388 3300025922 Ga0207646_10072279 Ga0207646_100722792 274
389 3300046690 Ga0495624_0035880 Ga0495624_0035880_1679_2584 274
390 3300048088 Ga0495602_0041899 Ga0495602_0041899_2001_2843 274
391 3300048089 Ga0495614_0059053 Ga0495614_0059053_309_1214 274
392 iso_pu_bacteria 2675903059 2676481166 274
393 3300031548 Ga0307408_100043675 Ga0307408_1000436752 275
394 3300031731 Ga0307405_10053082 Ga0307405_100530823 275
395 3300031824 Ga0307413_10054612 Ga0307413_100546122 275
396 3300031852 Ga0307410_10238619 Ga0307410_102386191 275
397 3300031889 Ga0326468_10001057 Ga0326468_100010572 275
398 3300031901 Ga0307406_10052811 Ga0307406_100528111 275
399 3300031911 Ga0307412_10083194 Ga0307412_100831942 275
400 3300031995 Ga0307409_100006475 Ga0307409_1000064756 275
401 3300032002 Ga0307416_100015727 Ga0307416_1000157274 275
402 3300032126 Ga0307415_100004302 Ga0307415_1000043026 275
403 3300005329 Ga0070683_100350827 Ga0070683_1003508271 276
404 3300031995 Ga0307409_100080257 Ga0307409_1000802572 276
405 3300032004 Ga0307414_10436093 Ga0307414_104360932 276
406 3300032126 Ga0307415_100182904 Ga0307415_1001829041 276
407 3300037312 Ga0395899_0327726 Ga0395899_0327726_17_886 276
408 3300038443 Ga0395901_0002584 Ga0395901_0002584_12983_13870 276
409 iso_pu_bacteria 2501939600 2501940307 276
410 3300005329 Ga0070683_100195959 Ga0070683_1001959592 277
411 3300005535 Ga0070684_100003933 Ga0070684_1000039339 277
412 3300005577 Ga0068857_100116271 Ga0068857_1001162712 277
413 3300006846 Ga0075430_100089398 Ga0075430_1000893982 278
414 3300049584 Ga0501068_0266117 Ga0501068_0266117_216_1052 278
415 3300050509 nmdc:mga0qj67_12039_c1 nmdc:mga0qj67_12039_c1_952_1788 278
416 iso_pu_bacteria 2751185782 2753265023 278
417 3300005985 Ga0081539_10000333 Ga0081539_1000033369 281
418 3300037312 Ga0395899_0087831 Ga0395899_0087831_275_1120 281
419 3300037418 Ga0395900_0185710 Ga0395900_0185710_729_1574 281
420 3300037466 Ga0395898_0004207 Ga0395898_0004207_4879_5724 281
421 3300037471 Ga0395905_0095542 Ga0395905_0095542_1526_2371 281
422 3300038443 Ga0395901_0097395 Ga0395901_0097395_1733_2578 281
423 3300003322 rootL2_10223346 rootL2_102233462 282
424 3300005338 Ga0068868_100175715 Ga0068868_1001757152 282
425 3300005347 Ga0070668_100036047 Ga0070668_1000360472 282
426 3300005367 Ga0070667_100240619 Ga0070667_1002406191 282
427 3300005548 Ga0070665_100165915 Ga0070665_1001659153 282
428 3300005842 Ga0068858_100073621 Ga0068858_1000736213 282
429 3300005983 Ga0081540_1008415 Ga0081540_10084155 282
430 3300011119 Ga0105246_10558786 Ga0105246_105587861 282
431 3300013308 Ga0157375_10630080 Ga0157375_106300801 282
432 3300014325 Ga0163163_10218429 Ga0163163_102184292 282
433 3300014968 Ga0157379_10107941 Ga0157379_101079413 282
434 3300025972 Ga0207668_10029174 Ga0207668_100291743 282
435 3300026023 Ga0207677_10275258 Ga0207677_102752582 282
436 3300026035 Ga0207703_10103541 Ga0207703_101035412 282
437 3300028381 Ga0268264_10005255 Ga0268264_100052555 282
438 3300028794 Ga0307515_10000065 Ga0307515_1000006564 282
439 3300031507 Ga0307509_10056958 Ga0307509_100569583 282
440 3300031507 Ga0307509_10204778 Ga0307509_102047781 282
441 3300031616 Ga0307508_10101764 Ga0307508_101017642 282
442 3300031730 Ga0307516_10004210 Ga0307516_1000421012 282
443 3300031730 Ga0307516_10133523 Ga0307516_101335232 282
444 3300031824 Ga0307413_10067859 Ga0307413_100678591 282
445 3300033179 Ga0307507_10025671 Ga0307507_100256714 282
446 3300005985 Ga0081539_10013060 Ga0081539_100130602 283
447 3300028786 Ga0307517_10064524 Ga0307517_100645243 283
448 3300028786 Ga0307517_10116144 Ga0307517_101161442 283
449 3300028794 Ga0307515_10014253 Ga0307515_100142533 283
450 3300028794 Ga0307515_10036058 Ga0307515_100360582 283
451 3300028794 Ga0307515_10086391 Ga0307515_100863911 283
452 3300030522 Ga0307512_10002293 Ga0307512_1000229310 283
453 3300030522 Ga0307512_10005567 Ga0307512_100055675 283
454 3300031456 Ga0307513_10017579 Ga0307513_1001757910 283
455 3300031616 Ga0307508_10014221 Ga0307508_100142217 283
456 3300031730 Ga0307516_10124572 Ga0307516_101245721 283
457 3300031730 Ga0307516_10372704 Ga0307516_103727042 283
458 3300045976 Ga0466967_0155309 Ga0466967_0155309_278_1129 283
459 3300046460 Ga0495638_0191337 Ga0495638_0191337_196_1047 283
460 3300053088 Ga0500644_0002336 Ga0500644_0002336_589_1440 283
461 3300053093 Ga0500651_0076455 Ga0500651_0076455_1018_1869 283
462 3300053096 Ga0500641_0053606 Ga0500641_0053606_755_1606 283
463 3300053098 Ga0500650_0088716 Ga0500650_0088716_175_1026 283
464 3300053109 Ga0500569_003510 Ga0500569_003510_1737_2588 283
465 3300053118 Ga0500594_0005151 Ga0500594_0005151_779_1630 283
466 3300053149 Ga0500600_0049907 Ga0500600_0049907_256_1107 283
467 3300005347 Ga0070668_100000410 Ga0070668_1000004109 284
468 3300025972 Ga0207668_10002557 Ga0207668_100025577 284
469 3300031731 Ga0307405_10038622 Ga0307405_100386223 284
470 3300032126 Ga0307415_100161699 Ga0307415_1001616992 284
471 3300032126 Ga0307415_100215829 Ga0307415_1002158292 284
472 3300003203 JGI25406J46586_10054899 JGI25406J46586_100548991 286
473 3300005985 Ga0081539_10000657 Ga0081539_1000065753 286
474 3300048911 Ga0496108_0000010 Ga0496108_0000010_107435_108295 286
475 3300035091 Ga0373951_0000316 Ga0373951_0000316_2082_2948 288
476 3300035115 Ga0373941_0033467 Ga0373941_0033467_177_1214 290
477 3300035207 Ga0373942_0000159 Ga0373942_0000159_6546_7553 290
478 3300037471 Ga0395905_0244334 Ga0395905_0244334_477_1358 291
479 3300038443 Ga0395901_0090855 Ga0395901_0090855_1106_1987 291
480 3300003203 JGI25406J46586_10014085 JGI25406J46586_100140852 302
481 3300005985 Ga0081539_10001151 Ga0081539_1000115117 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01734

Patatin

Patatin-like phospholipase

11

181

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.8081 8 276
5fqu-assembly1.cif.gz_B orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.7993 7 275
5fqu-assembly1.cif.gz_A orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.7931 7 275
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.7906 8 276
5fya-assembly1.cif.gz_B cubic crystal of the native plpd 0.783 7 280
ID Description Score Start End Superfamily
af_K7LIJ4_222_448_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.8189 7 190 3.40.1090.10
af_Q4CYT0_175_370_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7856 12 169 3.40.1090.10
af_A0A0P0XFP9_51_260_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7716 6 171 3.40.1090.10
af_I1KJJ2_27_400_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7685 7 269 3.40.1090.10
af_Q9N5Z7_84_319_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.763 6 176 3.40.1090.10
ID Description Score Start End GO Terms
AF-A0A5S4F8Y9-F1-model_v4 Patatin-like phospholipase family protein 0.9285 4 276 GO:0016042
GO:0016787
AF-A0A2U3C738-F1-model_v4 Patatin 0.928 7 277 GO:0016042
GO:0016787
AF-H6RKP1-F1-model_v4 Putative esterase of the alpha-beta hydrolase superfamily (EC 3.1.1.-) 0.9082 94 278 GO:0016042
GO:0016787
AF-A0A7K1CWD8-F1-model_v4 Patatin-like phospholipase family protein 0.9034 4 277 GO:0016042
GO:0016787
AF-A0A7K1CWD8-F1-model_v4 Patatin-like phospholipase family protein 0.891 4 277 GO:0016042
GO:0016787

Feature Viewer

pLDDT pTM Quality
80.74 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map