F452355
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 481 | 226 | 481 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_100790774|Ga0070690_1007907742 |
| Length | 99 |
| Sequence | MTSIDRLYRIAAAPLISEKGTDDSSSRNTYHFRVPLDANKVEIRQAVEKLFKVKVAEVRTMNLEGKLRRRGKFAGYRSDWKKAYVKLKPGQKSPEYADI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 155 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 166 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 172 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 182 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 183 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 184 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 185 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 189 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.47 |
| Metatranscriptomes | 3.53 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.62 |
| Rhizosphere | 98.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_11773782 | 3300004799 | Bacteria | 1461 |
| 2 | Ga0070658_10034348 | 3300005327 | Bacteria | 4080 |
| 3 | Ga0070658_10087950 | 3300005327 | Bacteria | 2558 |
| 4 | Ga0070683_100011876 | 3300005329 | Bacteria | 7549 |
| 5 | Ga0070683_100127827 | 3300005329 | Bacteria | 2403 |
| 6 | Ga0070683_100140694 | 3300005329 | Bacteria | 2286 |
| 7 | Ga0070690_100355530 | 3300005330 | Bacteria | 1064 |
| 8 | Ga0070690_100790774 | 3300005330 | Bacteria | 735 |
| 9 | Ga0070690_101045586 | 3300005330 | Unclassified | 645 |
| 10 | Ga0070670_101280382 | 3300005331 | Unclassified | 671 |
| 11 | Ga0068869_100032062 | 3300005334 | Bacteria | 3700 |
| 12 | Ga0070666_10335211 | 3300005335 | Bacteria | 1081 |
| 13 | Ga0070666_10611444 | 3300005335 | Bacteria | 796 |
| 14 | Ga0070680_100003385 | 3300005336 | Bacteria | 11897 |
| 15 | Ga0070680_101971883 | 3300005336 | Unclassified | 506 |
| 16 | Ga0070682_100229280 | 3300005337 | Bacteria | 1327 |
| 17 | Ga0070682_101890528 | 3300005337 | Bacteria | 523 |
| 18 | Ga0068868_100732432 | 3300005338 | Bacteria | 887 |
| 19 | Ga0068868_100740222 | 3300005338 | Bacteria | 882 |
| 20 | Ga0070660_100603597 | 3300005339 | Bacteria | 918 |
| 21 | Ga0070660_100828818 | 3300005339 | Bacteria | 779 |
| 22 | Ga0070689_100145757 | 3300005340 | Bacteria | 1907 |
| 23 | Ga0070689_101993010 | 3300005340 | Unclassified | 531 |
| 24 | Ga0070661_100095351 | 3300005344 | Bacteria | 2207 |
| 25 | Ga0070661_100171910 | 3300005344 | Bacteria | 1646 |
| 26 | Ga0070692_10429462 | 3300005345 | Unclassified | 841 |
| 27 | Ga0070673_100224680 | 3300005364 | Bacteria | 1627 |
| 28 | Ga0070659_100040328 | 3300005366 | Bacteria | 3647 |
| 29 | Ga0070659_100461056 | 3300005366 | Bacteria | 1079 |
| 30 | Ga0070667_100112886 | 3300005367 | Bacteria | 2358 |
| 31 | Ga0070667_101990900 | 3300005367 | Bacteria | 547 |
| 32 | Ga0070709_10601432 | 3300005434 | Bacteria | 847 |
| 33 | Ga0070709_11420961 | 3300005434 | Unclassified | 562 |
| 34 | Ga0070714_100226935 | 3300005435 | Bacteria | 1719 |
| 35 | Ga0070714_100242744 | 3300005435 | Bacteria | 1663 |
| 36 | Ga0070713_100319766 | 3300005436 | Bacteria | 1433 |
| 37 | Ga0070713_101714319 | 3300005436 | Bacteria | 610 |
| 38 | Ga0070711_100248899 | 3300005439 | Bacteria | 1393 |
| 39 | Ga0070711_100467606 | 3300005439 | Bacteria | 1035 |
| 40 | Ga0070711_101282670 | 3300005439 | Unclassified | 635 |
| 41 | Ga0070663_101937936 | 3300005455 | Bacteria | 530 |
| 42 | Ga0070678_100909430 | 3300005456 | Unclassified | 805 |
| 43 | Ga0070678_101130244 | 3300005456 | Bacteria | 724 |
| 44 | Ga0070662_100110487 | 3300005457 | Bacteria | 2094 |
| 45 | Ga0070681_10279937 | 3300005458 | Bacteria | 1579 |
| 46 | Ga0070681_11312271 | 3300005458 | Unclassified | 647 |
| 47 | Ga0068867_100164843 | 3300005459 | Bacteria | 1750 |
| 48 | Ga0068867_100511163 | 3300005459 | Bacteria | 1034 |
| 49 | Ga0068867_100798068 | 3300005459 | Unclassified | 842 |
| 50 | Ga0070685_11487597 | 3300005466 | Unclassified | 521 |
| 51 | Ga0070679_100306968 | 3300005530 | Unclassified | 1537 |
| 52 | Ga0070679_100796808 | 3300005530 | Bacteria | 888 |
| 53 | Ga0070684_100043376 | 3300005535 | Bacteria | 3883 |
| 54 | Ga0070684_100084550 | 3300005535 | Bacteria | 2813 |
| 55 | Ga0070684_100382373 | 3300005535 | Bacteria | 1297 |
| 56 | Ga0070684_100910473 | 3300005535 | Unclassified | 824 |
| 57 | Ga0070684_101296137 | 3300005535 | Bacteria | 686 |
| 58 | Ga0068853_100133809 | 3300005539 | Bacteria | 2221 |
| 59 | Ga0068853_100849546 | 3300005539 | Bacteria | 875 |
| 60 | Ga0068853_101023187 | 3300005539 | Bacteria | 796 |
| 61 | Ga0070672_100454817 | 3300005543 | Bacteria | 1103 |
| 62 | Ga0070672_100603484 | 3300005543 | Bacteria | 956 |
| 63 | Ga0070686_100378425 | 3300005544 | Bacteria | 1071 |
| 64 | Ga0070696_100637017 | 3300005546 | Bacteria | 863 |
| 65 | Ga0070696_101785997 | 3300005546 | Bacteria | 531 |
| 66 | Ga0070665_100019426 | 3300005548 | Bacteria | 6819 |
| 67 | Ga0070665_100193238 | 3300005548 | Bacteria | 2036 |
| 68 | Ga0070665_100489396 | 3300005548 | Bacteria | 1241 |
| 69 | Ga0068855_100019267 | 3300005563 | Bacteria | 8202 |
| 70 | Ga0068855_100067695 | 3300005563 | Bacteria | 4159 |
| 71 | Ga0068855_100099913 | 3300005563 | Bacteria | 3341 |
| 72 | Ga0068855_100135549 | 3300005563 | Bacteria | 2809 |
| 73 | Ga0068855_100274061 | 3300005563 | Bacteria | 1875 |
| 74 | Ga0068855_100336135 | 3300005563 | Bacteria | 1666 |
| 75 | Ga0068855_101494025 | 3300005563 | Bacteria | 694 |
| 76 | Ga0070664_100221341 | 3300005564 | Bacteria | 1693 |
| 77 | Ga0070664_100408912 | 3300005564 | Bacteria | 1242 |
| 78 | Ga0070664_101985845 | 3300005564 | Bacteria | 552 |
| 79 | Ga0070664_102370850 | 3300005564 | Unclassified | 503 |
| 80 | Ga0068857_100373758 | 3300005577 | Bacteria | 1322 |
| 81 | Ga0068857_102349277 | 3300005577 | Unclassified | 523 |
| 82 | Ga0068854_100081038 | 3300005578 | Bacteria | 2396 |
| 83 | Ga0068854_100448867 | 3300005578 | Bacteria | 1077 |
| 84 | Ga0068854_101230312 | 3300005578 | Unclassified | 672 |
| 85 | Ga0068856_100018870 | 3300005614 | Bacteria | 6688 |
| 86 | Ga0068856_100074498 | 3300005614 | Bacteria | 3361 |
| 87 | Ga0068856_100173262 | 3300005614 | Bacteria | 2170 |
| 88 | Ga0068856_100583850 | 3300005614 | Bacteria | 1139 |
| 89 | Ga0068856_102005051 | 3300005614 | Bacteria | 589 |
| 90 | Ga0070702_100140027 | 3300005615 | Bacteria | 1540 |
| 91 | Ga0068852_100024674 | 3300005616 | Bacteria | 4863 |
| 92 | Ga0068852_100054705 | 3300005616 | Bacteria | 3441 |
| 93 | Ga0068852_100520927 | 3300005616 | Unclassified | 1186 |
| 94 | Ga0068852_100559762 | 3300005616 | Bacteria | 1144 |
| 95 | Ga0068852_101066371 | 3300005616 | Bacteria | 828 |
| 96 | Ga0068852_101595218 | 3300005616 | Unclassified | 675 |
| 97 | Ga0068852_102197503 | 3300005616 | Unclassified | 573 |
| 98 | Ga0068859_100528142 | 3300005617 | Bacteria | 1275 |
| 99 | Ga0068864_101664988 | 3300005618 | Unclassified | 642 |
| 100 | Ga0068866_10105529 | 3300005718 | Unclassified | 1562 |
| 101 | Ga0068866_11119813 | 3300005718 | Bacteria | 565 |
| 102 | Ga0068866_11326093 | 3300005718 | Bacteria | 524 |
| 103 | Ga0068861_101882474 | 3300005719 | Unclassified | 595 |
| 104 | Ga0068851_10018984 | 3300005834 | Bacteria | 3320 |
| 105 | Ga0068851_10197446 | 3300005834 | Bacteria | 1121 |
| 106 | Ga0068863_100294776 | 3300005841 | Bacteria | 1572 |
| 107 | Ga0068863_100752387 | 3300005841 | Bacteria | 970 |
| 108 | Ga0068863_101103759 | 3300005841 | Bacteria | 798 |
| 109 | Ga0068858_100065255 | 3300005842 | Bacteria | 3368 |
| 110 | Ga0068858_100107555 | 3300005842 | Bacteria | 2603 |
| 111 | Ga0068858_100518938 | 3300005842 | Bacteria | 1152 |
| 112 | Ga0068860_100377752 | 3300005843 | Bacteria | 1398 |
| 113 | Ga0068860_100615283 | 3300005843 | Bacteria | 1092 |
| 114 | Ga0070717_10008895 | 3300006028 | Bacteria | 7523 |
| 115 | Ga0070717_10415563 | 3300006028 | Bacteria | 1210 |
| 116 | Ga0070715_11004026 | 3300006163 | Unclassified | 520 |
| 117 | Ga0097621_100084015 | 3300006237 | Bacteria | 2654 |
| 118 | Ga0097621_100400621 | 3300006237 | Bacteria | 1228 |
| 119 | Ga0097621_101347968 | 3300006237 | Bacteria | 675 |
| 120 | Ga0068871_100321617 | 3300006358 | Bacteria | 1362 |
| 121 | Ga0068871_100443827 | 3300006358 | Bacteria | 1162 |
| 122 | Ga0068871_100587733 | 3300006358 | Bacteria | 1012 |
| 123 | Ga0075430_100062426 | 3300006846 | Bacteria | 3130 |
| 124 | Ga0075430_101565249 | 3300006846 | Unclassified | 541 |
| 125 | Ga0075431_100269551 | 3300006847 | Bacteria | 1726 |
| 126 | Ga0075429_100843529 | 3300006880 | Bacteria | 802 |
| 127 | Ga0075429_101284120 | 3300006880 | Unclassified | 638 |
| 128 | Ga0068865_100083824 | 3300006881 | Bacteria | 2295 |
| 129 | Ga0068865_100444614 | 3300006881 | Bacteria | 1070 |
| 130 | Ga0068865_101229805 | 3300006881 | Bacteria | 664 |
| 131 | Ga0097620_100528128 | 3300006931 | Bacteria | 1275 |
| 132 | Ga0105244_10158474 | 3300009036 | Bacteria | 1082 |
| 133 | Ga0105240_10032555 | 3300009093 | Bacteria | 6750 |
| 134 | Ga0105240_10050651 | 3300009093 | Bacteria | 5233 |
| 135 | Ga0105240_10146366 | 3300009093 | Bacteria | 2818 |
| 136 | Ga0105240_10158948 | 3300009093 | Bacteria | 2686 |
| 137 | Ga0105240_10356892 | 3300009093 | Bacteria | 1657 |
| 138 | Ga0111539_10435561 | 3300009094 | Bacteria | 1527 |
| 139 | Ga0111539_10953621 | 3300009094 | Bacteria | 997 |
| 140 | Ga0111539_12245224 | 3300009094 | Unclassified | 633 |
| 141 | Ga0105245_10035188 | 3300009098 | Bacteria | 4445 |
| 142 | Ga0105245_10438605 | 3300009098 | Bacteria | 1312 |
| 143 | Ga0105247_10766052 | 3300009101 | Bacteria | 733 |
| 144 | Ga0105247_11211634 | 3300009101 | Bacteria | 602 |
| 145 | Ga0114129_10281931 | 3300009147 | Bacteria | 2220 |
| 146 | Ga0105243_10340774 | 3300009148 | Bacteria | 1373 |
| 147 | Ga0105241_10019071 | 3300009174 | Bacteria | 5058 |
| 148 | Ga0105241_10033499 | 3300009174 | Bacteria | 3856 |
| 149 | Ga0105241_10102535 | 3300009174 | Bacteria | 2277 |
| 150 | Ga0105241_10269414 | 3300009174 | Bacteria | 1450 |
| 151 | Ga0105241_10455233 | 3300009174 | Bacteria | 1133 |
| 152 | Ga0105241_10680473 | 3300009174 | Bacteria | 937 |
| 153 | Ga0105241_11114745 | 3300009174 | Bacteria | 744 |
| 154 | Ga0105242_10169196 | 3300009176 | Bacteria | 1919 |
| 155 | Ga0105242_10828011 | 3300009176 | Bacteria | 919 |
| 156 | Ga0105242_10878270 | 3300009176 | Bacteria | 895 |
| 157 | Ga0105248_10140985 | 3300009177 | Bacteria | 2719 |
| 158 | Ga0105248_10145379 | 3300009177 | Bacteria | 2675 |
| 159 | Ga0105248_10245059 | 3300009177 | Bacteria | 2017 |
| 160 | Ga0105248_10395810 | 3300009177 | Bacteria | 1555 |
| 161 | Ga0105248_11049092 | 3300009177 | Bacteria | 921 |
| 162 | Ga0105248_11759136 | 3300009177 | Bacteria | 703 |
| 163 | Ga0105248_11770371 | 3300009177 | Unclassified | 700 |
| 164 | Ga0105237_10120724 | 3300009545 | Bacteria | 2615 |
| 165 | Ga0105237_10322306 | 3300009545 | Bacteria | 1549 |
| 166 | Ga0105237_10355666 | 3300009545 | Bacteria | 1469 |
| 167 | Ga0105237_10950360 | 3300009545 | Bacteria | 866 |
| 168 | Ga0105237_11426848 | 3300009545 | Bacteria | 699 |
| 169 | Ga0105237_11478090 | 3300009545 | Unclassified | 686 |
| 170 | Ga0105237_12740522 | 3300009545 | Bacteria | 504 |
| 171 | Ga0105238_10010551 | 3300009551 | Bacteria | 9278 |
| 172 | Ga0105238_10182410 | 3300009551 | Bacteria | 2076 |
| 173 | Ga0105238_10246915 | 3300009551 | Bacteria | 1763 |
| 174 | Ga0105238_10553536 | 3300009551 | Bacteria | 1155 |
| 175 | Ga0105238_11411165 | 3300009551 | Unclassified | 724 |
| 176 | Ga0105238_12859825 | 3300009551 | Unclassified | 519 |
| 177 | Ga0105249_10127289 | 3300009553 | Bacteria | 2427 |
| 178 | Ga0105249_10898846 | 3300009553 | Unclassified | 952 |
| 179 | Ga0105239_10018959 | 3300010375 | Bacteria | 7604 |
| 180 | Ga0105239_10353252 | 3300010375 | Bacteria | 1660 |
| 181 | Ga0105239_12116984 | 3300010375 | Unclassified | 654 |
| 182 | Ga0105239_12424120 | 3300010375 | Bacteria | 611 |
| 183 | Ga0105239_13625040 | 3300010375 | Bacteria | 502 |
| 184 | Ga0105246_10059101 | 3300011119 | Bacteria | 2658 |
| 185 | Ga0105246_10179461 | 3300011119 | Bacteria | 1629 |
| 186 | Ga0105246_12099341 | 3300011119 | Unclassified | 547 |
| 187 | Ga0157373_10151724 | 3300013100 | Bacteria | 1630 |
| 188 | Ga0157373_10318742 | 3300013100 | Bacteria | 1106 |
| 189 | Ga0157373_10444366 | 3300013100 | Bacteria | 933 |
| 190 | Ga0157373_10539172 | 3300013100 | Bacteria | 845 |
| 191 | Ga0157373_10581839 | 3300013100 | Bacteria | 814 |
| 192 | Ga0157371_11641652 | 3300013102 | Unclassified | 504 |
| 193 | Ga0157370_10006622 | 3300013104 | Bacteria | 12731 |
| 194 | Ga0157370_10008076 | 3300013104 | Bacteria | 11391 |
| 195 | Ga0157370_10192208 | 3300013104 | Bacteria | 1895 |
| 196 | Ga0157369_10004351 | 3300013105 | Bacteria | 16713 |
| 197 | Ga0157369_10008438 | 3300013105 | Bacteria | 11818 |
| 198 | Ga0157369_10069033 | 3300013105 | Bacteria | 3797 |
| 199 | Ga0157369_10073830 | 3300013105 | Bacteria | 3659 |
| 200 | Ga0157369_10099938 | 3300013105 | Bacteria | 3092 |
| 201 | Ga0157369_10512462 | 3300013105 | Bacteria | 1241 |
| 202 | Ga0157369_10934338 | 3300013105 | Bacteria | 889 |
| 203 | Ga0157374_10285686 | 3300013296 | Bacteria | 1629 |
| 204 | Ga0157374_11234446 | 3300013296 | Unclassified | 769 |
| 205 | Ga0157374_12227279 | 3300013296 | Unclassified | 575 |
| 206 | Ga0157374_12722134 | 3300013296 | Bacteria | 522 |
| 207 | Ga0157378_10162304 | 3300013297 | Bacteria | 2090 |
| 208 | Ga0157378_10511865 | 3300013297 | Bacteria | 1201 |
| 209 | Ga0163162_11160875 | 3300013306 | Bacteria | 876 |
| 210 | Ga0163162_11604353 | 3300013306 | Bacteria | 742 |
| 211 | Ga0163162_12271444 | 3300013306 | Unclassified | 623 |
| 212 | Ga0163162_12325036 | 3300013306 | Unclassified | 616 |
| 213 | Ga0157372_10000424 | 3300013307 | Bacteria | 46469 |
| 214 | Ga0157372_10092295 | 3300013307 | Bacteria | 3444 |
| 215 | Ga0157372_10124099 | 3300013307 | Bacteria | 2968 |
| 216 | Ga0157372_10136299 | 3300013307 | Bacteria | 2827 |
| 217 | Ga0157372_10492494 | 3300013307 | Bacteria | 1429 |
| 218 | Ga0157372_10552252 | 3300013307 | Bacteria | 1343 |
| 219 | Ga0157372_10848801 | 3300013307 | Bacteria | 1060 |
| 220 | Ga0157375_10165732 | 3300013308 | Bacteria | 2354 |
| 221 | Ga0157375_11245580 | 3300013308 | Bacteria | 873 |
| 222 | Ga0157375_11551984 | 3300013308 | Bacteria | 782 |
| 223 | Ga0163163_10093659 | 3300014325 | Bacteria | 3021 |
| 224 | Ga0163163_10142252 | 3300014325 | Bacteria | 2441 |
| 225 | Ga0163163_11321162 | 3300014325 | Bacteria | 783 |
| 226 | Ga0163163_11729153 | 3300014325 | Unclassified | 686 |
| 227 | Ga0182008_10061089 | 3300014497 | Bacteria | 1857 |
| 228 | Ga0157376_10913440 | 3300014969 | Unclassified | 897 |
| 229 | Ga0163161_10407674 | 3300017792 | Bacteria | 1091 |
| 230 | Ga0197907_10629253 | 3300020069 | Bacteria | 691 |
| 231 | Ga0197907_11426004 | 3300020069 | Bacteria | 1347 |
| 232 | Ga0197907_11511092 | 3300020069 | Unclassified | 718 |
| 233 | Ga0206352_10081231 | 3300020078 | Bacteria | 979 |
| 234 | Ga0206352_10629975 | 3300020078 | Bacteria | 1125 |
| 235 | Ga0206350_10722182 | 3300020080 | Bacteria | 869 |
| 236 | Ga0206354_10031333 | 3300020081 | Unclassified | 544 |
| 237 | Ga0213873_10148009 | 3300021358 | Unclassified | 705 |
| 238 | Ga0213876_10445947 | 3300021384 | Unclassified | 688 |
| 239 | Ga0224712_10203988 | 3300022467 | Bacteria | 899 |
| 240 | Ga0207656_10021069 | 3300025321 | Bacteria | 2599 |
| 241 | Ga0207656_10136248 | 3300025321 | Bacteria | 1154 |
| 242 | Ga0207642_10077223 | 3300025899 | Unclassified | 1606 |
| 243 | Ga0207710_10154007 | 3300025900 | Bacteria | 1116 |
| 244 | Ga0207680_11265087 | 3300025903 | Unclassified | 525 |
| 245 | Ga0207647_10510618 | 3300025904 | Unclassified | 669 |
| 246 | Ga0207685_10592033 | 3300025905 | Bacteria | 594 |
| 247 | Ga0207699_10115363 | 3300025906 | Bacteria | 1728 |
| 248 | Ga0207699_10701868 | 3300025906 | Bacteria | 741 |
| 249 | Ga0207645_10500873 | 3300025907 | Bacteria | 822 |
| 250 | Ga0207645_10735376 | 3300025907 | Bacteria | 671 |
| 251 | Ga0207705_10110797 | 3300025909 | Bacteria | 2028 |
| 252 | Ga0207705_10247022 | 3300025909 | Bacteria | 1360 |
| 253 | Ga0207705_10532240 | 3300025909 | Bacteria | 913 |
| 254 | Ga0207654_10001818 | 3300025911 | Bacteria | 11074 |
| 255 | Ga0207654_10016146 | 3300025911 | Bacteria | 3884 |
| 256 | Ga0207654_10023979 | 3300025911 | Bacteria | 3275 |
| 257 | Ga0207654_10314553 | 3300025911 | Bacteria | 1069 |
| 258 | Ga0207654_10989430 | 3300025911 | Bacteria | 611 |
| 259 | Ga0207707_10560064 | 3300025912 | Bacteria | 970 |
| 260 | Ga0207695_10000379 | 3300025913 | Bacteria | 101331 |
| 261 | Ga0207695_10003215 | 3300025913 | Bacteria | 23264 |
| 262 | Ga0207695_10113892 | 3300025913 | Bacteria | 2680 |
| 263 | Ga0207695_10274140 | 3300025913 | Bacteria | 1582 |
| 264 | Ga0207671_10000503 | 3300025914 | Bacteria | 53115 |
| 265 | Ga0207671_10186363 | 3300025914 | Bacteria | 1617 |
| 266 | Ga0207671_10633766 | 3300025914 | Bacteria | 851 |
| 267 | Ga0207671_10776696 | 3300025914 | Bacteria | 760 |
| 268 | Ga0207671_11338872 | 3300025914 | Unclassified | 557 |
| 269 | Ga0207663_10042911 | 3300025916 | Bacteria | 2766 |
| 270 | Ga0207663_10389117 | 3300025916 | Bacteria | 1064 |
| 271 | Ga0207663_11166765 | 3300025916 | Unclassified | 620 |
| 272 | Ga0207660_10009654 | 3300025917 | Bacteria | 6246 |
| 273 | Ga0207662_10949465 | 3300025918 | Unclassified | 610 |
| 274 | Ga0207657_10171546 | 3300025919 | Bacteria | 1757 |
| 275 | Ga0207657_10494097 | 3300025919 | Bacteria | 959 |
| 276 | Ga0207657_10641450 | 3300025919 | Bacteria | 827 |
| 277 | Ga0207649_10007836 | 3300025920 | Bacteria | 5812 |
| 278 | Ga0207649_10168565 | 3300025920 | Bacteria | 1523 |
| 279 | Ga0207652_10176277 | 3300025921 | Bacteria | 1920 |
| 280 | Ga0207652_11308553 | 3300025921 | Bacteria | 627 |
| 281 | Ga0207694_10001290 | 3300025924 | Bacteria | 21610 |
| 282 | Ga0207694_10126612 | 3300025924 | Bacteria | 2044 |
| 283 | Ga0207694_10205170 | 3300025924 | Bacteria | 1605 |
| 284 | Ga0207687_10005635 | 3300025927 | Bacteria | 8282 |
| 285 | Ga0207687_10178613 | 3300025927 | Bacteria | 1643 |
| 286 | Ga0207700_10163874 | 3300025928 | Bacteria | 1848 |
| 287 | Ga0207700_11637077 | 3300025928 | Bacteria | 569 |
| 288 | Ga0207700_11637542 | 3300025928 | Unclassified | 569 |
| 289 | Ga0207664_10132452 | 3300025929 | Bacteria | 2100 |
| 290 | Ga0207664_10132724 | 3300025929 | Bacteria | 2098 |
| 291 | Ga0207644_10159342 | 3300025931 | Bacteria | 1753 |
| 292 | Ga0207690_10128235 | 3300025932 | Bacteria | 1853 |
| 293 | Ga0207690_10539238 | 3300025932 | Bacteria | 947 |
| 294 | Ga0207686_10514957 | 3300025934 | Bacteria | 930 |
| 295 | Ga0207686_10942265 | 3300025934 | Bacteria | 698 |
| 296 | Ga0207709_10350679 | 3300025935 | Bacteria | 1114 |
| 297 | Ga0207670_10189237 | 3300025936 | Bacteria | 1556 |
| 298 | Ga0207670_11308966 | 3300025936 | Bacteria | 614 |
| 299 | Ga0207670_11443091 | 3300025936 | Unclassified | 585 |
| 300 | Ga0207669_10439020 | 3300025937 | Bacteria | 1032 |
| 301 | Ga0207704_10063299 | 3300025938 | Bacteria | 2305 |
| 302 | Ga0207704_10446793 | 3300025938 | Bacteria | 1031 |
| 303 | Ga0207704_11369377 | 3300025938 | Unclassified | 606 |
| 304 | Ga0207691_11502131 | 3300025940 | Unclassified | 551 |
| 305 | Ga0207711_10049984 | 3300025941 | Bacteria | 3580 |
| 306 | Ga0207711_10100024 | 3300025941 | Bacteria | 2564 |
| 307 | Ga0207711_10341013 | 3300025941 | Bacteria | 1387 |
| 308 | Ga0207711_10432313 | 3300025941 | Bacteria | 1225 |
| 309 | Ga0207711_10520705 | 3300025941 | Bacteria | 1109 |
| 310 | Ga0207711_11283789 | 3300025941 | Unclassified | 674 |
| 311 | Ga0207661_10204260 | 3300025944 | Bacteria | 1738 |
| 312 | Ga0207661_10342388 | 3300025944 | Bacteria | 1347 |
| 313 | Ga0207679_10131379 | 3300025945 | Bacteria | 2009 |
| 314 | Ga0207679_10183582 | 3300025945 | Bacteria | 1733 |
| 315 | Ga0207679_11081303 | 3300025945 | Bacteria | 736 |
| 316 | Ga0207679_11640738 | 3300025945 | Bacteria | 589 |
| 317 | Ga0207667_10006951 | 3300025949 | Bacteria | 13678 |
| 318 | Ga0207667_10008805 | 3300025949 | Bacteria | 11950 |
| 319 | Ga0207667_10044956 | 3300025949 | Bacteria | 4678 |
| 320 | Ga0207667_10075240 | 3300025949 | Bacteria | 3507 |
| 321 | Ga0207667_10158603 | 3300025949 | Bacteria | 2328 |
| 322 | Ga0207667_10258025 | 3300025949 | Bacteria | 1783 |
| 323 | Ga0207667_10516793 | 3300025949 | Bacteria | 1210 |
| 324 | Ga0207667_11855631 | 3300025949 | Unclassified | 566 |
| 325 | Ga0207651_10072464 | 3300025960 | Bacteria | 2446 |
| 326 | Ga0207651_10438639 | 3300025960 | Bacteria | 1118 |
| 327 | Ga0207640_10592570 | 3300025981 | Bacteria | 937 |
| 328 | Ga0207640_10759592 | 3300025981 | Bacteria | 837 |
| 329 | Ga0207640_11240273 | 3300025981 | Unclassified | 664 |
| 330 | Ga0207658_11900063 | 3300025986 | Unclassified | 542 |
| 331 | Ga0207677_10522312 | 3300026023 | Bacteria | 1030 |
| 332 | Ga0207703_10121825 | 3300026035 | Bacteria | 2240 |
| 333 | Ga0207703_10293427 | 3300026035 | Bacteria | 1481 |
| 334 | Ga0207703_10344238 | 3300026035 | Bacteria | 1371 |
| 335 | Ga0207639_10000868 | 3300026041 | Bacteria | 20542 |
| 336 | Ga0207639_10241593 | 3300026041 | Bacteria | 1570 |
| 337 | Ga0207639_10528640 | 3300026041 | Bacteria | 1081 |
| 338 | Ga0207708_11809269 | 3300026075 | Bacteria | 536 |
| 339 | Ga0207702_10001589 | 3300026078 | Bacteria | 22475 |
| 340 | Ga0207702_10073915 | 3300026078 | Bacteria | 2940 |
| 341 | Ga0207702_10244880 | 3300026078 | Bacteria | 1681 |
| 342 | Ga0207702_12041154 | 3300026078 | Bacteria | 563 |
| 343 | Ga0207641_10912562 | 3300026088 | Bacteria | 873 |
| 344 | Ga0207648_10111966 | 3300026089 | Bacteria | 2396 |
| 345 | Ga0207648_10165067 | 3300026089 | Bacteria | 1957 |
| 346 | Ga0207676_10162211 | 3300026095 | Bacteria | 1938 |
| 347 | Ga0207676_10710020 | 3300026095 | Bacteria | 975 |
| 348 | Ga0207676_12352181 | 3300026095 | Unclassified | 530 |
| 349 | Ga0207676_12543447 | 3300026095 | Bacteria | 508 |
| 350 | Ga0207674_10097677 | 3300026116 | Bacteria | 2921 |
| 351 | Ga0207674_10125804 | 3300026116 | Bacteria | 2529 |
| 352 | Ga0207675_100467402 | 3300026118 | Bacteria | 1252 |
| 353 | Ga0207683_10438507 | 3300026121 | Bacteria | 1204 |
| 354 | Ga0207698_10000039 | 3300026142 | Bacteria | 101073 |
| 355 | Ga0207698_10000059 | 3300026142 | Bacteria | 76632 |
| 356 | Ga0207698_10069757 | 3300026142 | Bacteria | 2781 |
| 357 | Ga0207698_10085167 | 3300026142 | Bacteria | 2565 |
| 358 | Ga0207698_11854078 | 3300026142 | Bacteria | 618 |
| 359 | Ga0268266_11265523 | 3300028379 | Unclassified | 713 |
| 360 | Ga0268264_10567935 | 3300028381 | Unclassified | 1115 |
| 361 | Ga0268264_10943841 | 3300028381 | Bacteria | 867 |
| 362 | Ga0265336_10066187 | 3300028666 | Unclassified | 1081 |
| 363 | Ga0265338_10026446 | 3300028800 | Bacteria | 5851 |
| 364 | Ga0265324_10005069 | 3300029957 | Bacteria | 5768 |
| 365 | Ga0265770_1067326 | 3300030878 | Bacteria | 677 |
| 366 | Ga0265760_10165140 | 3300031090 | Bacteria | 733 |
| 367 | Ga0265332_10024511 | 3300031238 | Bacteria | 2654 |
| 368 | Ga0265328_10127802 | 3300031239 | Bacteria | 950 |
| 369 | Ga0265320_10009193 | 3300031240 | Bacteria | 5978 |
| 370 | Ga0265325_10023327 | 3300031241 | Bacteria | 3379 |
| 371 | Ga0265325_10217872 | 3300031241 | Bacteria | 874 |
| 372 | Ga0265329_10025218 | 3300031242 | Bacteria | 1969 |
| 373 | Ga0265340_10019656 | 3300031247 | Bacteria | 3477 |
| 374 | Ga0265339_10024306 | 3300031249 | Bacteria | 3493 |
| 375 | Ga0265331_10001121 | 3300031250 | Bacteria | 20536 |
| 376 | Ga0265331_10059193 | 3300031250 | Bacteria | 1812 |
| 377 | Ga0265331_10323112 | 3300031250 | Bacteria | 691 |
| 378 | Ga0265316_10045658 | 3300031344 | Bacteria | 3476 |
| 379 | Ga0265316_10088121 | 3300031344 | Bacteria | 2370 |
| 380 | Ga0265316_10264301 | 3300031344 | Bacteria | 1261 |
| 381 | Ga0265316_10327281 | 3300031344 | Bacteria | 1112 |
| 382 | Ga0265316_10348099 | 3300031344 | Bacteria | 1073 |
| 383 | Ga0265316_10393610 | 3300031344 | Unclassified | 998 |
| 384 | Ga0265316_10949812 | 3300031344 | Unclassified | 599 |
| 385 | Ga0265314_10037033 | 3300031711 | Bacteria | 3538 |
| 386 | Ga0265314_10183632 | 3300031711 | Bacteria | 1251 |
| 387 | Ga0265342_10193629 | 3300031712 | Bacteria | 1108 |
| 388 | Ga0265342_10336475 | 3300031712 | Bacteria | 788 |
| 389 | Ga0307412_11766458 | 3300031911 | Bacteria | 568 |
| 390 | Ga0307416_102604910 | 3300032002 | Unclassified | 603 |
| 391 | Ga0316053_107793 | 3300032120 | Unclassified | 715 |
| 392 | Ga0316583_10238438 | 3300032133 | Bacteria | 630 |
| 393 | Ga0373953_0039547 | 3300035117 | Bacteria | 1869 |
| 394 | Ga0373954_0004404 | 3300035118 | Bacteria | 6055 |
| 395 | Ga0373954_0032814 | 3300035118 | Bacteria | 2401 |
| 396 | Ga0373957_0348173 | 3300035120 | Unclassified | 632 |
| 397 | Ga0373946_0256260 | 3300035171 | Unclassified | 855 |
| 398 | Ga0373955_0034008 | 3300035172 | Bacteria | 2688 |
| 399 | Ga0373955_0102378 | 3300035172 | Bacteria | 1646 |
| 400 | Ga0373927_0063287 | 3300035695 | Bacteria | 2393 |
| 401 | Ga0373933_0107041 | 3300035724 | Bacteria | 1740 |
| 402 | Ga0373933_0323120 | 3300035724 | Unclassified | 1001 |
| 403 | Ga0373933_0498201 | 3300035724 | Bacteria | 798 |
| 404 | Ga0373947_0681495 | 3300035725 | Bacteria | 701 |
| 405 | Ga0373937_0018076 | 3300036401 | Bacteria | 6288 |
| 406 | Ga0373937_0390865 | 3300036401 | Bacteria | 1319 |
| 407 | Ga0373937_0868369 | 3300036401 | Bacteria | 851 |
| 408 | Ga0265778_002900 | 3300036457 | Bacteria | 1697 |
| 409 | Ga0265778_011645 | 3300036457 | Bacteria | 1016 |
| 410 | Ga0373925_0100983 | 3300037068 | Bacteria | 2218 |
| 411 | Ga0373925_0652358 | 3300037068 | Unclassified | 867 |
| 412 | Ga0373925_0795072 | 3300037068 | Bacteria | 780 |
| 413 | Ga0373925_1042202 | 3300037068 | Bacteria | 673 |
| 414 | Ga0395900_0566214 | 3300037418 | Bacteria | 1079 |
| 415 | Ga0395898_0117406 | 3300037466 | Bacteria | 2549 |
| 416 | Ga0436364_1078028 | 3300037853 | Unclassified | 547 |
| 417 | Ga0436365_0408821 | 3300039437 | Bacteria | 1282 |
| 418 | Ga0436365_1191518 | 3300039437 | Bacteria | 3046 |
| 419 | Ga0436360_0261959 | 3300039438 | Bacteria | 1358 |
| 420 | Ga0436363_0439753 | 3300039450 | Bacteria | 1118 |
| 421 | Ga0436363_1703451 | 3300039450 | Unclassified | 533 |
| 422 | Ga0436362_0001488 | 3300039453 | Bacteria | 1332 |
| 423 | Ga0451577_0173522 | 3300042876 | Bacteria | 1943 |
| 424 | Ga0451577_1684531 | 3300042876 | Bacteria | 558 |
| 425 | Ga0453683_1042374 | 3300044673 | Bacteria | 544 |
| 426 | Ga0453683_1223051 | 3300044673 | Unclassified | 503 |
| 427 | Ga0466966_0565567 | 3300044684 | Bacteria | 684 |
| 428 | Ga0466963_0003181 | 3300044694 | Bacteria | 9324 |
| 429 | Ga0453684_0195532 | 3300044712 | Bacteria | 2362 |
| 430 | Ga0453684_1049584 | 3300044712 | Bacteria | 864 |
| 431 | Ga0466971_0174310 | 3300044719 | Bacteria | 1010 |
| 432 | Ga0466971_0203686 | 3300044719 | Bacteria | 934 |
| 433 | Ga0466957_0476619 | 3300044842 | Bacteria | 863 |
| 434 | Ga0466959_0680363 | 3300045049 | Bacteria | 690 |
| 435 | Ga0466958_0456218 | 3300045836 | Bacteria | 828 |
| 436 | Ga0466967_0048703 | 3300045976 | Bacteria | 3702 |
| 437 | Ga0466967_0220020 | 3300045976 | Bacteria | 1804 |
| 438 | Ga0466967_0652124 | 3300045976 | Bacteria | 1041 |
| 439 | Ga0466967_1113497 | 3300045976 | Bacteria | 787 |
| 440 | Ga0495653_0843228 | 3300046463 | Bacteria | 549 |
| 441 | Ga0495580_0069834 | 3300046472 | Bacteria | 2454 |
| 442 | Ga0495580_0552097 | 3300046472 | Bacteria | 765 |
| 443 | Ga0495580_0562032 | 3300046472 | Unclassified | 757 |
| 444 | Ga0495664_0577150 | 3300046477 | Bacteria | 669 |
| 445 | Ga0495608_0352040 | 3300046511 | Bacteria | 906 |
| 446 | Ga0495628_0489551 | 3300046516 | Bacteria | 889 |
| 447 | Ga0495652_0147554 | 3300046529 | Bacteria | 1842 |
| 448 | Ga0495640_0846172 | 3300046533 | Unclassified | 544 |
| 449 | Ga0495667_0560841 | 3300046559 | Unclassified | 713 |
| 450 | Ga0495623_0229833 | 3300046679 | Bacteria | 1053 |
| 451 | Ga0495669_0416619 | 3300046684 | Unclassified | 651 |
| 452 | Ga0495600_0404426 | 3300046809 | Bacteria | 849 |
| 453 | Ga0495581_0120249 | 3300047315 | Bacteria | 1528 |
| 454 | Ga0495604_0302389 | 3300047317 | Bacteria | 1074 |
| 455 | Ga0495674_0147668 | 3300047319 | Bacteria | 1973 |
| 456 | Ga0495674_1223168 | 3300047319 | Bacteria | 567 |
| 457 | Ga0495680_0871283 | 3300047322 | Unclassified | 584 |
| 458 | Ga0495675_0039213 | 3300047444 | Bacteria | 3017 |
| 459 | Ga0495684_0089557 | 3300047471 | Bacteria | 2331 |
| 460 | Ga0495684_0152542 | 3300047471 | Bacteria | 1727 |
| 461 | Ga0495684_0969131 | 3300047471 | Unclassified | 543 |
| 462 | Ga0495602_0307814 | 3300048088 | Bacteria | 1157 |
| 463 | Ga0496102_0341167 | 3300048905 | Bacteria | 1411 |
| 464 | Ga0496104_1484708 | 3300048907 | Bacteria | 581 |
| 465 | Ga0496106_0942327 | 3300048909 | Bacteria | 681 |
| 466 | Ga0501070_0020844 | 3300049586 | Bacteria | 5499 |
| 467 | Ga0501072_0941625 | 3300049588 | Bacteria | 674 |
| 468 | nmdc:mga05p37_1553080_c1 | 3300050507 | Unclassified | 655 |
| 469 | nmdc:mga09592_1166991_c1 | 3300050508 | Unclassified | 638 |
| 470 | nmdc:mga0qj67_1304805_c1 | 3300050509 | Unclassified | 562 |
| 471 | nmdc:mga0qj67_132733_c1 | 3300050509 | Bacteria | 2017 |
| 472 | nmdc:mga06r32_10773_c1 | 3300050510 | Bacteria | 8236 |
| 473 | nmdc:mga08y16_1620439_c1 | 3300050511 | Bacteria | 604 |
| 474 | nmdc:mga08y16_571405_c1 | 3300050511 | Bacteria | 1142 |
| 475 | nmdc:mga08y16_847088_c1 | 3300050511 | Bacteria | 904 |
| 476 | Ga0495595_0118603 | 3300053084 | Bacteria | 1288 |
| 477 | Ga0495619_0318175 | 3300053085 | Bacteria | 1077 |
| 478 | Ga0495619_0960435 | 3300053085 | Unclassified | 573 |
| 479 | Ga0587086_020241 | 3300059507 | Bacteria | 902 |
| 480 | Ga0587075_012377 | 3300059644 | Bacteria | 1158 |
| 481 | Ga0587114_122396 | 3300059655 | Unclassified | 528 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_11604353 | Ga0163162_116043531 | 89 |
| 2 | 3300045049 | Ga0466959_0680363 | Ga0466959_0680363_11_280 | 89 |
| 3 | 3300009101 | Ga0105247_11211634 | Ga0105247_112116341 | 90 |
| 4 | 3300005842 | Ga0068858_100107555 | Ga0068858_1001075553 | 91 |
| 5 | 3300009098 | Ga0105245_10438605 | Ga0105245_104386052 | 91 |
| 6 | 3300009177 | Ga0105248_11759136 | Ga0105248_117591362 | 91 |
| 7 | 3300025927 | Ga0207687_10178613 | Ga0207687_101786132 | 91 |
| 8 | 3300025941 | Ga0207711_10520705 | Ga0207711_105207052 | 91 |
| 9 | 3300026035 | Ga0207703_10121825 | Ga0207703_101218252 | 91 |
| 10 | 3300026095 | Ga0207676_12543447 | Ga0207676_125434472 | 91 |
| 11 | 3300037068 | Ga0373925_0652358 | Ga0373925_0652358_548_838 | 91 |
| 12 | 3300047315 | Ga0495581_0120249 | Ga0495581_0120249_668_958 | 91 |
| 13 | 3300050511 | nmdc:mga08y16_847088_c1 | nmdc:mga08y16_847088_c1_28_318 | 91 |
| 14 | 3300005615 | Ga0070702_100140027 | Ga0070702_1001400272 | 92 |
| 15 | 3300009174 | Ga0105241_10102535 | Ga0105241_101025352 | 92 |
| 16 | 3300009176 | Ga0105242_10169196 | Ga0105242_101691963 | 92 |
| 17 | 3300009545 | Ga0105237_10355666 | Ga0105237_103556663 | 92 |
| 18 | 3300013306 | Ga0163162_12325036 | Ga0163162_123250362 | 92 |
| 19 | 3300035171 | Ga0373946_0256260 | Ga0373946_0256260_304_582 | 92 |
| 20 | 3300035724 | Ga0373933_0498201 | Ga0373933_0498201_398_676 | 92 |
| 21 | 3300004799 | Ga0058863_11773782 | Ga0058863_117737822 | 95 |
| 22 | 3300005327 | Ga0070658_10034348 | Ga0070658_100343486 | 95 |
| 23 | 3300005327 | Ga0070658_10087950 | Ga0070658_100879502 | 95 |
| 24 | 3300005329 | Ga0070683_100011876 | Ga0070683_10001187611 | 95 |
| 25 | 3300005329 | Ga0070683_100127827 | Ga0070683_1001278273 | 95 |
| 26 | 3300005329 | Ga0070683_100140694 | Ga0070683_1001406943 | 95 |
| 27 | 3300005330 | Ga0070690_100355530 | Ga0070690_1003555302 | 95 |
| 28 | 3300005330 | Ga0070690_100790774 | Ga0070690_1007907742 | 95 |
| 29 | 3300005330 | Ga0070690_101045586 | Ga0070690_1010455862 | 95 |
| 30 | 3300005331 | Ga0070670_101280382 | Ga0070670_1012803821 | 95 |
| 31 | 3300005334 | Ga0068869_100032062 | Ga0068869_1000320626 | 95 |
| 32 | 3300005335 | Ga0070666_10335211 | Ga0070666_103352112 | 95 |
| 33 | 3300005335 | Ga0070666_10611444 | Ga0070666_106114441 | 95 |
| 34 | 3300005336 | Ga0070680_100003385 | Ga0070680_1000033855 | 95 |
| 35 | 3300005336 | Ga0070680_101971883 | Ga0070680_1019718831 | 95 |
| 36 | 3300005337 | Ga0070682_100229280 | Ga0070682_1002292802 | 95 |
| 37 | 3300005337 | Ga0070682_101890528 | Ga0070682_1018905281 | 95 |
| 38 | 3300005338 | Ga0068868_100732432 | Ga0068868_1007324322 | 95 |
| 39 | 3300005338 | Ga0068868_100740222 | Ga0068868_1007402222 | 95 |
| 40 | 3300005339 | Ga0070660_100603597 | Ga0070660_1006035972 | 95 |
| 41 | 3300005339 | Ga0070660_100828818 | Ga0070660_1008288181 | 95 |
| 42 | 3300005340 | Ga0070689_100145757 | Ga0070689_1001457574 | 95 |
| 43 | 3300005340 | Ga0070689_101993010 | Ga0070689_1019930102 | 95 |
| 44 | 3300005344 | Ga0070661_100095351 | Ga0070661_1000953513 | 95 |
| 45 | 3300005344 | Ga0070661_100171910 | Ga0070661_1001719102 | 95 |
| 46 | 3300005345 | Ga0070692_10429462 | Ga0070692_104294622 | 95 |
| 47 | 3300005364 | Ga0070673_100224680 | Ga0070673_1002246803 | 95 |
| 48 | 3300005366 | Ga0070659_100040328 | Ga0070659_1000403283 | 95 |
| 49 | 3300005366 | Ga0070659_100461056 | Ga0070659_1004610562 | 95 |
| 50 | 3300005367 | Ga0070667_100112886 | Ga0070667_1001128865 | 95 |
| 51 | 3300005367 | Ga0070667_101990900 | Ga0070667_1019909001 | 95 |
| 52 | 3300005434 | Ga0070709_10601432 | Ga0070709_106014322 | 95 |
| 53 | 3300005434 | Ga0070709_11420961 | Ga0070709_114209611 | 95 |
| 54 | 3300005435 | Ga0070714_100226935 | Ga0070714_1002269353 | 95 |
| 55 | 3300005435 | Ga0070714_100242744 | Ga0070714_1002427442 | 95 |
| 56 | 3300005436 | Ga0070713_100319766 | Ga0070713_1003197662 | 95 |
| 57 | 3300005436 | Ga0070713_101714319 | Ga0070713_1017143191 | 95 |
| 58 | 3300005439 | Ga0070711_100248899 | Ga0070711_1002488992 | 95 |
| 59 | 3300005439 | Ga0070711_100467606 | Ga0070711_1004676062 | 95 |
| 60 | 3300005439 | Ga0070711_101282670 | Ga0070711_1012826702 | 95 |
| 61 | 3300005455 | Ga0070663_101937936 | Ga0070663_1019379361 | 95 |
| 62 | 3300005456 | Ga0070678_100909430 | Ga0070678_1009094302 | 95 |
| 63 | 3300005456 | Ga0070678_101130244 | Ga0070678_1011302442 | 95 |
| 64 | 3300005457 | Ga0070662_100110487 | Ga0070662_1001104874 | 95 |
| 65 | 3300005458 | Ga0070681_10279937 | Ga0070681_102799372 | 95 |
| 66 | 3300005458 | Ga0070681_11312271 | Ga0070681_113122711 | 95 |
| 67 | 3300005459 | Ga0068867_100164843 | Ga0068867_1001648431 | 95 |
| 68 | 3300005459 | Ga0068867_100511163 | Ga0068867_1005111632 | 95 |
| 69 | 3300005459 | Ga0068867_100798068 | Ga0068867_1007980682 | 95 |
| 70 | 3300005466 | Ga0070685_11487597 | Ga0070685_114875971 | 95 |
| 71 | 3300005530 | Ga0070679_100306968 | Ga0070679_1003069683 | 95 |
| 72 | 3300005530 | Ga0070679_100796808 | Ga0070679_1007968082 | 95 |
| 73 | 3300005535 | Ga0070684_100043376 | Ga0070684_1000433763 | 95 |
| 74 | 3300005535 | Ga0070684_100084550 | Ga0070684_1000845504 | 95 |
| 75 | 3300005535 | Ga0070684_100382373 | Ga0070684_1003823733 | 95 |
| 76 | 3300005535 | Ga0070684_100910473 | Ga0070684_1009104732 | 95 |
| 77 | 3300005535 | Ga0070684_101296137 | Ga0070684_1012961372 | 95 |
| 78 | 3300005539 | Ga0068853_100133809 | Ga0068853_1001338092 | 95 |
| 79 | 3300005539 | Ga0068853_100849546 | Ga0068853_1008495462 | 95 |
| 80 | 3300005539 | Ga0068853_101023187 | Ga0068853_1010231872 | 95 |
| 81 | 3300005543 | Ga0070672_100454817 | Ga0070672_1004548172 | 95 |
| 82 | 3300005543 | Ga0070672_100603484 | Ga0070672_1006034842 | 95 |
| 83 | 3300005544 | Ga0070686_100378425 | Ga0070686_1003784252 | 95 |
| 84 | 3300005546 | Ga0070696_100637017 | Ga0070696_1006370172 | 95 |
| 85 | 3300005546 | Ga0070696_101785997 | Ga0070696_1017859972 | 95 |
| 86 | 3300005548 | Ga0070665_100019426 | Ga0070665_10001942614 | 95 |
| 87 | 3300005548 | Ga0070665_100193238 | Ga0070665_1001932384 | 95 |
| 88 | 3300005548 | Ga0070665_100489396 | Ga0070665_1004893962 | 95 |
| 89 | 3300005563 | Ga0068855_100019267 | Ga0068855_1000192675 | 95 |
| 90 | 3300005563 | Ga0068855_100067695 | Ga0068855_1000676956 | 95 |
| 91 | 3300005563 | Ga0068855_100099913 | Ga0068855_1000999135 | 95 |
| 92 | 3300005563 | Ga0068855_100135549 | Ga0068855_1001355495 | 95 |
| 93 | 3300005563 | Ga0068855_100274061 | Ga0068855_1002740613 | 95 |
| 94 | 3300005563 | Ga0068855_100336135 | Ga0068855_1003361353 | 95 |
| 95 | 3300005563 | Ga0068855_101494025 | Ga0068855_1014940252 | 95 |
| 96 | 3300005564 | Ga0070664_100221341 | Ga0070664_1002213412 | 95 |
| 97 | 3300005564 | Ga0070664_100408912 | Ga0070664_1004089122 | 95 |
| 98 | 3300005564 | Ga0070664_101985845 | Ga0070664_1019858451 | 95 |
| 99 | 3300005564 | Ga0070664_102370850 | Ga0070664_1023708502 | 95 |
| 100 | 3300005577 | Ga0068857_100373758 | Ga0068857_1003737582 | 95 |
| 101 | 3300005577 | Ga0068857_102349277 | Ga0068857_1023492771 | 95 |
| 102 | 3300005578 | Ga0068854_100081038 | Ga0068854_1000810382 | 95 |
| 103 | 3300005578 | Ga0068854_100448867 | Ga0068854_1004488672 | 95 |
| 104 | 3300005578 | Ga0068854_101230312 | Ga0068854_1012303122 | 95 |
| 105 | 3300005614 | Ga0068856_100018870 | Ga0068856_1000188702 | 95 |
| 106 | 3300005614 | Ga0068856_100074498 | Ga0068856_1000744985 | 95 |
| 107 | 3300005614 | Ga0068856_100173262 | Ga0068856_1001732625 | 95 |
| 108 | 3300005614 | Ga0068856_100583850 | Ga0068856_1005838502 | 95 |
| 109 | 3300005614 | Ga0068856_102005051 | Ga0068856_1020050512 | 95 |
| 110 | 3300005616 | Ga0068852_100024674 | Ga0068852_1000246745 | 95 |
| 111 | 3300005616 | Ga0068852_100054705 | Ga0068852_1000547052 | 95 |
| 112 | 3300005616 | Ga0068852_100520927 | Ga0068852_1005209271 | 95 |
| 113 | 3300005616 | Ga0068852_100559762 | Ga0068852_1005597622 | 95 |
| 114 | 3300005616 | Ga0068852_101066371 | Ga0068852_1010663712 | 95 |
| 115 | 3300005616 | Ga0068852_101595218 | Ga0068852_1015952182 | 95 |
| 116 | 3300005616 | Ga0068852_102197503 | Ga0068852_1021975032 | 95 |
| 117 | 3300005617 | Ga0068859_100528142 | Ga0068859_1005281422 | 95 |
| 118 | 3300005618 | Ga0068864_101664988 | Ga0068864_1016649882 | 95 |
| 119 | 3300005718 | Ga0068866_10105529 | Ga0068866_101055292 | 95 |
| 120 | 3300005718 | Ga0068866_11119813 | Ga0068866_111198131 | 95 |
| 121 | 3300005718 | Ga0068866_11326093 | Ga0068866_113260931 | 95 |
| 122 | 3300005719 | Ga0068861_101882474 | Ga0068861_1018824742 | 95 |
| 123 | 3300005834 | Ga0068851_10018984 | Ga0068851_100189843 | 95 |
| 124 | 3300005834 | Ga0068851_10197446 | Ga0068851_101974462 | 95 |
| 125 | 3300005841 | Ga0068863_100294776 | Ga0068863_1002947761 | 95 |
| 126 | 3300005841 | Ga0068863_100752387 | Ga0068863_1007523872 | 95 |
| 127 | 3300005841 | Ga0068863_101103759 | Ga0068863_1011037592 | 95 |
| 128 | 3300005842 | Ga0068858_100065255 | Ga0068858_1000652552 | 95 |
| 129 | 3300005842 | Ga0068858_100518938 | Ga0068858_1005189382 | 95 |
| 130 | 3300005843 | Ga0068860_100377752 | Ga0068860_1003777522 | 95 |
| 131 | 3300005843 | Ga0068860_100615283 | Ga0068860_1006152831 | 95 |
| 132 | 3300006028 | Ga0070717_10008895 | Ga0070717_100088958 | 95 |
| 133 | 3300006028 | Ga0070717_10415563 | Ga0070717_104155632 | 95 |
| 134 | 3300006163 | Ga0070715_11004026 | Ga0070715_110040262 | 95 |
| 135 | 3300006237 | Ga0097621_100084015 | Ga0097621_1000840155 | 95 |
| 136 | 3300006237 | Ga0097621_100400621 | Ga0097621_1004006213 | 95 |
| 137 | 3300006237 | Ga0097621_101347968 | Ga0097621_1013479682 | 95 |
| 138 | 3300006358 | Ga0068871_100321617 | Ga0068871_1003216173 | 95 |
| 139 | 3300006358 | Ga0068871_100443827 | Ga0068871_1004438272 | 95 |
| 140 | 3300006358 | Ga0068871_100587733 | Ga0068871_1005877332 | 95 |
| 141 | 3300006846 | Ga0075430_100062426 | Ga0075430_1000624263 | 95 |
| 142 | 3300006846 | Ga0075430_101565249 | Ga0075430_1015652492 | 95 |
| 143 | 3300006847 | Ga0075431_100269551 | Ga0075431_1002695512 | 95 |
| 144 | 3300006880 | Ga0075429_100843529 | Ga0075429_1008435292 | 95 |
| 145 | 3300006880 | Ga0075429_101284120 | Ga0075429_1012841202 | 95 |
| 146 | 3300006881 | Ga0068865_100083824 | Ga0068865_1000838245 | 95 |
| 147 | 3300006881 | Ga0068865_100444614 | Ga0068865_1004446142 | 95 |
| 148 | 3300006881 | Ga0068865_101229805 | Ga0068865_1012298051 | 95 |
| 149 | 3300006931 | Ga0097620_100528128 | Ga0097620_1005281282 | 95 |
| 150 | 3300009036 | Ga0105244_10158474 | Ga0105244_101584742 | 95 |
| 151 | 3300009093 | Ga0105240_10032555 | Ga0105240_1003255513 | 95 |
| 152 | 3300009093 | Ga0105240_10050651 | Ga0105240_100506516 | 95 |
| 153 | 3300009093 | Ga0105240_10146366 | Ga0105240_101463665 | 95 |
| 154 | 3300009093 | Ga0105240_10158948 | Ga0105240_101589482 | 95 |
| 155 | 3300009093 | Ga0105240_10356892 | Ga0105240_103568922 | 95 |
| 156 | 3300009094 | Ga0111539_10435561 | Ga0111539_104355612 | 95 |
| 157 | 3300009094 | Ga0111539_10953621 | Ga0111539_109536212 | 95 |
| 158 | 3300009094 | Ga0111539_12245224 | Ga0111539_122452242 | 95 |
| 159 | 3300009098 | Ga0105245_10035188 | Ga0105245_100351882 | 95 |
| 160 | 3300009101 | Ga0105247_10766052 | Ga0105247_107660522 | 95 |
| 161 | 3300009147 | Ga0114129_10281931 | Ga0114129_102819312 | 95 |
| 162 | 3300009148 | Ga0105243_10340774 | Ga0105243_103407742 | 95 |
| 163 | 3300009174 | Ga0105241_10019071 | Ga0105241_100190715 | 95 |
| 164 | 3300009174 | Ga0105241_10033499 | Ga0105241_100334995 | 95 |
| 165 | 3300009174 | Ga0105241_10269414 | Ga0105241_102694143 | 95 |
| 166 | 3300009174 | Ga0105241_10455233 | Ga0105241_104552331 | 95 |
| 167 | 3300009174 | Ga0105241_10680473 | Ga0105241_106804732 | 95 |
| 168 | 3300009174 | Ga0105241_11114745 | Ga0105241_111147452 | 95 |
| 169 | 3300009176 | Ga0105242_10828011 | Ga0105242_108280112 | 95 |
| 170 | 3300009176 | Ga0105242_10878270 | Ga0105242_108782702 | 95 |
| 171 | 3300009177 | Ga0105248_10140985 | Ga0105248_101409855 | 95 |
| 172 | 3300009177 | Ga0105248_10145379 | Ga0105248_101453792 | 95 |
| 173 | 3300009177 | Ga0105248_10245059 | Ga0105248_102450592 | 95 |
| 174 | 3300009177 | Ga0105248_10395810 | Ga0105248_103958103 | 95 |
| 175 | 3300009177 | Ga0105248_11049092 | Ga0105248_110490922 | 95 |
| 176 | 3300009177 | Ga0105248_11770371 | Ga0105248_117703712 | 95 |
| 177 | 3300009545 | Ga0105237_10120724 | Ga0105237_101207242 | 95 |
| 178 | 3300009545 | Ga0105237_10322306 | Ga0105237_103223062 | 95 |
| 179 | 3300009545 | Ga0105237_10950360 | Ga0105237_109503601 | 95 |
| 180 | 3300009545 | Ga0105237_11426848 | Ga0105237_114268482 | 95 |
| 181 | 3300009545 | Ga0105237_11478090 | Ga0105237_114780902 | 95 |
| 182 | 3300009545 | Ga0105237_12740522 | Ga0105237_127405221 | 95 |
| 183 | 3300009551 | Ga0105238_10010551 | Ga0105238_1001055113 | 95 |
| 184 | 3300009551 | Ga0105238_10182410 | Ga0105238_101824104 | 95 |
| 185 | 3300009551 | Ga0105238_10246915 | Ga0105238_102469153 | 95 |
| 186 | 3300009551 | Ga0105238_10553536 | Ga0105238_105535362 | 95 |
| 187 | 3300009551 | Ga0105238_11411165 | Ga0105238_114111652 | 95 |
| 188 | 3300009551 | Ga0105238_12859825 | Ga0105238_128598252 | 95 |
| 189 | 3300009553 | Ga0105249_10127289 | Ga0105249_101272894 | 95 |
| 190 | 3300009553 | Ga0105249_10898846 | Ga0105249_108988462 | 95 |
| 191 | 3300010375 | Ga0105239_10018959 | Ga0105239_1001895913 | 95 |
| 192 | 3300010375 | Ga0105239_10353252 | Ga0105239_103532522 | 95 |
| 193 | 3300010375 | Ga0105239_12116984 | Ga0105239_121169842 | 95 |
| 194 | 3300010375 | Ga0105239_12424120 | Ga0105239_124241202 | 95 |
| 195 | 3300010375 | Ga0105239_13625040 | Ga0105239_136250401 | 95 |
| 196 | 3300011119 | Ga0105246_10059101 | Ga0105246_100591013 | 95 |
| 197 | 3300011119 | Ga0105246_10179461 | Ga0105246_101794613 | 95 |
| 198 | 3300011119 | Ga0105246_12099341 | Ga0105246_120993412 | 95 |
| 199 | 3300013100 | Ga0157373_10151724 | Ga0157373_101517242 | 95 |
| 200 | 3300013100 | Ga0157373_10318742 | Ga0157373_103187422 | 95 |
| 201 | 3300013100 | Ga0157373_10444366 | Ga0157373_104443661 | 95 |
| 202 | 3300013100 | Ga0157373_10539172 | Ga0157373_105391721 | 95 |
| 203 | 3300013100 | Ga0157373_10581839 | Ga0157373_105818392 | 95 |
| 204 | 3300013102 | Ga0157371_11641652 | Ga0157371_116416521 | 95 |
| 205 | 3300013104 | Ga0157370_10006622 | Ga0157370_1000662219 | 95 |
| 206 | 3300013104 | Ga0157370_10008076 | Ga0157370_1000807619 | 95 |
| 207 | 3300013104 | Ga0157370_10192208 | Ga0157370_101922082 | 95 |
| 208 | 3300013105 | Ga0157369_10004351 | Ga0157369_1000435126 | 95 |
| 209 | 3300013105 | Ga0157369_10008438 | Ga0157369_1000843820 | 95 |
| 210 | 3300013105 | Ga0157369_10069033 | Ga0157369_100690335 | 95 |
| 211 | 3300013105 | Ga0157369_10073830 | Ga0157369_100738305 | 95 |
| 212 | 3300013105 | Ga0157369_10099938 | Ga0157369_100999385 | 95 |
| 213 | 3300013105 | Ga0157369_10512462 | Ga0157369_105124622 | 95 |
| 214 | 3300013105 | Ga0157369_10934338 | Ga0157369_109343382 | 95 |
| 215 | 3300013296 | Ga0157374_10285686 | Ga0157374_102856862 | 95 |
| 216 | 3300013296 | Ga0157374_11234446 | Ga0157374_112344462 | 95 |
| 217 | 3300013296 | Ga0157374_12227279 | Ga0157374_122272792 | 95 |
| 218 | 3300013296 | Ga0157374_12722134 | Ga0157374_127221341 | 95 |
| 219 | 3300013297 | Ga0157378_10162304 | Ga0157378_101623041 | 95 |
| 220 | 3300013297 | Ga0157378_10511865 | Ga0157378_105118652 | 95 |
| 221 | 3300013306 | Ga0163162_11160875 | Ga0163162_111608752 | 95 |
| 222 | 3300013306 | Ga0163162_12271444 | Ga0163162_122714443 | 95 |
| 223 | 3300013307 | Ga0157372_10000424 | Ga0157372_1000042453 | 95 |
| 224 | 3300013307 | Ga0157372_10092295 | Ga0157372_100922952 | 95 |
| 225 | 3300013307 | Ga0157372_10124099 | Ga0157372_101240993 | 95 |
| 226 | 3300013307 | Ga0157372_10136299 | Ga0157372_101362994 | 95 |
| 227 | 3300013307 | Ga0157372_10492494 | Ga0157372_104924942 | 95 |
| 228 | 3300013307 | Ga0157372_10552252 | Ga0157372_105522521 | 95 |
| 229 | 3300013307 | Ga0157372_10848801 | Ga0157372_108488012 | 95 |
| 230 | 3300013308 | Ga0157375_10165732 | Ga0157375_101657322 | 95 |
| 231 | 3300013308 | Ga0157375_11245580 | Ga0157375_112455802 | 95 |
| 232 | 3300013308 | Ga0157375_11551984 | Ga0157375_115519842 | 95 |
| 233 | 3300014325 | Ga0163163_10093659 | Ga0163163_100936593 | 95 |
| 234 | 3300014325 | Ga0163163_10142252 | Ga0163163_101422525 | 95 |
| 235 | 3300014325 | Ga0163163_11321162 | Ga0163163_113211622 | 95 |
| 236 | 3300014325 | Ga0163163_11729153 | Ga0163163_117291532 | 95 |
| 237 | 3300014497 | Ga0182008_10061089 | Ga0182008_100610891 | 95 |
| 238 | 3300014969 | Ga0157376_10913440 | Ga0157376_109134402 | 95 |
| 239 | 3300017792 | Ga0163161_10407674 | Ga0163161_104076742 | 95 |
| 240 | 3300020069 | Ga0197907_10629253 | Ga0197907_106292531 | 95 |
| 241 | 3300020069 | Ga0197907_11426004 | Ga0197907_114260041 | 95 |
| 242 | 3300020069 | Ga0197907_11511092 | Ga0197907_115110922 | 95 |
| 243 | 3300020078 | Ga0206352_10081231 | Ga0206352_100812312 | 95 |
| 244 | 3300020078 | Ga0206352_10629975 | Ga0206352_106299752 | 95 |
| 245 | 3300020080 | Ga0206350_10722182 | Ga0206350_107221822 | 95 |
| 246 | 3300020081 | Ga0206354_10031333 | Ga0206354_100313332 | 95 |
| 247 | 3300021358 | Ga0213873_10148009 | Ga0213873_101480092 | 95 |
| 248 | 3300021384 | Ga0213876_10445947 | Ga0213876_104459472 | 95 |
| 249 | 3300022467 | Ga0224712_10203988 | Ga0224712_102039882 | 95 |
| 250 | 3300025321 | Ga0207656_10021069 | Ga0207656_100210692 | 95 |
| 251 | 3300025321 | Ga0207656_10136248 | Ga0207656_101362482 | 95 |
| 252 | 3300025899 | Ga0207642_10077223 | Ga0207642_100772233 | 95 |
| 253 | 3300025900 | Ga0207710_10154007 | Ga0207710_101540072 | 95 |
| 254 | 3300025903 | Ga0207680_11265087 | Ga0207680_112650872 | 95 |
| 255 | 3300025904 | Ga0207647_10510618 | Ga0207647_105106182 | 95 |
| 256 | 3300025905 | Ga0207685_10592033 | Ga0207685_105920332 | 95 |
| 257 | 3300025906 | Ga0207699_10115363 | Ga0207699_101153632 | 95 |
| 258 | 3300025906 | Ga0207699_10701868 | Ga0207699_107018682 | 95 |
| 259 | 3300025907 | Ga0207645_10500873 | Ga0207645_105008732 | 95 |
| 260 | 3300025907 | Ga0207645_10735376 | Ga0207645_107353762 | 95 |
| 261 | 3300025909 | Ga0207705_10110797 | Ga0207705_101107972 | 95 |
| 262 | 3300025909 | Ga0207705_10247022 | Ga0207705_102470223 | 95 |
| 263 | 3300025909 | Ga0207705_10532240 | Ga0207705_105322402 | 95 |
| 264 | 3300025911 | Ga0207654_10001818 | Ga0207654_100018185 | 95 |
| 265 | 3300025911 | Ga0207654_10016146 | Ga0207654_100161465 | 95 |
| 266 | 3300025911 | Ga0207654_10023979 | Ga0207654_100239792 | 95 |
| 267 | 3300025911 | Ga0207654_10314553 | Ga0207654_103145532 | 95 |
| 268 | 3300025911 | Ga0207654_10989430 | Ga0207654_109894302 | 95 |
| 269 | 3300025912 | Ga0207707_10560064 | Ga0207707_105600642 | 95 |
| 270 | 3300025913 | Ga0207695_10000379 | Ga0207695_1000037995 | 95 |
| 271 | 3300025913 | Ga0207695_10003215 | Ga0207695_100032155 | 95 |
| 272 | 3300025913 | Ga0207695_10113892 | Ga0207695_101138925 | 95 |
| 273 | 3300025913 | Ga0207695_10274140 | Ga0207695_102741403 | 95 |
| 274 | 3300025914 | Ga0207671_10000503 | Ga0207671_1000050329 | 95 |
| 275 | 3300025914 | Ga0207671_10186363 | Ga0207671_101863632 | 95 |
| 276 | 3300025914 | Ga0207671_10633766 | Ga0207671_106337661 | 95 |
| 277 | 3300025914 | Ga0207671_10776696 | Ga0207671_107766962 | 95 |
| 278 | 3300025914 | Ga0207671_11338872 | Ga0207671_113388722 | 95 |
| 279 | 3300025916 | Ga0207663_10042911 | Ga0207663_100429115 | 95 |
| 280 | 3300025916 | Ga0207663_10389117 | Ga0207663_103891172 | 95 |
| 281 | 3300025916 | Ga0207663_11166765 | Ga0207663_111667652 | 95 |
| 282 | 3300025917 | Ga0207660_10009654 | Ga0207660_100096545 | 95 |
| 283 | 3300025918 | Ga0207662_10949465 | Ga0207662_109494652 | 95 |
| 284 | 3300025919 | Ga0207657_10171546 | Ga0207657_101715462 | 95 |
| 285 | 3300025919 | Ga0207657_10494097 | Ga0207657_104940971 | 95 |
| 286 | 3300025919 | Ga0207657_10641450 | Ga0207657_106414502 | 95 |
| 287 | 3300025920 | Ga0207649_10007836 | Ga0207649_100078365 | 95 |
| 288 | 3300025920 | Ga0207649_10168565 | Ga0207649_101685652 | 95 |
| 289 | 3300025921 | Ga0207652_10176277 | Ga0207652_101762774 | 95 |
| 290 | 3300025921 | Ga0207652_11308553 | Ga0207652_113085532 | 95 |
| 291 | 3300025924 | Ga0207694_10001290 | Ga0207694_100012905 | 95 |
| 292 | 3300025924 | Ga0207694_10126612 | Ga0207694_101266123 | 95 |
| 293 | 3300025924 | Ga0207694_10205170 | Ga0207694_102051702 | 95 |
| 294 | 3300025927 | Ga0207687_10005635 | Ga0207687_100056353 | 95 |
| 295 | 3300025928 | Ga0207700_10163874 | Ga0207700_101638744 | 95 |
| 296 | 3300025928 | Ga0207700_11637077 | Ga0207700_116370772 | 95 |
| 297 | 3300025928 | Ga0207700_11637542 | Ga0207700_116375422 | 95 |
| 298 | 3300025929 | Ga0207664_10132452 | Ga0207664_101324523 | 95 |
| 299 | 3300025929 | Ga0207664_10132724 | Ga0207664_101327242 | 95 |
| 300 | 3300025931 | Ga0207644_10159342 | Ga0207644_101593424 | 95 |
| 301 | 3300025932 | Ga0207690_10128235 | Ga0207690_101282352 | 95 |
| 302 | 3300025932 | Ga0207690_10539238 | Ga0207690_105392382 | 95 |
| 303 | 3300025934 | Ga0207686_10514957 | Ga0207686_105149572 | 95 |
| 304 | 3300025934 | Ga0207686_10942265 | Ga0207686_109422652 | 95 |
| 305 | 3300025935 | Ga0207709_10350679 | Ga0207709_103506792 | 95 |
| 306 | 3300025936 | Ga0207670_10189237 | Ga0207670_101892372 | 95 |
| 307 | 3300025936 | Ga0207670_11308966 | Ga0207670_113089662 | 95 |
| 308 | 3300025936 | Ga0207670_11443091 | Ga0207670_114430911 | 95 |
| 309 | 3300025937 | Ga0207669_10439020 | Ga0207669_104390202 | 95 |
| 310 | 3300025938 | Ga0207704_10063299 | Ga0207704_100632993 | 95 |
| 311 | 3300025938 | Ga0207704_10446793 | Ga0207704_104467932 | 95 |
| 312 | 3300025938 | Ga0207704_11369377 | Ga0207704_113693772 | 95 |
| 313 | 3300025940 | Ga0207691_11502131 | Ga0207691_115021312 | 95 |
| 314 | 3300025941 | Ga0207711_10049984 | Ga0207711_100499845 | 95 |
| 315 | 3300025941 | Ga0207711_10100024 | Ga0207711_101000242 | 95 |
| 316 | 3300025941 | Ga0207711_10341013 | Ga0207711_103410133 | 95 |
| 317 | 3300025941 | Ga0207711_10432313 | Ga0207711_104323132 | 95 |
| 318 | 3300025941 | Ga0207711_11283789 | Ga0207711_112837892 | 95 |
| 319 | 3300025944 | Ga0207661_10204260 | Ga0207661_102042602 | 95 |
| 320 | 3300025944 | Ga0207661_10342388 | Ga0207661_103423883 | 95 |
| 321 | 3300025945 | Ga0207679_10131379 | Ga0207679_101313792 | 95 |
| 322 | 3300025945 | Ga0207679_10183582 | Ga0207679_101835823 | 95 |
| 323 | 3300025945 | Ga0207679_11081303 | Ga0207679_110813032 | 95 |
| 324 | 3300025945 | Ga0207679_11640738 | Ga0207679_116407382 | 95 |
| 325 | 3300025949 | Ga0207667_10006951 | Ga0207667_100069514 | 95 |
| 326 | 3300025949 | Ga0207667_10008805 | Ga0207667_1000880519 | 95 |
| 327 | 3300025949 | Ga0207667_10044956 | Ga0207667_100449567 | 95 |
| 328 | 3300025949 | Ga0207667_10075240 | Ga0207667_100752405 | 95 |
| 329 | 3300025949 | Ga0207667_10158603 | Ga0207667_101586031 | 95 |
| 330 | 3300025949 | Ga0207667_10258025 | Ga0207667_102580253 | 95 |
| 331 | 3300025949 | Ga0207667_10516793 | Ga0207667_105167932 | 95 |
| 332 | 3300025949 | Ga0207667_11855631 | Ga0207667_118556312 | 95 |
| 333 | 3300025960 | Ga0207651_10072464 | Ga0207651_100724645 | 95 |
| 334 | 3300025960 | Ga0207651_10438639 | Ga0207651_104386392 | 95 |
| 335 | 3300025981 | Ga0207640_10592570 | Ga0207640_105925702 | 95 |
| 336 | 3300025981 | Ga0207640_10759592 | Ga0207640_107595922 | 95 |
| 337 | 3300025981 | Ga0207640_11240273 | Ga0207640_112402732 | 95 |
| 338 | 3300025986 | Ga0207658_11900063 | Ga0207658_119000631 | 95 |
| 339 | 3300026023 | Ga0207677_10522312 | Ga0207677_105223122 | 95 |
| 340 | 3300026035 | Ga0207703_10293427 | Ga0207703_102934272 | 95 |
| 341 | 3300026035 | Ga0207703_10344238 | Ga0207703_103442382 | 95 |
| 342 | 3300026041 | Ga0207639_10000868 | Ga0207639_1000086831 | 95 |
| 343 | 3300026041 | Ga0207639_10241593 | Ga0207639_102415932 | 95 |
| 344 | 3300026041 | Ga0207639_10528640 | Ga0207639_105286402 | 95 |
| 345 | 3300026075 | Ga0207708_11809269 | Ga0207708_118092691 | 95 |
| 346 | 3300026078 | Ga0207702_10001589 | Ga0207702_1000158932 | 95 |
| 347 | 3300026078 | Ga0207702_10073915 | Ga0207702_100739153 | 95 |
| 348 | 3300026078 | Ga0207702_10244880 | Ga0207702_102448802 | 95 |
| 349 | 3300026078 | Ga0207702_12041154 | Ga0207702_120411542 | 95 |
| 350 | 3300026088 | Ga0207641_10912562 | Ga0207641_109125621 | 95 |
| 351 | 3300026089 | Ga0207648_10111966 | Ga0207648_101119665 | 95 |
| 352 | 3300026089 | Ga0207648_10165067 | Ga0207648_101650675 | 95 |
| 353 | 3300026095 | Ga0207676_10162211 | Ga0207676_101622112 | 95 |
| 354 | 3300026095 | Ga0207676_10710020 | Ga0207676_107100202 | 95 |
| 355 | 3300026095 | Ga0207676_12352181 | Ga0207676_123521812 | 95 |
| 356 | 3300026116 | Ga0207674_10097677 | Ga0207674_100976772 | 95 |
| 357 | 3300026116 | Ga0207674_10125804 | Ga0207674_101258045 | 95 |
| 358 | 3300026118 | Ga0207675_100467402 | Ga0207675_1004674021 | 95 |
| 359 | 3300026121 | Ga0207683_10438507 | Ga0207683_104385072 | 95 |
| 360 | 3300026142 | Ga0207698_10000039 | Ga0207698_100000395 | 95 |
| 361 | 3300026142 | Ga0207698_10000059 | Ga0207698_1000005962 | 95 |
| 362 | 3300026142 | Ga0207698_10069757 | Ga0207698_100697575 | 95 |
| 363 | 3300026142 | Ga0207698_10085167 | Ga0207698_100851672 | 95 |
| 364 | 3300026142 | Ga0207698_11854078 | Ga0207698_118540782 | 95 |
| 365 | 3300028379 | Ga0268266_11265523 | Ga0268266_112655232 | 95 |
| 366 | 3300028381 | Ga0268264_10567935 | Ga0268264_105679352 | 95 |
| 367 | 3300028381 | Ga0268264_10943841 | Ga0268264_109438412 | 95 |
| 368 | 3300028666 | Ga0265336_10066187 | Ga0265336_100661872 | 95 |
| 369 | 3300028800 | Ga0265338_10026446 | Ga0265338_100264465 | 95 |
| 370 | 3300029957 | Ga0265324_10005069 | Ga0265324_100050697 | 95 |
| 371 | 3300030878 | Ga0265770_1067326 | Ga0265770_10673262 | 95 |
| 372 | 3300031090 | Ga0265760_10165140 | Ga0265760_101651402 | 95 |
| 373 | 3300031238 | Ga0265332_10024511 | Ga0265332_100245112 | 95 |
| 374 | 3300031239 | Ga0265328_10127802 | Ga0265328_101278022 | 95 |
| 375 | 3300031240 | Ga0265320_10009193 | Ga0265320_100091939 | 95 |
| 376 | 3300031241 | Ga0265325_10023327 | Ga0265325_100233272 | 95 |
| 377 | 3300031241 | Ga0265325_10217872 | Ga0265325_102178722 | 95 |
| 378 | 3300031242 | Ga0265329_10025218 | Ga0265329_100252182 | 95 |
| 379 | 3300031247 | Ga0265340_10019656 | Ga0265340_100196565 | 95 |
| 380 | 3300031249 | Ga0265339_10024306 | Ga0265339_100243065 | 95 |
| 381 | 3300031250 | Ga0265331_10001121 | Ga0265331_100011219 | 95 |
| 382 | 3300031250 | Ga0265331_10059193 | Ga0265331_100591933 | 95 |
| 383 | 3300031250 | Ga0265331_10323112 | Ga0265331_103231122 | 95 |
| 384 | 3300031344 | Ga0265316_10045658 | Ga0265316_100456585 | 95 |
| 385 | 3300031344 | Ga0265316_10088121 | Ga0265316_100881213 | 95 |
| 386 | 3300031344 | Ga0265316_10264301 | Ga0265316_102643012 | 95 |
| 387 | 3300031344 | Ga0265316_10327281 | Ga0265316_103272812 | 95 |
| 388 | 3300031344 | Ga0265316_10348099 | Ga0265316_103480993 | 95 |
| 389 | 3300031344 | Ga0265316_10393610 | Ga0265316_103936102 | 95 |
| 390 | 3300031344 | Ga0265316_10949812 | Ga0265316_109498122 | 95 |
| 391 | 3300031711 | Ga0265314_10037033 | Ga0265314_100370332 | 95 |
| 392 | 3300031711 | Ga0265314_10183632 | Ga0265314_101836322 | 95 |
| 393 | 3300031712 | Ga0265342_10193629 | Ga0265342_101936292 | 95 |
| 394 | 3300031712 | Ga0265342_10336475 | Ga0265342_103364751 | 95 |
| 395 | 3300031911 | Ga0307412_11766458 | Ga0307412_117664582 | 95 |
| 396 | 3300032002 | Ga0307416_102604910 | Ga0307416_1026049102 | 95 |
| 397 | 3300032120 | Ga0316053_107793 | Ga0316053_1077932 | 95 |
| 398 | 3300032133 | Ga0316583_10238438 | Ga0316583_102384382 | 95 |
| 399 | 3300035117 | Ga0373953_0039547 | Ga0373953_0039547_342_632 | 95 |
| 400 | 3300035118 | Ga0373954_0004404 | Ga0373954_0004404_4906_5196 | 95 |
| 401 | 3300035118 | Ga0373954_0032814 | Ga0373954_0032814_860_1150 | 95 |
| 402 | 3300035120 | Ga0373957_0348173 | Ga0373957_0348173_10_300 | 95 |
| 403 | 3300035172 | Ga0373955_0034008 | Ga0373955_0034008_1478_1768 | 95 |
| 404 | 3300035172 | Ga0373955_0102378 | Ga0373955_0102378_964_1254 | 95 |
| 405 | 3300035695 | Ga0373927_0063287 | Ga0373927_0063287_1572_1859 | 95 |
| 406 | 3300035724 | Ga0373933_0107041 | Ga0373933_0107041_766_1056 | 95 |
| 407 | 3300035724 | Ga0373933_0323120 | Ga0373933_0323120_683_973 | 95 |
| 408 | 3300035725 | Ga0373947_0681495 | Ga0373947_0681495_395_682 | 95 |
| 409 | 3300036401 | Ga0373937_0018076 | Ga0373937_0018076_4986_5276 | 95 |
| 410 | 3300036401 | Ga0373937_0390865 | Ga0373937_0390865_819_1109 | 95 |
| 411 | 3300036401 | Ga0373937_0868369 | Ga0373937_0868369_180_470 | 95 |
| 412 | 3300036457 | Ga0265778_002900 | Ga0265778_002900_1196_1483 | 95 |
| 413 | 3300036457 | Ga0265778_011645 | Ga0265778_011645_222_512 | 95 |
| 414 | 3300037068 | Ga0373925_0100983 | Ga0373925_0100983_262_552 | 95 |
| 415 | 3300037068 | Ga0373925_0795072 | Ga0373925_0795072_175_462 | 95 |
| 416 | 3300037068 | Ga0373925_1042202 | Ga0373925_1042202_54_347 | 95 |
| 417 | 3300037418 | Ga0395900_0566214 | Ga0395900_0566214_714_1004 | 95 |
| 418 | 3300037466 | Ga0395898_0117406 | Ga0395898_0117406_1892_2182 | 95 |
| 419 | 3300037853 | Ga0436364_1078028 | Ga0436364_1078028_214_504 | 95 |
| 420 | 3300039437 | Ga0436365_0408821 | Ga0436365_0408821_914_1201 | 95 |
| 421 | 3300039437 | Ga0436365_1191518 | Ga0436365_1191518_1849_2136 | 95 |
| 422 | 3300039438 | Ga0436360_0261959 | Ga0436360_0261959_510_800 | 95 |
| 423 | 3300039450 | Ga0436363_0439753 | Ga0436363_0439753_511_801 | 95 |
| 424 | 3300039450 | Ga0436363_1703451 | Ga0436363_1703451_39_326 | 95 |
| 425 | 3300039453 | Ga0436362_0001488 | Ga0436362_0001488_285_572 | 95 |
| 426 | 3300042876 | Ga0451577_0173522 | Ga0451577_0173522_442_735 | 95 |
| 427 | 3300042876 | Ga0451577_1684531 | Ga0451577_1684531_255_542 | 95 |
| 428 | 3300044673 | Ga0453683_1042374 | Ga0453683_1042374_153_443 | 95 |
| 429 | 3300044673 | Ga0453683_1223051 | Ga0453683_1223051_195_482 | 95 |
| 430 | 3300044684 | Ga0466966_0565567 | Ga0466966_0565567_243_533 | 95 |
| 431 | 3300044694 | Ga0466963_0003181 | Ga0466963_0003181_2898_3191 | 95 |
| 432 | 3300044712 | Ga0453684_0195532 | Ga0453684_0195532_718_1005 | 95 |
| 433 | 3300044712 | Ga0453684_1049584 | Ga0453684_1049584_442_735 | 95 |
| 434 | 3300044719 | Ga0466971_0174310 | Ga0466971_0174310_293_583 | 95 |
| 435 | 3300044719 | Ga0466971_0203686 | Ga0466971_0203686_387_677 | 95 |
| 436 | 3300044842 | Ga0466957_0476619 | Ga0466957_0476619_269_559 | 95 |
| 437 | 3300045836 | Ga0466958_0456218 | Ga0466958_0456218_510_800 | 95 |
| 438 | 3300045976 | Ga0466967_0048703 | Ga0466967_0048703_1224_1517 | 95 |
| 439 | 3300045976 | Ga0466967_0220020 | Ga0466967_0220020_210_500 | 95 |
| 440 | 3300045976 | Ga0466967_0652124 | Ga0466967_0652124_738_1031 | 95 |
| 441 | 3300045976 | Ga0466967_1113497 | Ga0466967_1113497_325_618 | 95 |
| 442 | 3300046463 | Ga0495653_0843228 | Ga0495653_0843228_38_325 | 95 |
| 443 | 3300046472 | Ga0495580_0069834 | Ga0495580_0069834_2128_2415 | 95 |
| 444 | 3300046472 | Ga0495580_0552097 | Ga0495580_0552097_209_499 | 95 |
| 445 | 3300046472 | Ga0495580_0562032 | Ga0495580_0562032_316_606 | 95 |
| 446 | 3300046477 | Ga0495664_0577150 | Ga0495664_0577150_231_521 | 95 |
| 447 | 3300046511 | Ga0495608_0352040 | Ga0495608_0352040_20_310 | 95 |
| 448 | 3300046516 | Ga0495628_0489551 | Ga0495628_0489551_15_305 | 95 |
| 449 | 3300046529 | Ga0495652_0147554 | Ga0495652_0147554_694_984 | 95 |
| 450 | 3300046533 | Ga0495640_0846172 | Ga0495640_0846172_79_366 | 95 |
| 451 | 3300046559 | Ga0495667_0560841 | Ga0495667_0560841_414_701 | 95 |
| 452 | 3300046679 | Ga0495623_0229833 | Ga0495623_0229833_267_557 | 95 |
| 453 | 3300046684 | Ga0495669_0416619 | Ga0495669_0416619_338_628 | 95 |
| 454 | 3300046809 | Ga0495600_0404426 | Ga0495600_0404426_446_736 | 95 |
| 455 | 3300047317 | Ga0495604_0302389 | Ga0495604_0302389_415_705 | 95 |
| 456 | 3300047319 | Ga0495674_0147668 | Ga0495674_0147668_184_474 | 95 |
| 457 | 3300047319 | Ga0495674_1223168 | Ga0495674_1223168_76_366 | 95 |
| 458 | 3300047322 | Ga0495680_0871283 | Ga0495680_0871283_199_489 | 95 |
| 459 | 3300047444 | Ga0495675_0039213 | Ga0495675_0039213_267_554 | 95 |
| 460 | 3300047471 | Ga0495684_0089557 | Ga0495684_0089557_475_765 | 95 |
| 461 | 3300047471 | Ga0495684_0152542 | Ga0495684_0152542_1160_1450 | 95 |
| 462 | 3300047471 | Ga0495684_0969131 | Ga0495684_0969131_68_355 | 95 |
| 463 | 3300048088 | Ga0495602_0307814 | Ga0495602_0307814_76_363 | 95 |
| 464 | 3300048905 | Ga0496102_0341167 | Ga0496102_0341167_1028_1318 | 95 |
| 465 | 3300048907 | Ga0496104_1484708 | Ga0496104_1484708_202_492 | 95 |
| 466 | 3300048909 | Ga0496106_0942327 | Ga0496106_0942327_314_604 | 95 |
| 467 | 3300049586 | Ga0501070_0020844 | Ga0501070_0020844_607_900 | 95 |
| 468 | 3300049588 | Ga0501072_0941625 | Ga0501072_0941625_350_640 | 95 |
| 469 | 3300050507 | nmdc:mga05p37_1553080_c1 | nmdc:mga05p37_1553080_c1_265_552 | 95 |
| 470 | 3300050508 | nmdc:mga09592_1166991_c1 | nmdc:mga09592_1166991_c1_106_393 | 95 |
| 471 | 3300050509 | nmdc:mga0qj67_1304805_c1 | nmdc:mga0qj67_1304805_c1_154_441 | 95 |
| 472 | 3300050509 | nmdc:mga0qj67_132733_c1 | nmdc:mga0qj67_132733_c1_1071_1361 | 95 |
| 473 | 3300050510 | nmdc:mga06r32_10773_c1 | nmdc:mga06r32_10773_c1_1834_2121 | 95 |
| 474 | 3300050511 | nmdc:mga08y16_1620439_c1 | nmdc:mga08y16_1620439_c1_244_531 | 95 |
| 475 | 3300050511 | nmdc:mga08y16_571405_c1 | nmdc:mga08y16_571405_c1_159_446 | 95 |
| 476 | 3300053084 | Ga0495595_0118603 | Ga0495595_0118603_760_1050 | 95 |
| 477 | 3300053085 | Ga0495619_0318175 | Ga0495619_0318175_589_879 | 95 |
| 478 | 3300053085 | Ga0495619_0960435 | Ga0495619_0960435_34_324 | 95 |
| 479 | 3300059507 | Ga0587086_020241 | Ga0587086_020241_13_306 | 95 |
| 480 | 3300059644 | Ga0587075_012377 | Ga0587075_012377_470_763 | 95 |
| 481 | 3300059655 | Ga0587114_122396 | Ga0587114_122396_67_360 | 95 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v8p-assembly4.cif.gz_GR | t.thermophila 60s ribosomal subunit in complex with initiation factor 6. | 0.9138 | 1 | 89 |
| 6zu5-assembly1.cif.gz_LX0 | structure of the paranosema locustae ribosome in complex with lso2 | 0.9131 | 3 | 86 |
| 6fu8-assembly1.cif.gz_C | ul23 beta hairpin loop deletion of e.coli ribosome | 0.9072 | 3 | 88 |
| 7r72-assembly1.cif.gz_X | state e1 nucleolar 60s ribosome biogenesis intermediate - spb4 local model | 0.9063 | 3 | 87 |
| 8b2l-assembly1.cif.gz_k3 | cryo-em structure of the plant 80s ribosome | 0.906 | 1 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZFK7_36_158_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9343 | 1 | 87 | 3.30.70.330 |
| 4a1aR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9141 | 1 | 89 | 3.30.70.330 |
| 6fu8C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9072 | 3 | 88 | 3.30.70.330 |
| 1w2bR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.903 | 5 | 89 | 3.30.70.330 |
| af_E9AG68_26_145_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.902 | 3 | 87 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-L2GX17-F1-model_v4 | 50S ribosomal protein L23 | 0.9222 | 3 | 86 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A497EJ14-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9131 | 1 | 87 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A4W2IFM3-F1-model_v4 | Large ribosomal subunit protein uL23 N-terminal domain-containing protein | 0.9122 | 1 | 84 |
GO:0003735
GO:0006412 GO:0019843 GO:0044391 |
| AF-A0A667HP71-F1-model_v4 | Ribosomal protein L23/L25 N-terminal domain-containing protein | 0.9118 | 1 | 84 |
GO:0003735
GO:0006412 GO:0044391 |
| AF-A6R098-F1-model_v4 | Ribosomal protein L23a | 0.9104 | 1 | 88 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar