F452355

General Info

Members Datasets Scaffolds Average Seq Length
481 226 481 96

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100790774|Ga0070690_1007907742
Length 99
Sequence MTSIDRLYRIAAAPLISEKGTDDSSSRNTYHFRVPLDANKVEIRQAVEKLFKVKVAEVRTMNLEGKLRRRGKFAGYRSDWKKAYVKLKPGQKSPEYADI

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
149 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 3.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.62
Rhizosphere 98.13
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11773782 3300004799 Bacteria 1461
2 Ga0070658_10034348 3300005327 Bacteria 4080
3 Ga0070658_10087950 3300005327 Bacteria 2558
4 Ga0070683_100011876 3300005329 Bacteria 7549
5 Ga0070683_100127827 3300005329 Bacteria 2403
6 Ga0070683_100140694 3300005329 Bacteria 2286
7 Ga0070690_100355530 3300005330 Bacteria 1064
8 Ga0070690_100790774 3300005330 Bacteria 735
9 Ga0070690_101045586 3300005330 Unclassified 645
10 Ga0070670_101280382 3300005331 Unclassified 671
11 Ga0068869_100032062 3300005334 Bacteria 3700
12 Ga0070666_10335211 3300005335 Bacteria 1081
13 Ga0070666_10611444 3300005335 Bacteria 796
14 Ga0070680_100003385 3300005336 Bacteria 11897
15 Ga0070680_101971883 3300005336 Unclassified 506
16 Ga0070682_100229280 3300005337 Bacteria 1327
17 Ga0070682_101890528 3300005337 Bacteria 523
18 Ga0068868_100732432 3300005338 Bacteria 887
19 Ga0068868_100740222 3300005338 Bacteria 882
20 Ga0070660_100603597 3300005339 Bacteria 918
21 Ga0070660_100828818 3300005339 Bacteria 779
22 Ga0070689_100145757 3300005340 Bacteria 1907
23 Ga0070689_101993010 3300005340 Unclassified 531
24 Ga0070661_100095351 3300005344 Bacteria 2207
25 Ga0070661_100171910 3300005344 Bacteria 1646
26 Ga0070692_10429462 3300005345 Unclassified 841
27 Ga0070673_100224680 3300005364 Bacteria 1627
28 Ga0070659_100040328 3300005366 Bacteria 3647
29 Ga0070659_100461056 3300005366 Bacteria 1079
30 Ga0070667_100112886 3300005367 Bacteria 2358
31 Ga0070667_101990900 3300005367 Bacteria 547
32 Ga0070709_10601432 3300005434 Bacteria 847
33 Ga0070709_11420961 3300005434 Unclassified 562
34 Ga0070714_100226935 3300005435 Bacteria 1719
35 Ga0070714_100242744 3300005435 Bacteria 1663
36 Ga0070713_100319766 3300005436 Bacteria 1433
37 Ga0070713_101714319 3300005436 Bacteria 610
38 Ga0070711_100248899 3300005439 Bacteria 1393
39 Ga0070711_100467606 3300005439 Bacteria 1035
40 Ga0070711_101282670 3300005439 Unclassified 635
41 Ga0070663_101937936 3300005455 Bacteria 530
42 Ga0070678_100909430 3300005456 Unclassified 805
43 Ga0070678_101130244 3300005456 Bacteria 724
44 Ga0070662_100110487 3300005457 Bacteria 2094
45 Ga0070681_10279937 3300005458 Bacteria 1579
46 Ga0070681_11312271 3300005458 Unclassified 647
47 Ga0068867_100164843 3300005459 Bacteria 1750
48 Ga0068867_100511163 3300005459 Bacteria 1034
49 Ga0068867_100798068 3300005459 Unclassified 842
50 Ga0070685_11487597 3300005466 Unclassified 521
51 Ga0070679_100306968 3300005530 Unclassified 1537
52 Ga0070679_100796808 3300005530 Bacteria 888
53 Ga0070684_100043376 3300005535 Bacteria 3883
54 Ga0070684_100084550 3300005535 Bacteria 2813
55 Ga0070684_100382373 3300005535 Bacteria 1297
56 Ga0070684_100910473 3300005535 Unclassified 824
57 Ga0070684_101296137 3300005535 Bacteria 686
58 Ga0068853_100133809 3300005539 Bacteria 2221
59 Ga0068853_100849546 3300005539 Bacteria 875
60 Ga0068853_101023187 3300005539 Bacteria 796
61 Ga0070672_100454817 3300005543 Bacteria 1103
62 Ga0070672_100603484 3300005543 Bacteria 956
63 Ga0070686_100378425 3300005544 Bacteria 1071
64 Ga0070696_100637017 3300005546 Bacteria 863
65 Ga0070696_101785997 3300005546 Bacteria 531
66 Ga0070665_100019426 3300005548 Bacteria 6819
67 Ga0070665_100193238 3300005548 Bacteria 2036
68 Ga0070665_100489396 3300005548 Bacteria 1241
69 Ga0068855_100019267 3300005563 Bacteria 8202
70 Ga0068855_100067695 3300005563 Bacteria 4159
71 Ga0068855_100099913 3300005563 Bacteria 3341
72 Ga0068855_100135549 3300005563 Bacteria 2809
73 Ga0068855_100274061 3300005563 Bacteria 1875
74 Ga0068855_100336135 3300005563 Bacteria 1666
75 Ga0068855_101494025 3300005563 Bacteria 694
76 Ga0070664_100221341 3300005564 Bacteria 1693
77 Ga0070664_100408912 3300005564 Bacteria 1242
78 Ga0070664_101985845 3300005564 Bacteria 552
79 Ga0070664_102370850 3300005564 Unclassified 503
80 Ga0068857_100373758 3300005577 Bacteria 1322
81 Ga0068857_102349277 3300005577 Unclassified 523
82 Ga0068854_100081038 3300005578 Bacteria 2396
83 Ga0068854_100448867 3300005578 Bacteria 1077
84 Ga0068854_101230312 3300005578 Unclassified 672
85 Ga0068856_100018870 3300005614 Bacteria 6688
86 Ga0068856_100074498 3300005614 Bacteria 3361
87 Ga0068856_100173262 3300005614 Bacteria 2170
88 Ga0068856_100583850 3300005614 Bacteria 1139
89 Ga0068856_102005051 3300005614 Bacteria 589
90 Ga0070702_100140027 3300005615 Bacteria 1540
91 Ga0068852_100024674 3300005616 Bacteria 4863
92 Ga0068852_100054705 3300005616 Bacteria 3441
93 Ga0068852_100520927 3300005616 Unclassified 1186
94 Ga0068852_100559762 3300005616 Bacteria 1144
95 Ga0068852_101066371 3300005616 Bacteria 828
96 Ga0068852_101595218 3300005616 Unclassified 675
97 Ga0068852_102197503 3300005616 Unclassified 573
98 Ga0068859_100528142 3300005617 Bacteria 1275
99 Ga0068864_101664988 3300005618 Unclassified 642
100 Ga0068866_10105529 3300005718 Unclassified 1562
101 Ga0068866_11119813 3300005718 Bacteria 565
102 Ga0068866_11326093 3300005718 Bacteria 524
103 Ga0068861_101882474 3300005719 Unclassified 595
104 Ga0068851_10018984 3300005834 Bacteria 3320
105 Ga0068851_10197446 3300005834 Bacteria 1121
106 Ga0068863_100294776 3300005841 Bacteria 1572
107 Ga0068863_100752387 3300005841 Bacteria 970
108 Ga0068863_101103759 3300005841 Bacteria 798
109 Ga0068858_100065255 3300005842 Bacteria 3368
110 Ga0068858_100107555 3300005842 Bacteria 2603
111 Ga0068858_100518938 3300005842 Bacteria 1152
112 Ga0068860_100377752 3300005843 Bacteria 1398
113 Ga0068860_100615283 3300005843 Bacteria 1092
114 Ga0070717_10008895 3300006028 Bacteria 7523
115 Ga0070717_10415563 3300006028 Bacteria 1210
116 Ga0070715_11004026 3300006163 Unclassified 520
117 Ga0097621_100084015 3300006237 Bacteria 2654
118 Ga0097621_100400621 3300006237 Bacteria 1228
119 Ga0097621_101347968 3300006237 Bacteria 675
120 Ga0068871_100321617 3300006358 Bacteria 1362
121 Ga0068871_100443827 3300006358 Bacteria 1162
122 Ga0068871_100587733 3300006358 Bacteria 1012
123 Ga0075430_100062426 3300006846 Bacteria 3130
124 Ga0075430_101565249 3300006846 Unclassified 541
125 Ga0075431_100269551 3300006847 Bacteria 1726
126 Ga0075429_100843529 3300006880 Bacteria 802
127 Ga0075429_101284120 3300006880 Unclassified 638
128 Ga0068865_100083824 3300006881 Bacteria 2295
129 Ga0068865_100444614 3300006881 Bacteria 1070
130 Ga0068865_101229805 3300006881 Bacteria 664
131 Ga0097620_100528128 3300006931 Bacteria 1275
132 Ga0105244_10158474 3300009036 Bacteria 1082
133 Ga0105240_10032555 3300009093 Bacteria 6750
134 Ga0105240_10050651 3300009093 Bacteria 5233
135 Ga0105240_10146366 3300009093 Bacteria 2818
136 Ga0105240_10158948 3300009093 Bacteria 2686
137 Ga0105240_10356892 3300009093 Bacteria 1657
138 Ga0111539_10435561 3300009094 Bacteria 1527
139 Ga0111539_10953621 3300009094 Bacteria 997
140 Ga0111539_12245224 3300009094 Unclassified 633
141 Ga0105245_10035188 3300009098 Bacteria 4445
142 Ga0105245_10438605 3300009098 Bacteria 1312
143 Ga0105247_10766052 3300009101 Bacteria 733
144 Ga0105247_11211634 3300009101 Bacteria 602
145 Ga0114129_10281931 3300009147 Bacteria 2220
146 Ga0105243_10340774 3300009148 Bacteria 1373
147 Ga0105241_10019071 3300009174 Bacteria 5058
148 Ga0105241_10033499 3300009174 Bacteria 3856
149 Ga0105241_10102535 3300009174 Bacteria 2277
150 Ga0105241_10269414 3300009174 Bacteria 1450
151 Ga0105241_10455233 3300009174 Bacteria 1133
152 Ga0105241_10680473 3300009174 Bacteria 937
153 Ga0105241_11114745 3300009174 Bacteria 744
154 Ga0105242_10169196 3300009176 Bacteria 1919
155 Ga0105242_10828011 3300009176 Bacteria 919
156 Ga0105242_10878270 3300009176 Bacteria 895
157 Ga0105248_10140985 3300009177 Bacteria 2719
158 Ga0105248_10145379 3300009177 Bacteria 2675
159 Ga0105248_10245059 3300009177 Bacteria 2017
160 Ga0105248_10395810 3300009177 Bacteria 1555
161 Ga0105248_11049092 3300009177 Bacteria 921
162 Ga0105248_11759136 3300009177 Bacteria 703
163 Ga0105248_11770371 3300009177 Unclassified 700
164 Ga0105237_10120724 3300009545 Bacteria 2615
165 Ga0105237_10322306 3300009545 Bacteria 1549
166 Ga0105237_10355666 3300009545 Bacteria 1469
167 Ga0105237_10950360 3300009545 Bacteria 866
168 Ga0105237_11426848 3300009545 Bacteria 699
169 Ga0105237_11478090 3300009545 Unclassified 686
170 Ga0105237_12740522 3300009545 Bacteria 504
171 Ga0105238_10010551 3300009551 Bacteria 9278
172 Ga0105238_10182410 3300009551 Bacteria 2076
173 Ga0105238_10246915 3300009551 Bacteria 1763
174 Ga0105238_10553536 3300009551 Bacteria 1155
175 Ga0105238_11411165 3300009551 Unclassified 724
176 Ga0105238_12859825 3300009551 Unclassified 519
177 Ga0105249_10127289 3300009553 Bacteria 2427
178 Ga0105249_10898846 3300009553 Unclassified 952
179 Ga0105239_10018959 3300010375 Bacteria 7604
180 Ga0105239_10353252 3300010375 Bacteria 1660
181 Ga0105239_12116984 3300010375 Unclassified 654
182 Ga0105239_12424120 3300010375 Bacteria 611
183 Ga0105239_13625040 3300010375 Bacteria 502
184 Ga0105246_10059101 3300011119 Bacteria 2658
185 Ga0105246_10179461 3300011119 Bacteria 1629
186 Ga0105246_12099341 3300011119 Unclassified 547
187 Ga0157373_10151724 3300013100 Bacteria 1630
188 Ga0157373_10318742 3300013100 Bacteria 1106
189 Ga0157373_10444366 3300013100 Bacteria 933
190 Ga0157373_10539172 3300013100 Bacteria 845
191 Ga0157373_10581839 3300013100 Bacteria 814
192 Ga0157371_11641652 3300013102 Unclassified 504
193 Ga0157370_10006622 3300013104 Bacteria 12731
194 Ga0157370_10008076 3300013104 Bacteria 11391
195 Ga0157370_10192208 3300013104 Bacteria 1895
196 Ga0157369_10004351 3300013105 Bacteria 16713
197 Ga0157369_10008438 3300013105 Bacteria 11818
198 Ga0157369_10069033 3300013105 Bacteria 3797
199 Ga0157369_10073830 3300013105 Bacteria 3659
200 Ga0157369_10099938 3300013105 Bacteria 3092
201 Ga0157369_10512462 3300013105 Bacteria 1241
202 Ga0157369_10934338 3300013105 Bacteria 889
203 Ga0157374_10285686 3300013296 Bacteria 1629
204 Ga0157374_11234446 3300013296 Unclassified 769
205 Ga0157374_12227279 3300013296 Unclassified 575
206 Ga0157374_12722134 3300013296 Bacteria 522
207 Ga0157378_10162304 3300013297 Bacteria 2090
208 Ga0157378_10511865 3300013297 Bacteria 1201
209 Ga0163162_11160875 3300013306 Bacteria 876
210 Ga0163162_11604353 3300013306 Bacteria 742
211 Ga0163162_12271444 3300013306 Unclassified 623
212 Ga0163162_12325036 3300013306 Unclassified 616
213 Ga0157372_10000424 3300013307 Bacteria 46469
214 Ga0157372_10092295 3300013307 Bacteria 3444
215 Ga0157372_10124099 3300013307 Bacteria 2968
216 Ga0157372_10136299 3300013307 Bacteria 2827
217 Ga0157372_10492494 3300013307 Bacteria 1429
218 Ga0157372_10552252 3300013307 Bacteria 1343
219 Ga0157372_10848801 3300013307 Bacteria 1060
220 Ga0157375_10165732 3300013308 Bacteria 2354
221 Ga0157375_11245580 3300013308 Bacteria 873
222 Ga0157375_11551984 3300013308 Bacteria 782
223 Ga0163163_10093659 3300014325 Bacteria 3021
224 Ga0163163_10142252 3300014325 Bacteria 2441
225 Ga0163163_11321162 3300014325 Bacteria 783
226 Ga0163163_11729153 3300014325 Unclassified 686
227 Ga0182008_10061089 3300014497 Bacteria 1857
228 Ga0157376_10913440 3300014969 Unclassified 897
229 Ga0163161_10407674 3300017792 Bacteria 1091
230 Ga0197907_10629253 3300020069 Bacteria 691
231 Ga0197907_11426004 3300020069 Bacteria 1347
232 Ga0197907_11511092 3300020069 Unclassified 718
233 Ga0206352_10081231 3300020078 Bacteria 979
234 Ga0206352_10629975 3300020078 Bacteria 1125
235 Ga0206350_10722182 3300020080 Bacteria 869
236 Ga0206354_10031333 3300020081 Unclassified 544
237 Ga0213873_10148009 3300021358 Unclassified 705
238 Ga0213876_10445947 3300021384 Unclassified 688
239 Ga0224712_10203988 3300022467 Bacteria 899
240 Ga0207656_10021069 3300025321 Bacteria 2599
241 Ga0207656_10136248 3300025321 Bacteria 1154
242 Ga0207642_10077223 3300025899 Unclassified 1606
243 Ga0207710_10154007 3300025900 Bacteria 1116
244 Ga0207680_11265087 3300025903 Unclassified 525
245 Ga0207647_10510618 3300025904 Unclassified 669
246 Ga0207685_10592033 3300025905 Bacteria 594
247 Ga0207699_10115363 3300025906 Bacteria 1728
248 Ga0207699_10701868 3300025906 Bacteria 741
249 Ga0207645_10500873 3300025907 Bacteria 822
250 Ga0207645_10735376 3300025907 Bacteria 671
251 Ga0207705_10110797 3300025909 Bacteria 2028
252 Ga0207705_10247022 3300025909 Bacteria 1360
253 Ga0207705_10532240 3300025909 Bacteria 913
254 Ga0207654_10001818 3300025911 Bacteria 11074
255 Ga0207654_10016146 3300025911 Bacteria 3884
256 Ga0207654_10023979 3300025911 Bacteria 3275
257 Ga0207654_10314553 3300025911 Bacteria 1069
258 Ga0207654_10989430 3300025911 Bacteria 611
259 Ga0207707_10560064 3300025912 Bacteria 970
260 Ga0207695_10000379 3300025913 Bacteria 101331
261 Ga0207695_10003215 3300025913 Bacteria 23264
262 Ga0207695_10113892 3300025913 Bacteria 2680
263 Ga0207695_10274140 3300025913 Bacteria 1582
264 Ga0207671_10000503 3300025914 Bacteria 53115
265 Ga0207671_10186363 3300025914 Bacteria 1617
266 Ga0207671_10633766 3300025914 Bacteria 851
267 Ga0207671_10776696 3300025914 Bacteria 760
268 Ga0207671_11338872 3300025914 Unclassified 557
269 Ga0207663_10042911 3300025916 Bacteria 2766
270 Ga0207663_10389117 3300025916 Bacteria 1064
271 Ga0207663_11166765 3300025916 Unclassified 620
272 Ga0207660_10009654 3300025917 Bacteria 6246
273 Ga0207662_10949465 3300025918 Unclassified 610
274 Ga0207657_10171546 3300025919 Bacteria 1757
275 Ga0207657_10494097 3300025919 Bacteria 959
276 Ga0207657_10641450 3300025919 Bacteria 827
277 Ga0207649_10007836 3300025920 Bacteria 5812
278 Ga0207649_10168565 3300025920 Bacteria 1523
279 Ga0207652_10176277 3300025921 Bacteria 1920
280 Ga0207652_11308553 3300025921 Bacteria 627
281 Ga0207694_10001290 3300025924 Bacteria 21610
282 Ga0207694_10126612 3300025924 Bacteria 2044
283 Ga0207694_10205170 3300025924 Bacteria 1605
284 Ga0207687_10005635 3300025927 Bacteria 8282
285 Ga0207687_10178613 3300025927 Bacteria 1643
286 Ga0207700_10163874 3300025928 Bacteria 1848
287 Ga0207700_11637077 3300025928 Bacteria 569
288 Ga0207700_11637542 3300025928 Unclassified 569
289 Ga0207664_10132452 3300025929 Bacteria 2100
290 Ga0207664_10132724 3300025929 Bacteria 2098
291 Ga0207644_10159342 3300025931 Bacteria 1753
292 Ga0207690_10128235 3300025932 Bacteria 1853
293 Ga0207690_10539238 3300025932 Bacteria 947
294 Ga0207686_10514957 3300025934 Bacteria 930
295 Ga0207686_10942265 3300025934 Bacteria 698
296 Ga0207709_10350679 3300025935 Bacteria 1114
297 Ga0207670_10189237 3300025936 Bacteria 1556
298 Ga0207670_11308966 3300025936 Bacteria 614
299 Ga0207670_11443091 3300025936 Unclassified 585
300 Ga0207669_10439020 3300025937 Bacteria 1032
301 Ga0207704_10063299 3300025938 Bacteria 2305
302 Ga0207704_10446793 3300025938 Bacteria 1031
303 Ga0207704_11369377 3300025938 Unclassified 606
304 Ga0207691_11502131 3300025940 Unclassified 551
305 Ga0207711_10049984 3300025941 Bacteria 3580
306 Ga0207711_10100024 3300025941 Bacteria 2564
307 Ga0207711_10341013 3300025941 Bacteria 1387
308 Ga0207711_10432313 3300025941 Bacteria 1225
309 Ga0207711_10520705 3300025941 Bacteria 1109
310 Ga0207711_11283789 3300025941 Unclassified 674
311 Ga0207661_10204260 3300025944 Bacteria 1738
312 Ga0207661_10342388 3300025944 Bacteria 1347
313 Ga0207679_10131379 3300025945 Bacteria 2009
314 Ga0207679_10183582 3300025945 Bacteria 1733
315 Ga0207679_11081303 3300025945 Bacteria 736
316 Ga0207679_11640738 3300025945 Bacteria 589
317 Ga0207667_10006951 3300025949 Bacteria 13678
318 Ga0207667_10008805 3300025949 Bacteria 11950
319 Ga0207667_10044956 3300025949 Bacteria 4678
320 Ga0207667_10075240 3300025949 Bacteria 3507
321 Ga0207667_10158603 3300025949 Bacteria 2328
322 Ga0207667_10258025 3300025949 Bacteria 1783
323 Ga0207667_10516793 3300025949 Bacteria 1210
324 Ga0207667_11855631 3300025949 Unclassified 566
325 Ga0207651_10072464 3300025960 Bacteria 2446
326 Ga0207651_10438639 3300025960 Bacteria 1118
327 Ga0207640_10592570 3300025981 Bacteria 937
328 Ga0207640_10759592 3300025981 Bacteria 837
329 Ga0207640_11240273 3300025981 Unclassified 664
330 Ga0207658_11900063 3300025986 Unclassified 542
331 Ga0207677_10522312 3300026023 Bacteria 1030
332 Ga0207703_10121825 3300026035 Bacteria 2240
333 Ga0207703_10293427 3300026035 Bacteria 1481
334 Ga0207703_10344238 3300026035 Bacteria 1371
335 Ga0207639_10000868 3300026041 Bacteria 20542
336 Ga0207639_10241593 3300026041 Bacteria 1570
337 Ga0207639_10528640 3300026041 Bacteria 1081
338 Ga0207708_11809269 3300026075 Bacteria 536
339 Ga0207702_10001589 3300026078 Bacteria 22475
340 Ga0207702_10073915 3300026078 Bacteria 2940
341 Ga0207702_10244880 3300026078 Bacteria 1681
342 Ga0207702_12041154 3300026078 Bacteria 563
343 Ga0207641_10912562 3300026088 Bacteria 873
344 Ga0207648_10111966 3300026089 Bacteria 2396
345 Ga0207648_10165067 3300026089 Bacteria 1957
346 Ga0207676_10162211 3300026095 Bacteria 1938
347 Ga0207676_10710020 3300026095 Bacteria 975
348 Ga0207676_12352181 3300026095 Unclassified 530
349 Ga0207676_12543447 3300026095 Bacteria 508
350 Ga0207674_10097677 3300026116 Bacteria 2921
351 Ga0207674_10125804 3300026116 Bacteria 2529
352 Ga0207675_100467402 3300026118 Bacteria 1252
353 Ga0207683_10438507 3300026121 Bacteria 1204
354 Ga0207698_10000039 3300026142 Bacteria 101073
355 Ga0207698_10000059 3300026142 Bacteria 76632
356 Ga0207698_10069757 3300026142 Bacteria 2781
357 Ga0207698_10085167 3300026142 Bacteria 2565
358 Ga0207698_11854078 3300026142 Bacteria 618
359 Ga0268266_11265523 3300028379 Unclassified 713
360 Ga0268264_10567935 3300028381 Unclassified 1115
361 Ga0268264_10943841 3300028381 Bacteria 867
362 Ga0265336_10066187 3300028666 Unclassified 1081
363 Ga0265338_10026446 3300028800 Bacteria 5851
364 Ga0265324_10005069 3300029957 Bacteria 5768
365 Ga0265770_1067326 3300030878 Bacteria 677
366 Ga0265760_10165140 3300031090 Bacteria 733
367 Ga0265332_10024511 3300031238 Bacteria 2654
368 Ga0265328_10127802 3300031239 Bacteria 950
369 Ga0265320_10009193 3300031240 Bacteria 5978
370 Ga0265325_10023327 3300031241 Bacteria 3379
371 Ga0265325_10217872 3300031241 Bacteria 874
372 Ga0265329_10025218 3300031242 Bacteria 1969
373 Ga0265340_10019656 3300031247 Bacteria 3477
374 Ga0265339_10024306 3300031249 Bacteria 3493
375 Ga0265331_10001121 3300031250 Bacteria 20536
376 Ga0265331_10059193 3300031250 Bacteria 1812
377 Ga0265331_10323112 3300031250 Bacteria 691
378 Ga0265316_10045658 3300031344 Bacteria 3476
379 Ga0265316_10088121 3300031344 Bacteria 2370
380 Ga0265316_10264301 3300031344 Bacteria 1261
381 Ga0265316_10327281 3300031344 Bacteria 1112
382 Ga0265316_10348099 3300031344 Bacteria 1073
383 Ga0265316_10393610 3300031344 Unclassified 998
384 Ga0265316_10949812 3300031344 Unclassified 599
385 Ga0265314_10037033 3300031711 Bacteria 3538
386 Ga0265314_10183632 3300031711 Bacteria 1251
387 Ga0265342_10193629 3300031712 Bacteria 1108
388 Ga0265342_10336475 3300031712 Bacteria 788
389 Ga0307412_11766458 3300031911 Bacteria 568
390 Ga0307416_102604910 3300032002 Unclassified 603
391 Ga0316053_107793 3300032120 Unclassified 715
392 Ga0316583_10238438 3300032133 Bacteria 630
393 Ga0373953_0039547 3300035117 Bacteria 1869
394 Ga0373954_0004404 3300035118 Bacteria 6055
395 Ga0373954_0032814 3300035118 Bacteria 2401
396 Ga0373957_0348173 3300035120 Unclassified 632
397 Ga0373946_0256260 3300035171 Unclassified 855
398 Ga0373955_0034008 3300035172 Bacteria 2688
399 Ga0373955_0102378 3300035172 Bacteria 1646
400 Ga0373927_0063287 3300035695 Bacteria 2393
401 Ga0373933_0107041 3300035724 Bacteria 1740
402 Ga0373933_0323120 3300035724 Unclassified 1001
403 Ga0373933_0498201 3300035724 Bacteria 798
404 Ga0373947_0681495 3300035725 Bacteria 701
405 Ga0373937_0018076 3300036401 Bacteria 6288
406 Ga0373937_0390865 3300036401 Bacteria 1319
407 Ga0373937_0868369 3300036401 Bacteria 851
408 Ga0265778_002900 3300036457 Bacteria 1697
409 Ga0265778_011645 3300036457 Bacteria 1016
410 Ga0373925_0100983 3300037068 Bacteria 2218
411 Ga0373925_0652358 3300037068 Unclassified 867
412 Ga0373925_0795072 3300037068 Bacteria 780
413 Ga0373925_1042202 3300037068 Bacteria 673
414 Ga0395900_0566214 3300037418 Bacteria 1079
415 Ga0395898_0117406 3300037466 Bacteria 2549
416 Ga0436364_1078028 3300037853 Unclassified 547
417 Ga0436365_0408821 3300039437 Bacteria 1282
418 Ga0436365_1191518 3300039437 Bacteria 3046
419 Ga0436360_0261959 3300039438 Bacteria 1358
420 Ga0436363_0439753 3300039450 Bacteria 1118
421 Ga0436363_1703451 3300039450 Unclassified 533
422 Ga0436362_0001488 3300039453 Bacteria 1332
423 Ga0451577_0173522 3300042876 Bacteria 1943
424 Ga0451577_1684531 3300042876 Bacteria 558
425 Ga0453683_1042374 3300044673 Bacteria 544
426 Ga0453683_1223051 3300044673 Unclassified 503
427 Ga0466966_0565567 3300044684 Bacteria 684
428 Ga0466963_0003181 3300044694 Bacteria 9324
429 Ga0453684_0195532 3300044712 Bacteria 2362
430 Ga0453684_1049584 3300044712 Bacteria 864
431 Ga0466971_0174310 3300044719 Bacteria 1010
432 Ga0466971_0203686 3300044719 Bacteria 934
433 Ga0466957_0476619 3300044842 Bacteria 863
434 Ga0466959_0680363 3300045049 Bacteria 690
435 Ga0466958_0456218 3300045836 Bacteria 828
436 Ga0466967_0048703 3300045976 Bacteria 3702
437 Ga0466967_0220020 3300045976 Bacteria 1804
438 Ga0466967_0652124 3300045976 Bacteria 1041
439 Ga0466967_1113497 3300045976 Bacteria 787
440 Ga0495653_0843228 3300046463 Bacteria 549
441 Ga0495580_0069834 3300046472 Bacteria 2454
442 Ga0495580_0552097 3300046472 Bacteria 765
443 Ga0495580_0562032 3300046472 Unclassified 757
444 Ga0495664_0577150 3300046477 Bacteria 669
445 Ga0495608_0352040 3300046511 Bacteria 906
446 Ga0495628_0489551 3300046516 Bacteria 889
447 Ga0495652_0147554 3300046529 Bacteria 1842
448 Ga0495640_0846172 3300046533 Unclassified 544
449 Ga0495667_0560841 3300046559 Unclassified 713
450 Ga0495623_0229833 3300046679 Bacteria 1053
451 Ga0495669_0416619 3300046684 Unclassified 651
452 Ga0495600_0404426 3300046809 Bacteria 849
453 Ga0495581_0120249 3300047315 Bacteria 1528
454 Ga0495604_0302389 3300047317 Bacteria 1074
455 Ga0495674_0147668 3300047319 Bacteria 1973
456 Ga0495674_1223168 3300047319 Bacteria 567
457 Ga0495680_0871283 3300047322 Unclassified 584
458 Ga0495675_0039213 3300047444 Bacteria 3017
459 Ga0495684_0089557 3300047471 Bacteria 2331
460 Ga0495684_0152542 3300047471 Bacteria 1727
461 Ga0495684_0969131 3300047471 Unclassified 543
462 Ga0495602_0307814 3300048088 Bacteria 1157
463 Ga0496102_0341167 3300048905 Bacteria 1411
464 Ga0496104_1484708 3300048907 Bacteria 581
465 Ga0496106_0942327 3300048909 Bacteria 681
466 Ga0501070_0020844 3300049586 Bacteria 5499
467 Ga0501072_0941625 3300049588 Bacteria 674
468 nmdc:mga05p37_1553080_c1 3300050507 Unclassified 655
469 nmdc:mga09592_1166991_c1 3300050508 Unclassified 638
470 nmdc:mga0qj67_1304805_c1 3300050509 Unclassified 562
471 nmdc:mga0qj67_132733_c1 3300050509 Bacteria 2017
472 nmdc:mga06r32_10773_c1 3300050510 Bacteria 8236
473 nmdc:mga08y16_1620439_c1 3300050511 Bacteria 604
474 nmdc:mga08y16_571405_c1 3300050511 Bacteria 1142
475 nmdc:mga08y16_847088_c1 3300050511 Bacteria 904
476 Ga0495595_0118603 3300053084 Bacteria 1288
477 Ga0495619_0318175 3300053085 Bacteria 1077
478 Ga0495619_0960435 3300053085 Unclassified 573
479 Ga0587086_020241 3300059507 Bacteria 902
480 Ga0587075_012377 3300059644 Bacteria 1158
481 Ga0587114_122396 3300059655 Unclassified 528

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_11604353 Ga0163162_116043531 89
2 3300045049 Ga0466959_0680363 Ga0466959_0680363_11_280 89
3 3300009101 Ga0105247_11211634 Ga0105247_112116341 90
4 3300005842 Ga0068858_100107555 Ga0068858_1001075553 91
5 3300009098 Ga0105245_10438605 Ga0105245_104386052 91
6 3300009177 Ga0105248_11759136 Ga0105248_117591362 91
7 3300025927 Ga0207687_10178613 Ga0207687_101786132 91
8 3300025941 Ga0207711_10520705 Ga0207711_105207052 91
9 3300026035 Ga0207703_10121825 Ga0207703_101218252 91
10 3300026095 Ga0207676_12543447 Ga0207676_125434472 91
11 3300037068 Ga0373925_0652358 Ga0373925_0652358_548_838 91
12 3300047315 Ga0495581_0120249 Ga0495581_0120249_668_958 91
13 3300050511 nmdc:mga08y16_847088_c1 nmdc:mga08y16_847088_c1_28_318 91
14 3300005615 Ga0070702_100140027 Ga0070702_1001400272 92
15 3300009174 Ga0105241_10102535 Ga0105241_101025352 92
16 3300009176 Ga0105242_10169196 Ga0105242_101691963 92
17 3300009545 Ga0105237_10355666 Ga0105237_103556663 92
18 3300013306 Ga0163162_12325036 Ga0163162_123250362 92
19 3300035171 Ga0373946_0256260 Ga0373946_0256260_304_582 92
20 3300035724 Ga0373933_0498201 Ga0373933_0498201_398_676 92
21 3300004799 Ga0058863_11773782 Ga0058863_117737822 95
22 3300005327 Ga0070658_10034348 Ga0070658_100343486 95
23 3300005327 Ga0070658_10087950 Ga0070658_100879502 95
24 3300005329 Ga0070683_100011876 Ga0070683_10001187611 95
25 3300005329 Ga0070683_100127827 Ga0070683_1001278273 95
26 3300005329 Ga0070683_100140694 Ga0070683_1001406943 95
27 3300005330 Ga0070690_100355530 Ga0070690_1003555302 95
28 3300005330 Ga0070690_100790774 Ga0070690_1007907742 95
29 3300005330 Ga0070690_101045586 Ga0070690_1010455862 95
30 3300005331 Ga0070670_101280382 Ga0070670_1012803821 95
31 3300005334 Ga0068869_100032062 Ga0068869_1000320626 95
32 3300005335 Ga0070666_10335211 Ga0070666_103352112 95
33 3300005335 Ga0070666_10611444 Ga0070666_106114441 95
34 3300005336 Ga0070680_100003385 Ga0070680_1000033855 95
35 3300005336 Ga0070680_101971883 Ga0070680_1019718831 95
36 3300005337 Ga0070682_100229280 Ga0070682_1002292802 95
37 3300005337 Ga0070682_101890528 Ga0070682_1018905281 95
38 3300005338 Ga0068868_100732432 Ga0068868_1007324322 95
39 3300005338 Ga0068868_100740222 Ga0068868_1007402222 95
40 3300005339 Ga0070660_100603597 Ga0070660_1006035972 95
41 3300005339 Ga0070660_100828818 Ga0070660_1008288181 95
42 3300005340 Ga0070689_100145757 Ga0070689_1001457574 95
43 3300005340 Ga0070689_101993010 Ga0070689_1019930102 95
44 3300005344 Ga0070661_100095351 Ga0070661_1000953513 95
45 3300005344 Ga0070661_100171910 Ga0070661_1001719102 95
46 3300005345 Ga0070692_10429462 Ga0070692_104294622 95
47 3300005364 Ga0070673_100224680 Ga0070673_1002246803 95
48 3300005366 Ga0070659_100040328 Ga0070659_1000403283 95
49 3300005366 Ga0070659_100461056 Ga0070659_1004610562 95
50 3300005367 Ga0070667_100112886 Ga0070667_1001128865 95
51 3300005367 Ga0070667_101990900 Ga0070667_1019909001 95
52 3300005434 Ga0070709_10601432 Ga0070709_106014322 95
53 3300005434 Ga0070709_11420961 Ga0070709_114209611 95
54 3300005435 Ga0070714_100226935 Ga0070714_1002269353 95
55 3300005435 Ga0070714_100242744 Ga0070714_1002427442 95
56 3300005436 Ga0070713_100319766 Ga0070713_1003197662 95
57 3300005436 Ga0070713_101714319 Ga0070713_1017143191 95
58 3300005439 Ga0070711_100248899 Ga0070711_1002488992 95
59 3300005439 Ga0070711_100467606 Ga0070711_1004676062 95
60 3300005439 Ga0070711_101282670 Ga0070711_1012826702 95
61 3300005455 Ga0070663_101937936 Ga0070663_1019379361 95
62 3300005456 Ga0070678_100909430 Ga0070678_1009094302 95
63 3300005456 Ga0070678_101130244 Ga0070678_1011302442 95
64 3300005457 Ga0070662_100110487 Ga0070662_1001104874 95
65 3300005458 Ga0070681_10279937 Ga0070681_102799372 95
66 3300005458 Ga0070681_11312271 Ga0070681_113122711 95
67 3300005459 Ga0068867_100164843 Ga0068867_1001648431 95
68 3300005459 Ga0068867_100511163 Ga0068867_1005111632 95
69 3300005459 Ga0068867_100798068 Ga0068867_1007980682 95
70 3300005466 Ga0070685_11487597 Ga0070685_114875971 95
71 3300005530 Ga0070679_100306968 Ga0070679_1003069683 95
72 3300005530 Ga0070679_100796808 Ga0070679_1007968082 95
73 3300005535 Ga0070684_100043376 Ga0070684_1000433763 95
74 3300005535 Ga0070684_100084550 Ga0070684_1000845504 95
75 3300005535 Ga0070684_100382373 Ga0070684_1003823733 95
76 3300005535 Ga0070684_100910473 Ga0070684_1009104732 95
77 3300005535 Ga0070684_101296137 Ga0070684_1012961372 95
78 3300005539 Ga0068853_100133809 Ga0068853_1001338092 95
79 3300005539 Ga0068853_100849546 Ga0068853_1008495462 95
80 3300005539 Ga0068853_101023187 Ga0068853_1010231872 95
81 3300005543 Ga0070672_100454817 Ga0070672_1004548172 95
82 3300005543 Ga0070672_100603484 Ga0070672_1006034842 95
83 3300005544 Ga0070686_100378425 Ga0070686_1003784252 95
84 3300005546 Ga0070696_100637017 Ga0070696_1006370172 95
85 3300005546 Ga0070696_101785997 Ga0070696_1017859972 95
86 3300005548 Ga0070665_100019426 Ga0070665_10001942614 95
87 3300005548 Ga0070665_100193238 Ga0070665_1001932384 95
88 3300005548 Ga0070665_100489396 Ga0070665_1004893962 95
89 3300005563 Ga0068855_100019267 Ga0068855_1000192675 95
90 3300005563 Ga0068855_100067695 Ga0068855_1000676956 95
91 3300005563 Ga0068855_100099913 Ga0068855_1000999135 95
92 3300005563 Ga0068855_100135549 Ga0068855_1001355495 95
93 3300005563 Ga0068855_100274061 Ga0068855_1002740613 95
94 3300005563 Ga0068855_100336135 Ga0068855_1003361353 95
95 3300005563 Ga0068855_101494025 Ga0068855_1014940252 95
96 3300005564 Ga0070664_100221341 Ga0070664_1002213412 95
97 3300005564 Ga0070664_100408912 Ga0070664_1004089122 95
98 3300005564 Ga0070664_101985845 Ga0070664_1019858451 95
99 3300005564 Ga0070664_102370850 Ga0070664_1023708502 95
100 3300005577 Ga0068857_100373758 Ga0068857_1003737582 95
101 3300005577 Ga0068857_102349277 Ga0068857_1023492771 95
102 3300005578 Ga0068854_100081038 Ga0068854_1000810382 95
103 3300005578 Ga0068854_100448867 Ga0068854_1004488672 95
104 3300005578 Ga0068854_101230312 Ga0068854_1012303122 95
105 3300005614 Ga0068856_100018870 Ga0068856_1000188702 95
106 3300005614 Ga0068856_100074498 Ga0068856_1000744985 95
107 3300005614 Ga0068856_100173262 Ga0068856_1001732625 95
108 3300005614 Ga0068856_100583850 Ga0068856_1005838502 95
109 3300005614 Ga0068856_102005051 Ga0068856_1020050512 95
110 3300005616 Ga0068852_100024674 Ga0068852_1000246745 95
111 3300005616 Ga0068852_100054705 Ga0068852_1000547052 95
112 3300005616 Ga0068852_100520927 Ga0068852_1005209271 95
113 3300005616 Ga0068852_100559762 Ga0068852_1005597622 95
114 3300005616 Ga0068852_101066371 Ga0068852_1010663712 95
115 3300005616 Ga0068852_101595218 Ga0068852_1015952182 95
116 3300005616 Ga0068852_102197503 Ga0068852_1021975032 95
117 3300005617 Ga0068859_100528142 Ga0068859_1005281422 95
118 3300005618 Ga0068864_101664988 Ga0068864_1016649882 95
119 3300005718 Ga0068866_10105529 Ga0068866_101055292 95
120 3300005718 Ga0068866_11119813 Ga0068866_111198131 95
121 3300005718 Ga0068866_11326093 Ga0068866_113260931 95
122 3300005719 Ga0068861_101882474 Ga0068861_1018824742 95
123 3300005834 Ga0068851_10018984 Ga0068851_100189843 95
124 3300005834 Ga0068851_10197446 Ga0068851_101974462 95
125 3300005841 Ga0068863_100294776 Ga0068863_1002947761 95
126 3300005841 Ga0068863_100752387 Ga0068863_1007523872 95
127 3300005841 Ga0068863_101103759 Ga0068863_1011037592 95
128 3300005842 Ga0068858_100065255 Ga0068858_1000652552 95
129 3300005842 Ga0068858_100518938 Ga0068858_1005189382 95
130 3300005843 Ga0068860_100377752 Ga0068860_1003777522 95
131 3300005843 Ga0068860_100615283 Ga0068860_1006152831 95
132 3300006028 Ga0070717_10008895 Ga0070717_100088958 95
133 3300006028 Ga0070717_10415563 Ga0070717_104155632 95
134 3300006163 Ga0070715_11004026 Ga0070715_110040262 95
135 3300006237 Ga0097621_100084015 Ga0097621_1000840155 95
136 3300006237 Ga0097621_100400621 Ga0097621_1004006213 95
137 3300006237 Ga0097621_101347968 Ga0097621_1013479682 95
138 3300006358 Ga0068871_100321617 Ga0068871_1003216173 95
139 3300006358 Ga0068871_100443827 Ga0068871_1004438272 95
140 3300006358 Ga0068871_100587733 Ga0068871_1005877332 95
141 3300006846 Ga0075430_100062426 Ga0075430_1000624263 95
142 3300006846 Ga0075430_101565249 Ga0075430_1015652492 95
143 3300006847 Ga0075431_100269551 Ga0075431_1002695512 95
144 3300006880 Ga0075429_100843529 Ga0075429_1008435292 95
145 3300006880 Ga0075429_101284120 Ga0075429_1012841202 95
146 3300006881 Ga0068865_100083824 Ga0068865_1000838245 95
147 3300006881 Ga0068865_100444614 Ga0068865_1004446142 95
148 3300006881 Ga0068865_101229805 Ga0068865_1012298051 95
149 3300006931 Ga0097620_100528128 Ga0097620_1005281282 95
150 3300009036 Ga0105244_10158474 Ga0105244_101584742 95
151 3300009093 Ga0105240_10032555 Ga0105240_1003255513 95
152 3300009093 Ga0105240_10050651 Ga0105240_100506516 95
153 3300009093 Ga0105240_10146366 Ga0105240_101463665 95
154 3300009093 Ga0105240_10158948 Ga0105240_101589482 95
155 3300009093 Ga0105240_10356892 Ga0105240_103568922 95
156 3300009094 Ga0111539_10435561 Ga0111539_104355612 95
157 3300009094 Ga0111539_10953621 Ga0111539_109536212 95
158 3300009094 Ga0111539_12245224 Ga0111539_122452242 95
159 3300009098 Ga0105245_10035188 Ga0105245_100351882 95
160 3300009101 Ga0105247_10766052 Ga0105247_107660522 95
161 3300009147 Ga0114129_10281931 Ga0114129_102819312 95
162 3300009148 Ga0105243_10340774 Ga0105243_103407742 95
163 3300009174 Ga0105241_10019071 Ga0105241_100190715 95
164 3300009174 Ga0105241_10033499 Ga0105241_100334995 95
165 3300009174 Ga0105241_10269414 Ga0105241_102694143 95
166 3300009174 Ga0105241_10455233 Ga0105241_104552331 95
167 3300009174 Ga0105241_10680473 Ga0105241_106804732 95
168 3300009174 Ga0105241_11114745 Ga0105241_111147452 95
169 3300009176 Ga0105242_10828011 Ga0105242_108280112 95
170 3300009176 Ga0105242_10878270 Ga0105242_108782702 95
171 3300009177 Ga0105248_10140985 Ga0105248_101409855 95
172 3300009177 Ga0105248_10145379 Ga0105248_101453792 95
173 3300009177 Ga0105248_10245059 Ga0105248_102450592 95
174 3300009177 Ga0105248_10395810 Ga0105248_103958103 95
175 3300009177 Ga0105248_11049092 Ga0105248_110490922 95
176 3300009177 Ga0105248_11770371 Ga0105248_117703712 95
177 3300009545 Ga0105237_10120724 Ga0105237_101207242 95
178 3300009545 Ga0105237_10322306 Ga0105237_103223062 95
179 3300009545 Ga0105237_10950360 Ga0105237_109503601 95
180 3300009545 Ga0105237_11426848 Ga0105237_114268482 95
181 3300009545 Ga0105237_11478090 Ga0105237_114780902 95
182 3300009545 Ga0105237_12740522 Ga0105237_127405221 95
183 3300009551 Ga0105238_10010551 Ga0105238_1001055113 95
184 3300009551 Ga0105238_10182410 Ga0105238_101824104 95
185 3300009551 Ga0105238_10246915 Ga0105238_102469153 95
186 3300009551 Ga0105238_10553536 Ga0105238_105535362 95
187 3300009551 Ga0105238_11411165 Ga0105238_114111652 95
188 3300009551 Ga0105238_12859825 Ga0105238_128598252 95
189 3300009553 Ga0105249_10127289 Ga0105249_101272894 95
190 3300009553 Ga0105249_10898846 Ga0105249_108988462 95
191 3300010375 Ga0105239_10018959 Ga0105239_1001895913 95
192 3300010375 Ga0105239_10353252 Ga0105239_103532522 95
193 3300010375 Ga0105239_12116984 Ga0105239_121169842 95
194 3300010375 Ga0105239_12424120 Ga0105239_124241202 95
195 3300010375 Ga0105239_13625040 Ga0105239_136250401 95
196 3300011119 Ga0105246_10059101 Ga0105246_100591013 95
197 3300011119 Ga0105246_10179461 Ga0105246_101794613 95
198 3300011119 Ga0105246_12099341 Ga0105246_120993412 95
199 3300013100 Ga0157373_10151724 Ga0157373_101517242 95
200 3300013100 Ga0157373_10318742 Ga0157373_103187422 95
201 3300013100 Ga0157373_10444366 Ga0157373_104443661 95
202 3300013100 Ga0157373_10539172 Ga0157373_105391721 95
203 3300013100 Ga0157373_10581839 Ga0157373_105818392 95
204 3300013102 Ga0157371_11641652 Ga0157371_116416521 95
205 3300013104 Ga0157370_10006622 Ga0157370_1000662219 95
206 3300013104 Ga0157370_10008076 Ga0157370_1000807619 95
207 3300013104 Ga0157370_10192208 Ga0157370_101922082 95
208 3300013105 Ga0157369_10004351 Ga0157369_1000435126 95
209 3300013105 Ga0157369_10008438 Ga0157369_1000843820 95
210 3300013105 Ga0157369_10069033 Ga0157369_100690335 95
211 3300013105 Ga0157369_10073830 Ga0157369_100738305 95
212 3300013105 Ga0157369_10099938 Ga0157369_100999385 95
213 3300013105 Ga0157369_10512462 Ga0157369_105124622 95
214 3300013105 Ga0157369_10934338 Ga0157369_109343382 95
215 3300013296 Ga0157374_10285686 Ga0157374_102856862 95
216 3300013296 Ga0157374_11234446 Ga0157374_112344462 95
217 3300013296 Ga0157374_12227279 Ga0157374_122272792 95
218 3300013296 Ga0157374_12722134 Ga0157374_127221341 95
219 3300013297 Ga0157378_10162304 Ga0157378_101623041 95
220 3300013297 Ga0157378_10511865 Ga0157378_105118652 95
221 3300013306 Ga0163162_11160875 Ga0163162_111608752 95
222 3300013306 Ga0163162_12271444 Ga0163162_122714443 95
223 3300013307 Ga0157372_10000424 Ga0157372_1000042453 95
224 3300013307 Ga0157372_10092295 Ga0157372_100922952 95
225 3300013307 Ga0157372_10124099 Ga0157372_101240993 95
226 3300013307 Ga0157372_10136299 Ga0157372_101362994 95
227 3300013307 Ga0157372_10492494 Ga0157372_104924942 95
228 3300013307 Ga0157372_10552252 Ga0157372_105522521 95
229 3300013307 Ga0157372_10848801 Ga0157372_108488012 95
230 3300013308 Ga0157375_10165732 Ga0157375_101657322 95
231 3300013308 Ga0157375_11245580 Ga0157375_112455802 95
232 3300013308 Ga0157375_11551984 Ga0157375_115519842 95
233 3300014325 Ga0163163_10093659 Ga0163163_100936593 95
234 3300014325 Ga0163163_10142252 Ga0163163_101422525 95
235 3300014325 Ga0163163_11321162 Ga0163163_113211622 95
236 3300014325 Ga0163163_11729153 Ga0163163_117291532 95
237 3300014497 Ga0182008_10061089 Ga0182008_100610891 95
238 3300014969 Ga0157376_10913440 Ga0157376_109134402 95
239 3300017792 Ga0163161_10407674 Ga0163161_104076742 95
240 3300020069 Ga0197907_10629253 Ga0197907_106292531 95
241 3300020069 Ga0197907_11426004 Ga0197907_114260041 95
242 3300020069 Ga0197907_11511092 Ga0197907_115110922 95
243 3300020078 Ga0206352_10081231 Ga0206352_100812312 95
244 3300020078 Ga0206352_10629975 Ga0206352_106299752 95
245 3300020080 Ga0206350_10722182 Ga0206350_107221822 95
246 3300020081 Ga0206354_10031333 Ga0206354_100313332 95
247 3300021358 Ga0213873_10148009 Ga0213873_101480092 95
248 3300021384 Ga0213876_10445947 Ga0213876_104459472 95
249 3300022467 Ga0224712_10203988 Ga0224712_102039882 95
250 3300025321 Ga0207656_10021069 Ga0207656_100210692 95
251 3300025321 Ga0207656_10136248 Ga0207656_101362482 95
252 3300025899 Ga0207642_10077223 Ga0207642_100772233 95
253 3300025900 Ga0207710_10154007 Ga0207710_101540072 95
254 3300025903 Ga0207680_11265087 Ga0207680_112650872 95
255 3300025904 Ga0207647_10510618 Ga0207647_105106182 95
256 3300025905 Ga0207685_10592033 Ga0207685_105920332 95
257 3300025906 Ga0207699_10115363 Ga0207699_101153632 95
258 3300025906 Ga0207699_10701868 Ga0207699_107018682 95
259 3300025907 Ga0207645_10500873 Ga0207645_105008732 95
260 3300025907 Ga0207645_10735376 Ga0207645_107353762 95
261 3300025909 Ga0207705_10110797 Ga0207705_101107972 95
262 3300025909 Ga0207705_10247022 Ga0207705_102470223 95
263 3300025909 Ga0207705_10532240 Ga0207705_105322402 95
264 3300025911 Ga0207654_10001818 Ga0207654_100018185 95
265 3300025911 Ga0207654_10016146 Ga0207654_100161465 95
266 3300025911 Ga0207654_10023979 Ga0207654_100239792 95
267 3300025911 Ga0207654_10314553 Ga0207654_103145532 95
268 3300025911 Ga0207654_10989430 Ga0207654_109894302 95
269 3300025912 Ga0207707_10560064 Ga0207707_105600642 95
270 3300025913 Ga0207695_10000379 Ga0207695_1000037995 95
271 3300025913 Ga0207695_10003215 Ga0207695_100032155 95
272 3300025913 Ga0207695_10113892 Ga0207695_101138925 95
273 3300025913 Ga0207695_10274140 Ga0207695_102741403 95
274 3300025914 Ga0207671_10000503 Ga0207671_1000050329 95
275 3300025914 Ga0207671_10186363 Ga0207671_101863632 95
276 3300025914 Ga0207671_10633766 Ga0207671_106337661 95
277 3300025914 Ga0207671_10776696 Ga0207671_107766962 95
278 3300025914 Ga0207671_11338872 Ga0207671_113388722 95
279 3300025916 Ga0207663_10042911 Ga0207663_100429115 95
280 3300025916 Ga0207663_10389117 Ga0207663_103891172 95
281 3300025916 Ga0207663_11166765 Ga0207663_111667652 95
282 3300025917 Ga0207660_10009654 Ga0207660_100096545 95
283 3300025918 Ga0207662_10949465 Ga0207662_109494652 95
284 3300025919 Ga0207657_10171546 Ga0207657_101715462 95
285 3300025919 Ga0207657_10494097 Ga0207657_104940971 95
286 3300025919 Ga0207657_10641450 Ga0207657_106414502 95
287 3300025920 Ga0207649_10007836 Ga0207649_100078365 95
288 3300025920 Ga0207649_10168565 Ga0207649_101685652 95
289 3300025921 Ga0207652_10176277 Ga0207652_101762774 95
290 3300025921 Ga0207652_11308553 Ga0207652_113085532 95
291 3300025924 Ga0207694_10001290 Ga0207694_100012905 95
292 3300025924 Ga0207694_10126612 Ga0207694_101266123 95
293 3300025924 Ga0207694_10205170 Ga0207694_102051702 95
294 3300025927 Ga0207687_10005635 Ga0207687_100056353 95
295 3300025928 Ga0207700_10163874 Ga0207700_101638744 95
296 3300025928 Ga0207700_11637077 Ga0207700_116370772 95
297 3300025928 Ga0207700_11637542 Ga0207700_116375422 95
298 3300025929 Ga0207664_10132452 Ga0207664_101324523 95
299 3300025929 Ga0207664_10132724 Ga0207664_101327242 95
300 3300025931 Ga0207644_10159342 Ga0207644_101593424 95
301 3300025932 Ga0207690_10128235 Ga0207690_101282352 95
302 3300025932 Ga0207690_10539238 Ga0207690_105392382 95
303 3300025934 Ga0207686_10514957 Ga0207686_105149572 95
304 3300025934 Ga0207686_10942265 Ga0207686_109422652 95
305 3300025935 Ga0207709_10350679 Ga0207709_103506792 95
306 3300025936 Ga0207670_10189237 Ga0207670_101892372 95
307 3300025936 Ga0207670_11308966 Ga0207670_113089662 95
308 3300025936 Ga0207670_11443091 Ga0207670_114430911 95
309 3300025937 Ga0207669_10439020 Ga0207669_104390202 95
310 3300025938 Ga0207704_10063299 Ga0207704_100632993 95
311 3300025938 Ga0207704_10446793 Ga0207704_104467932 95
312 3300025938 Ga0207704_11369377 Ga0207704_113693772 95
313 3300025940 Ga0207691_11502131 Ga0207691_115021312 95
314 3300025941 Ga0207711_10049984 Ga0207711_100499845 95
315 3300025941 Ga0207711_10100024 Ga0207711_101000242 95
316 3300025941 Ga0207711_10341013 Ga0207711_103410133 95
317 3300025941 Ga0207711_10432313 Ga0207711_104323132 95
318 3300025941 Ga0207711_11283789 Ga0207711_112837892 95
319 3300025944 Ga0207661_10204260 Ga0207661_102042602 95
320 3300025944 Ga0207661_10342388 Ga0207661_103423883 95
321 3300025945 Ga0207679_10131379 Ga0207679_101313792 95
322 3300025945 Ga0207679_10183582 Ga0207679_101835823 95
323 3300025945 Ga0207679_11081303 Ga0207679_110813032 95
324 3300025945 Ga0207679_11640738 Ga0207679_116407382 95
325 3300025949 Ga0207667_10006951 Ga0207667_100069514 95
326 3300025949 Ga0207667_10008805 Ga0207667_1000880519 95
327 3300025949 Ga0207667_10044956 Ga0207667_100449567 95
328 3300025949 Ga0207667_10075240 Ga0207667_100752405 95
329 3300025949 Ga0207667_10158603 Ga0207667_101586031 95
330 3300025949 Ga0207667_10258025 Ga0207667_102580253 95
331 3300025949 Ga0207667_10516793 Ga0207667_105167932 95
332 3300025949 Ga0207667_11855631 Ga0207667_118556312 95
333 3300025960 Ga0207651_10072464 Ga0207651_100724645 95
334 3300025960 Ga0207651_10438639 Ga0207651_104386392 95
335 3300025981 Ga0207640_10592570 Ga0207640_105925702 95
336 3300025981 Ga0207640_10759592 Ga0207640_107595922 95
337 3300025981 Ga0207640_11240273 Ga0207640_112402732 95
338 3300025986 Ga0207658_11900063 Ga0207658_119000631 95
339 3300026023 Ga0207677_10522312 Ga0207677_105223122 95
340 3300026035 Ga0207703_10293427 Ga0207703_102934272 95
341 3300026035 Ga0207703_10344238 Ga0207703_103442382 95
342 3300026041 Ga0207639_10000868 Ga0207639_1000086831 95
343 3300026041 Ga0207639_10241593 Ga0207639_102415932 95
344 3300026041 Ga0207639_10528640 Ga0207639_105286402 95
345 3300026075 Ga0207708_11809269 Ga0207708_118092691 95
346 3300026078 Ga0207702_10001589 Ga0207702_1000158932 95
347 3300026078 Ga0207702_10073915 Ga0207702_100739153 95
348 3300026078 Ga0207702_10244880 Ga0207702_102448802 95
349 3300026078 Ga0207702_12041154 Ga0207702_120411542 95
350 3300026088 Ga0207641_10912562 Ga0207641_109125621 95
351 3300026089 Ga0207648_10111966 Ga0207648_101119665 95
352 3300026089 Ga0207648_10165067 Ga0207648_101650675 95
353 3300026095 Ga0207676_10162211 Ga0207676_101622112 95
354 3300026095 Ga0207676_10710020 Ga0207676_107100202 95
355 3300026095 Ga0207676_12352181 Ga0207676_123521812 95
356 3300026116 Ga0207674_10097677 Ga0207674_100976772 95
357 3300026116 Ga0207674_10125804 Ga0207674_101258045 95
358 3300026118 Ga0207675_100467402 Ga0207675_1004674021 95
359 3300026121 Ga0207683_10438507 Ga0207683_104385072 95
360 3300026142 Ga0207698_10000039 Ga0207698_100000395 95
361 3300026142 Ga0207698_10000059 Ga0207698_1000005962 95
362 3300026142 Ga0207698_10069757 Ga0207698_100697575 95
363 3300026142 Ga0207698_10085167 Ga0207698_100851672 95
364 3300026142 Ga0207698_11854078 Ga0207698_118540782 95
365 3300028379 Ga0268266_11265523 Ga0268266_112655232 95
366 3300028381 Ga0268264_10567935 Ga0268264_105679352 95
367 3300028381 Ga0268264_10943841 Ga0268264_109438412 95
368 3300028666 Ga0265336_10066187 Ga0265336_100661872 95
369 3300028800 Ga0265338_10026446 Ga0265338_100264465 95
370 3300029957 Ga0265324_10005069 Ga0265324_100050697 95
371 3300030878 Ga0265770_1067326 Ga0265770_10673262 95
372 3300031090 Ga0265760_10165140 Ga0265760_101651402 95
373 3300031238 Ga0265332_10024511 Ga0265332_100245112 95
374 3300031239 Ga0265328_10127802 Ga0265328_101278022 95
375 3300031240 Ga0265320_10009193 Ga0265320_100091939 95
376 3300031241 Ga0265325_10023327 Ga0265325_100233272 95
377 3300031241 Ga0265325_10217872 Ga0265325_102178722 95
378 3300031242 Ga0265329_10025218 Ga0265329_100252182 95
379 3300031247 Ga0265340_10019656 Ga0265340_100196565 95
380 3300031249 Ga0265339_10024306 Ga0265339_100243065 95
381 3300031250 Ga0265331_10001121 Ga0265331_100011219 95
382 3300031250 Ga0265331_10059193 Ga0265331_100591933 95
383 3300031250 Ga0265331_10323112 Ga0265331_103231122 95
384 3300031344 Ga0265316_10045658 Ga0265316_100456585 95
385 3300031344 Ga0265316_10088121 Ga0265316_100881213 95
386 3300031344 Ga0265316_10264301 Ga0265316_102643012 95
387 3300031344 Ga0265316_10327281 Ga0265316_103272812 95
388 3300031344 Ga0265316_10348099 Ga0265316_103480993 95
389 3300031344 Ga0265316_10393610 Ga0265316_103936102 95
390 3300031344 Ga0265316_10949812 Ga0265316_109498122 95
391 3300031711 Ga0265314_10037033 Ga0265314_100370332 95
392 3300031711 Ga0265314_10183632 Ga0265314_101836322 95
393 3300031712 Ga0265342_10193629 Ga0265342_101936292 95
394 3300031712 Ga0265342_10336475 Ga0265342_103364751 95
395 3300031911 Ga0307412_11766458 Ga0307412_117664582 95
396 3300032002 Ga0307416_102604910 Ga0307416_1026049102 95
397 3300032120 Ga0316053_107793 Ga0316053_1077932 95
398 3300032133 Ga0316583_10238438 Ga0316583_102384382 95
399 3300035117 Ga0373953_0039547 Ga0373953_0039547_342_632 95
400 3300035118 Ga0373954_0004404 Ga0373954_0004404_4906_5196 95
401 3300035118 Ga0373954_0032814 Ga0373954_0032814_860_1150 95
402 3300035120 Ga0373957_0348173 Ga0373957_0348173_10_300 95
403 3300035172 Ga0373955_0034008 Ga0373955_0034008_1478_1768 95
404 3300035172 Ga0373955_0102378 Ga0373955_0102378_964_1254 95
405 3300035695 Ga0373927_0063287 Ga0373927_0063287_1572_1859 95
406 3300035724 Ga0373933_0107041 Ga0373933_0107041_766_1056 95
407 3300035724 Ga0373933_0323120 Ga0373933_0323120_683_973 95
408 3300035725 Ga0373947_0681495 Ga0373947_0681495_395_682 95
409 3300036401 Ga0373937_0018076 Ga0373937_0018076_4986_5276 95
410 3300036401 Ga0373937_0390865 Ga0373937_0390865_819_1109 95
411 3300036401 Ga0373937_0868369 Ga0373937_0868369_180_470 95
412 3300036457 Ga0265778_002900 Ga0265778_002900_1196_1483 95
413 3300036457 Ga0265778_011645 Ga0265778_011645_222_512 95
414 3300037068 Ga0373925_0100983 Ga0373925_0100983_262_552 95
415 3300037068 Ga0373925_0795072 Ga0373925_0795072_175_462 95
416 3300037068 Ga0373925_1042202 Ga0373925_1042202_54_347 95
417 3300037418 Ga0395900_0566214 Ga0395900_0566214_714_1004 95
418 3300037466 Ga0395898_0117406 Ga0395898_0117406_1892_2182 95
419 3300037853 Ga0436364_1078028 Ga0436364_1078028_214_504 95
420 3300039437 Ga0436365_0408821 Ga0436365_0408821_914_1201 95
421 3300039437 Ga0436365_1191518 Ga0436365_1191518_1849_2136 95
422 3300039438 Ga0436360_0261959 Ga0436360_0261959_510_800 95
423 3300039450 Ga0436363_0439753 Ga0436363_0439753_511_801 95
424 3300039450 Ga0436363_1703451 Ga0436363_1703451_39_326 95
425 3300039453 Ga0436362_0001488 Ga0436362_0001488_285_572 95
426 3300042876 Ga0451577_0173522 Ga0451577_0173522_442_735 95
427 3300042876 Ga0451577_1684531 Ga0451577_1684531_255_542 95
428 3300044673 Ga0453683_1042374 Ga0453683_1042374_153_443 95
429 3300044673 Ga0453683_1223051 Ga0453683_1223051_195_482 95
430 3300044684 Ga0466966_0565567 Ga0466966_0565567_243_533 95
431 3300044694 Ga0466963_0003181 Ga0466963_0003181_2898_3191 95
432 3300044712 Ga0453684_0195532 Ga0453684_0195532_718_1005 95
433 3300044712 Ga0453684_1049584 Ga0453684_1049584_442_735 95
434 3300044719 Ga0466971_0174310 Ga0466971_0174310_293_583 95
435 3300044719 Ga0466971_0203686 Ga0466971_0203686_387_677 95
436 3300044842 Ga0466957_0476619 Ga0466957_0476619_269_559 95
437 3300045836 Ga0466958_0456218 Ga0466958_0456218_510_800 95
438 3300045976 Ga0466967_0048703 Ga0466967_0048703_1224_1517 95
439 3300045976 Ga0466967_0220020 Ga0466967_0220020_210_500 95
440 3300045976 Ga0466967_0652124 Ga0466967_0652124_738_1031 95
441 3300045976 Ga0466967_1113497 Ga0466967_1113497_325_618 95
442 3300046463 Ga0495653_0843228 Ga0495653_0843228_38_325 95
443 3300046472 Ga0495580_0069834 Ga0495580_0069834_2128_2415 95
444 3300046472 Ga0495580_0552097 Ga0495580_0552097_209_499 95
445 3300046472 Ga0495580_0562032 Ga0495580_0562032_316_606 95
446 3300046477 Ga0495664_0577150 Ga0495664_0577150_231_521 95
447 3300046511 Ga0495608_0352040 Ga0495608_0352040_20_310 95
448 3300046516 Ga0495628_0489551 Ga0495628_0489551_15_305 95
449 3300046529 Ga0495652_0147554 Ga0495652_0147554_694_984 95
450 3300046533 Ga0495640_0846172 Ga0495640_0846172_79_366 95
451 3300046559 Ga0495667_0560841 Ga0495667_0560841_414_701 95
452 3300046679 Ga0495623_0229833 Ga0495623_0229833_267_557 95
453 3300046684 Ga0495669_0416619 Ga0495669_0416619_338_628 95
454 3300046809 Ga0495600_0404426 Ga0495600_0404426_446_736 95
455 3300047317 Ga0495604_0302389 Ga0495604_0302389_415_705 95
456 3300047319 Ga0495674_0147668 Ga0495674_0147668_184_474 95
457 3300047319 Ga0495674_1223168 Ga0495674_1223168_76_366 95
458 3300047322 Ga0495680_0871283 Ga0495680_0871283_199_489 95
459 3300047444 Ga0495675_0039213 Ga0495675_0039213_267_554 95
460 3300047471 Ga0495684_0089557 Ga0495684_0089557_475_765 95
461 3300047471 Ga0495684_0152542 Ga0495684_0152542_1160_1450 95
462 3300047471 Ga0495684_0969131 Ga0495684_0969131_68_355 95
463 3300048088 Ga0495602_0307814 Ga0495602_0307814_76_363 95
464 3300048905 Ga0496102_0341167 Ga0496102_0341167_1028_1318 95
465 3300048907 Ga0496104_1484708 Ga0496104_1484708_202_492 95
466 3300048909 Ga0496106_0942327 Ga0496106_0942327_314_604 95
467 3300049586 Ga0501070_0020844 Ga0501070_0020844_607_900 95
468 3300049588 Ga0501072_0941625 Ga0501072_0941625_350_640 95
469 3300050507 nmdc:mga05p37_1553080_c1 nmdc:mga05p37_1553080_c1_265_552 95
470 3300050508 nmdc:mga09592_1166991_c1 nmdc:mga09592_1166991_c1_106_393 95
471 3300050509 nmdc:mga0qj67_1304805_c1 nmdc:mga0qj67_1304805_c1_154_441 95
472 3300050509 nmdc:mga0qj67_132733_c1 nmdc:mga0qj67_132733_c1_1071_1361 95
473 3300050510 nmdc:mga06r32_10773_c1 nmdc:mga06r32_10773_c1_1834_2121 95
474 3300050511 nmdc:mga08y16_1620439_c1 nmdc:mga08y16_1620439_c1_244_531 95
475 3300050511 nmdc:mga08y16_571405_c1 nmdc:mga08y16_571405_c1_159_446 95
476 3300053084 Ga0495595_0118603 Ga0495595_0118603_760_1050 95
477 3300053085 Ga0495619_0318175 Ga0495619_0318175_589_879 95
478 3300053085 Ga0495619_0960435 Ga0495619_0960435_34_324 95
479 3300059507 Ga0587086_020241 Ga0587086_020241_13_306 95
480 3300059644 Ga0587075_012377 Ga0587075_012377_470_763 95
481 3300059655 Ga0587114_122396 Ga0587114_122396_67_360 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

9

95

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v8p-assembly4.cif.gz_GR t.thermophila 60s ribosomal subunit in complex with initiation factor 6. 0.9138 1 89
6zu5-assembly1.cif.gz_LX0 structure of the paranosema locustae ribosome in complex with lso2 0.9131 3 86
6fu8-assembly1.cif.gz_C ul23 beta hairpin loop deletion of e.coli ribosome 0.9072 3 88
7r72-assembly1.cif.gz_X state e1 nucleolar 60s ribosome biogenesis intermediate - spb4 local model 0.9063 3 87
8b2l-assembly1.cif.gz_k3 cryo-em structure of the plant 80s ribosome 0.906 1 87
ID Description Score Start End Superfamily
af_D3ZFK7_36_158_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9343 1 87 3.30.70.330
4a1aR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9141 1 89 3.30.70.330
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9072 3 88 3.30.70.330
1w2bR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.903 5 89 3.30.70.330
af_E9AG68_26_145_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.902 3 87 3.30.70.330
ID Description Score Start End GO Terms
AF-L2GX17-F1-model_v4 50S ribosomal protein L23 0.9222 3 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A497EJ14-F1-model_v4 Large ribosomal subunit protein uL23 0.9131 1 87 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A4W2IFM3-F1-model_v4 Large ribosomal subunit protein uL23 N-terminal domain-containing protein 0.9122 1 84 GO:0003735
GO:0006412
GO:0019843
GO:0044391
AF-A0A667HP71-F1-model_v4 Ribosomal protein L23/L25 N-terminal domain-containing protein 0.9118 1 84 GO:0003735
GO:0006412
GO:0044391
AF-A6R098-F1-model_v4 Ribosomal protein L23a 0.9104 1 88 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
85.84 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map