F452364

General Info

Members Datasets Scaffolds Average Seq Length
481 273 963 320

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100009513|Ga0070659_1000095139
Length 388
Sequence MHTVVVHIDKNVIVSCDLVFRIGTRFQTSARYFSRDTARSVGQYSLTTNQPQLEVNGDMRQVSNLWTKRSFAGLSTCCLVVAALALVAVLAAPAQAQDNKMTPIATPAQPNAIEIGTGPLPDAKNPESWHSQYGSKFARNVTVATLTPFLPDPTKASGAAVVVAPGGGFRTLSMENEGWNVARALAEKGVAAFVLKYRLNQTPADMPGFEQSMREMFSGTARPPRPDPEKAMAGLAPQIADARAAFALIRKRAAEWHVDPNRIGMVGFSAGAMLTMATTLAGEDAKPAFIGNIYGPLAPLTVPADAPPLFIALAADDPFFANGGYGLIDSWKAAKHPVEFHLYEQGGHGFGMYPKETTSTGWFEAFVRWIGMHGMLKPPASGSGGAAN

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
216 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
243 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
249 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
250 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
255 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
256 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
257 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
258 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
259 2643221642 Caulobacter sp. Root343 Isolate Unclassified
260 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
261 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
262 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
263 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
264 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
265 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
266 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
267 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
268 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
269 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
270 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
271 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
272 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
273 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.84
Metatranscriptomes 0
Isolates 4.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.83
Bulb 0
Endosphere 8.73
Nodule 0
Rhizoplane 3.74
Rhizosphere 82.54
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100009513 3300005366 Bacteria 7140
2 JGI24737J22298_10008882 3300001990 Bacteria 3354
3 JGI24735J21928_10017258 3300002067 Bacteria 2233
4 JGI25406J46586_10004109 3300003203 Bacteria 6801
5 JGI25165J46597_1000120 3300003214 Bacteria 136275
6 JGI25153J46596_10001019 3300003215 Bacteria 17024
7 rootH2_10056391 3300003320 Bacteria 11934
8 rootH1_10007730 3300003316 Bacteria 2158
9 rootH1_10007730 3300003323 Bacteria 11381
10 Ga0055542_1008800 3300003762 Bacteria 1949
11 Ga0055529_1000068 3300003763 Bacteria 163911
12 Ga0055537_1000488 3300003773 Bacteria 24384
13 Ga0055524_1000095 3300003775 Bacteria 109223
14 Ga0055536_1000379 3300003781 Bacteria 32677
15 Ga0055528_1002530 3300003790 Bacteria 9735
16 Ga0055530_10009361 3300003791 Bacteria 3774
17 Ga0055530_10011078 3300003791 Bacteria 3270
18 Ga0055531_10000560 3300003794 Bacteria 32677
19 Ga0055531_10007451 3300003794 Bacteria 5971
20 Ga0065165_1000840 3300005262 Bacteria 40310
21 Ga0065165_1002885 3300005262 Bacteria 13219
22 Ga0065165_1005700 3300005262 Bacteria 6854
23 Ga0065712_10072716 3300005290 Bacteria 4641
24 Ga0065715_10111295 3300005293 Bacteria 2580
25 Ga0070658_10000013 3300005327 Bacteria 267776
26 Ga0070658_10000734 3300005327 Bacteria 28171
27 Ga0070658_10165864 3300005327 Bacteria 1854
28 Ga0070676_10011018 3300005328 Bacteria 4913
29 Ga0070676_10153346 3300005328 Bacteria 1477
30 Ga0070690_100001641 3300005330 Bacteria 11763
31 Ga0070690_100011164 3300005330 Bacteria 5248
32 Ga0070670_100001022 3300005331 Bacteria 22109
33 Ga0070670_100291914 3300005331 Bacteria 1425
34 Ga0068869_100000655 3300005334 Bacteria 19610
35 Ga0070666_10023221 3300005335 Bacteria 4036
36 Ga0070666_10085003 3300005335 Bacteria 2166
37 Ga0070666_10099997 3300005335 Bacteria 1997
38 Ga0070680_100040989 3300005336 Bacteria 3753
39 Ga0068868_100000025 3300005338 Bacteria 82086
40 Ga0068868_100044910 3300005338 Bacteria 3456
41 Ga0068868_100045315 3300005338 Bacteria 3440
42 Ga0068868_100318508 3300005338 Bacteria 1324
43 Ga0070660_100000888 3300005339 Bacteria 19990
44 Ga0070660_100004197 3300005339 Bacteria 9950
45 Ga0070660_100043986 3300005339 Bacteria 3413
46 Ga0070689_100155280 3300005340 Bacteria 1847
47 Ga0070687_100076446 3300005343 Bacteria 1813
48 Ga0070687_100078462 3300005343 Bacteria 1795
49 Ga0070661_100013638 3300005344 Bacteria 5707
50 Ga0070661_100094129 3300005344 Bacteria 2220
51 Ga0070661_100202611 3300005344 Bacteria 1517
52 Ga0070669_100017299 3300005353 Bacteria 5143
53 Ga0070669_100025370 3300005353 Bacteria 4257
54 Ga0070669_100084425 3300005353 Bacteria 2369
55 Ga0070675_100000925 3300005354 Bacteria 20897
56 Ga0070675_100165130 3300005354 Bacteria 1907
57 Ga0070671_100001039 3300005355 Bacteria 20441
58 Ga0070671_100318883 3300005355 Bacteria 1324
59 Ga0070674_100032237 3300005356 Bacteria 3478
60 Ga0070673_100000016 3300005364 Bacteria 114927
61 Ga0070673_100001707 3300005364 Bacteria 13050
62 Ga0070673_100034457 3300005364 Bacteria 3832
63 Ga0070688_100135175 3300005365 Bacteria 1668
64 Ga0070659_100011148 3300005366 Bacteria 6640
65 Ga0070659_100028786 3300005366 Bacteria 4292
66 Ga0070659_100184379 3300005366 Bacteria 1713
67 Ga0070667_100061776 3300005367 Bacteria 3172
68 Ga0070714_100019094 3300005435 Bacteria 5579
69 Ga0070714_100277689 3300005435 Bacteria 1555
70 Ga0070701_10028617 3300005438 Bacteria 2740
71 Ga0070711_100097786 3300005439 Bacteria 2129
72 Ga0070694_100001287 3300005444 Bacteria 14572
73 Ga0070663_100000572 3300005455 Bacteria 19682
74 Ga0070663_100030580 3300005455 Bacteria 3692
75 Ga0070678_100002092 3300005456 Bacteria 10822
76 Ga0070678_100070387 3300005456 Bacteria 2615
77 Ga0070662_100035107 3300005457 Bacteria 3539
78 Ga0070662_100036785 3300005457 Bacteria 3466
79 Ga0070662_100111639 3300005457 Bacteria 2083
80 Ga0070681_10008869 3300005458 Bacteria 9881
81 Ga0068867_100000299 3300005459 Bacteria 32625
82 Ga0068867_100018326 3300005459 Bacteria 4976
83 Ga0070679_100157760 3300005530 Bacteria 2244
84 Ga0068853_100022796 3300005539 Bacteria 5233
85 Ga0068853_100087520 3300005539 Bacteria 2734
86 Ga0068853_100135534 3300005539 Bacteria 2207
87 Ga0070672_100000571 3300005543 Bacteria 21614
88 Ga0070672_100045039 3300005543 Bacteria 3410
89 Ga0070672_100124758 3300005543 Bacteria 2111
90 Ga0070695_100302992 3300005545 Unclassified 1182
91 Ga0070665_100054088 3300005548 Bacteria 4026
92 Ga0068855_100001290 3300005563 Bacteria 31069
93 Ga0068855_100009554 3300005563 Bacteria 11712
94 Ga0070664_100025677 3300005564 Bacteria 4885
95 Ga0070664_100035410 3300005564 Bacteria 4191
96 Ga0070664_100222953 3300005564 Bacteria 1687
97 Ga0070664_100280478 3300005564 Bacteria 1502
98 Ga0068857_100005243 3300005577 Bacteria 11035
99 Ga0068857_100046973 3300005577 Bacteria 3832
100 Ga0068854_100026880 3300005578 Bacteria 3959
101 Ga0068854_100057892 3300005578 Bacteria 2796
102 Ga0068854_100102813 3300005578 Bacteria 2144
103 Ga0068854_100412887 3300005578 Bacteria 1119
104 Ga0068856_100002933 3300005614 Bacteria 17472
105 Ga0068856_100026258 3300005614 Bacteria 5679
106 Ga0068856_100091891 3300005614 Bacteria 3019
107 Ga0068852_100056659 3300005616 Bacteria 3388
108 Ga0068852_100133802 3300005616 Unclassified 2286
109 Ga0068852_100306172 3300005616 Bacteria 1539
110 Ga0068859_100009808 3300005617 Bacteria 9671
111 Ga0068859_100035981 3300005617 Bacteria 4968
112 Ga0068859_100050186 3300005617 Bacteria 4191
113 Ga0068864_100030745 3300005618 Bacteria 4553
114 Ga0068864_100090763 3300005618 Bacteria 2694
115 Ga0068864_100138745 3300005618 Bacteria 2191
116 Ga0068866_10003217 3300005718 Bacteria 6736
117 Ga0068866_10040172 3300005718 Bacteria 2314
118 Ga0068861_100093255 3300005719 Bacteria 2380
119 Ga0068861_100393129 3300005719 Bacteria 1228
120 Ga0068851_10000356 3300005834 Bacteria 20687
121 Ga0068851_10043143 3300005834 Bacteria 2272
122 Ga0068863_100048009 3300005841 Bacteria 4048
123 Ga0068863_100386428 3300005841 Bacteria 1367
124 Ga0068858_100040666 3300005842 Bacteria 4312
125 Ga0068858_100042945 3300005842 Bacteria 4192
126 Ga0068858_100255061 3300005842 Bacteria 1666
127 Ga0068860_100046349 3300005843 Bacteria 4145
128 Ga0068860_100079374 3300005843 Bacteria 3120
129 Ga0068862_100049996 3300005844 Bacteria 3572
130 Ga0068862_100052122 3300005844 Bacteria 3500
131 Ga0081539_10003170 3300005985 Bacteria 20838
132 Ga0081539_10027851 3300005985 Bacteria 3569
133 Ga0081539_10039290 3300005985 Bacteria 2795
134 Ga0070716_100063790 3300006173 Unclassified 2140
135 Ga0070712_100450048 3300006175 Bacteria 1072
136 Ga0097621_100000367 3300006237 Bacteria 31296
137 Ga0097621_100006959 3300006237 Bacteria 8053
138 Ga0097621_100046372 3300006237 Bacteria 3516
139 Ga0097621_100259326 3300006237 Bacteria 1524
140 Ga0068871_100000479 3300006358 Bacteria 27366
141 Ga0068871_100002343 3300006358 Bacteria 12903
142 Ga0068871_100351726 3300006358 Bacteria 1303
143 Ga0075433_10221019 3300006852 Bacteria 1682
144 Ga0075429_100040112 3300006880 Bacteria 4075
145 Ga0068865_100000026 3300006881 Bacteria 93349
146 Ga0068865_100004123 3300006881 Bacteria 8738
147 Ga0097620_100009808 3300006931 Bacteria 9671
148 Ga0097620_100035978 3300006931 Bacteria 4968
149 Ga0097620_100050187 3300006931 Bacteria 4191
150 Ga0105244_10132662 3300009036 Bacteria 1202
151 Ga0105240_10028301 3300009093 Bacteria 7321
152 Ga0105240_10031815 3300009093 Bacteria 6836
153 Ga0105240_10043192 3300009093 Bacteria 5738
154 Ga0111539_10322898 3300009094 Bacteria 1796
155 Ga0111539_10546648 3300009094 Bacteria 1349
156 Ga0105245_10000078 3300009098 Bacteria 100583
157 Ga0105245_10088225 3300009098 Bacteria 2848
158 Ga0105245_10114809 3300009098 Bacteria 2508
159 Ga0105245_10280750 3300009098 Bacteria 1627
160 Ga0105243_10001224 3300009148 Bacteria 23118
161 Ga0105243_10016028 3300009148 Bacteria 5670
162 Ga0105241_10013272 3300009174 Bacteria 6038
163 Ga0105241_10087190 3300009174 Bacteria 2456
164 Ga0105241_10165217 3300009174 Bacteria 1823
165 Ga0105242_10006070 3300009176 Bacteria 9314
166 Ga0105242_10019056 3300009176 Bacteria 5375
167 Ga0105237_10029531 3300009545 Bacteria 5572
168 Ga0105238_10007923 3300009551 Bacteria 10631
169 Ga0105249_10011695 3300009553 Bacteria 7719
170 Ga0105249_10011803 3300009553 Bacteria 7681
171 Ga0105239_10015928 3300010375 Bacteria 8320
172 Ga0105246_10000711 3300011119 Bacteria 18783
173 Ga0105246_10407780 3300011119 Bacteria 1130
174 Ga0157373_10044608 3300013100 Bacteria 3165
175 Ga0157370_10002033 3300013104 Bacteria 24869
176 Ga0157370_10012906 3300013104 Bacteria 8635
177 Ga0157370_10331321 3300013104 Bacteria 1403
178 Ga0157370_10349195 3300013104 Bacteria 1363
179 Ga0157369_10048030 3300013105 Bacteria 4632
180 Ga0157369_10127079 3300013105 Bacteria 2702
181 Ga0157369_10341700 3300013105 Bacteria 1555
182 Ga0157374_10000087 3300013296 Bacteria 91263
183 Ga0157374_10121444 3300013296 Bacteria 2522
184 Ga0157374_10723579 3300013296 Bacteria 1009
185 Ga0157378_10000083 3300013297 Bacteria 87820
186 Ga0157378_10090407 3300013297 Bacteria 2782
187 Ga0157378_10259048 3300013297 Bacteria 1668
188 Ga0163162_10163688 3300013306 Bacteria 2347
189 Ga0163162_10241179 3300013306 Bacteria 1938
190 Ga0157372_10097702 3300013307 Bacteria 3349
191 Ga0157375_10002225 3300013308 Bacteria 16788
192 Ga0157375_10162430 3300013308 Bacteria 2376
193 Ga0157375_10688484 3300013308 Bacteria 1176
194 Ga0163163_10023927 3300014325 Bacteria 5807
195 Ga0163163_10043736 3300014325 Bacteria 4393
196 Ga0163163_10098263 3300014325 Bacteria 2948
197 Ga0157380_10109062 3300014326 Bacteria 2322
198 Ga0157379_10237541 3300014968 Bacteria 1653
199 Ga0157376_10000071 3300014969 Bacteria 82759
200 Ga0157376_10052882 3300014969 Bacteria 3379
201 Ga0163161_10043519 3300017792 Bacteria 3233
202 Ga0213876_10001857 3300021384 Bacteria 12724
203 Ga0209147_100266 3300025229 Bacteria 47344
204 Ga0209437_108758 3300025233 Bacteria 1605
205 Ga0209026_1002564 3300025250 Bacteria 6698
206 Ga0209148_1000061 3300025254 Bacteria 349575
207 Ga0209233_1000003 3300025261 Bacteria 1607366
208 Ga0209233_1000026 3300025261 Bacteria 678466
209 Ga0209233_1014267 3300025261 Bacteria 2243
210 Ga0209565_1000008 3300025263 Bacteria 774179
211 Ga0209565_1000522 3300025263 Bacteria 27324
212 Ga0209455_1000026 3300025272 Bacteria 653778
213 Ga0209673_1000645 3300025273 Bacteria 51774
214 Ga0209673_1001385 3300025273 Bacteria 23781
215 Ga0209676_1000483 3300025292 Bacteria 65133
216 Ga0209564_1008979 3300025295 Bacteria 4838
217 Ga0209758_1003157 3300025297 Bacteria 15483
218 Ga0209758_1005516 3300025297 Bacteria 9666
219 Ga0209050_1000010 3300025298 Bacteria 980454
220 Ga0209050_1000215 3300025298 Bacteria 129179
221 Ga0209050_1001022 3300025298 Bacteria 34910
222 Ga0209050_1002559 3300025298 Bacteria 15174
223 Ga0209256_1000009 3300025299 Bacteria 922071
224 Ga0209256_1000010 3300025299 Bacteria 912110
225 Ga0209256_1002486 3300025299 Bacteria 14935
226 Ga0209257_1000027 3300025304 Bacteria 703541
227 Ga0209257_1000532 3300025304 Bacteria 66089
228 Ga0209257_1004045 3300025304 Bacteria 11783
229 Ga0207697_10088367 3300025315 Bacteria 1312
230 Ga0207656_10014892 3300025321 Bacteria 3005
231 Ga0207656_10031456 3300025321 Bacteria 2199
232 Ga0207682_10084397 3300025893 Bacteria 1367
233 Ga0207642_10011848 3300025899 Bacteria 3127
234 Ga0207680_10018488 3300025903 Bacteria 3706
235 Ga0207647_10004220 3300025904 Bacteria 10655
236 Ga0207645_10000217 3300025907 Bacteria 47483
237 Ga0207645_10062188 3300025907 Bacteria 2385
238 Ga0207645_10151062 3300025907 Bacteria 1516
239 Ga0207705_10000002 3300025909 Bacteria 2046852
240 Ga0207705_10000018 3300025909 Bacteria 319792
241 Ga0207705_10031816 3300025909 Bacteria 3768
242 Ga0207705_10032851 3300025909 Bacteria 3707
243 Ga0207684_10005643 3300025910 Bacteria 11496
244 Ga0207707_10001374 3300025912 Bacteria 22568
245 Ga0207695_10016004 3300025913 Bacteria 8804
246 Ga0207695_10055766 3300025913 Bacteria 4116
247 Ga0207695_10108723 3300025913 Bacteria 2756
248 Ga0207695_10130137 3300025913 Bacteria 2475
249 Ga0207695_10315698 3300025913 Bacteria 1452
250 Ga0207671_10213979 3300025914 Bacteria 1508
251 Ga0207693_10034480 3300025915 Bacteria 3992
252 Ga0207663_10178228 3300025916 Bacteria 1515
253 Ga0207660_10039985 3300025917 Bacteria 3281
254 Ga0207660_10326127 3300025917 Unclassified 1227
255 Ga0207657_10000273 3300025919 Bacteria 54891
256 Ga0207657_10008526 3300025919 Bacteria 10394
257 Ga0207657_10083491 3300025919 Bacteria 2680
258 Ga0207657_10139722 3300025919 Bacteria 1979
259 Ga0207649_10002638 3300025920 Bacteria 9956
260 Ga0207649_10065359 3300025920 Bacteria 2302
261 Ga0207649_10197431 3300025920 Bacteria 1419
262 Ga0207649_10331634 3300025920 Bacteria 1121
263 Ga0207652_10055877 3300025921 Bacteria 3397
264 Ga0207652_10118673 3300025921 Bacteria 2352
265 Ga0207681_10012369 3300025923 Bacteria 5266
266 Ga0207681_10037243 3300025923 Bacteria 3214
267 Ga0207681_10304572 3300025923 Bacteria 1262
268 Ga0207694_10005534 3300025924 Bacteria 9690
269 Ga0207650_10019174 3300025925 Bacteria 4806
270 Ga0207659_10005328 3300025926 Bacteria 7795
271 Ga0207687_10000316 3300025927 Bacteria 32985
272 Ga0207687_10069976 3300025927 Bacteria 2504
273 Ga0207700_10053313 3300025928 Bacteria 3030
274 Ga0207664_10036629 3300025929 Bacteria 3792
275 Ga0207664_10098427 3300025929 Bacteria 2412
276 Ga0207644_10032375 3300025931 Bacteria 3647
277 Ga0207644_10039932 3300025931 Bacteria 3314
278 Ga0207690_10007103 3300025932 Bacteria 6652
279 Ga0207690_10014886 3300025932 Bacteria 4708
280 Ga0207690_10042225 3300025932 Bacteria 2994
281 Ga0207706_10043075 3300025933 Bacteria 4000
282 Ga0207706_10056210 3300025933 Bacteria 3470
283 Ga0207706_10078142 3300025933 Bacteria 2911
284 Ga0207686_10001161 3300025934 Bacteria 15196
285 Ga0207686_10018341 3300025934 Bacteria 3961
286 Ga0207686_10048023 3300025934 Bacteria 2642
287 Ga0207709_10000187 3300025935 Bacteria 82937
288 Ga0207670_10028365 3300025936 Bacteria 3553
289 Ga0207669_10022506 3300025937 Bacteria 3349
290 Ga0207669_10038279 3300025937 Bacteria 2760
291 Ga0207704_10000006 3300025938 Bacteria 220005
292 Ga0207704_10021819 3300025938 Bacteria 3418
293 Ga0207704_10436103 3300025938 Bacteria 1042
294 Ga0207665_10112182 3300025939 Unclassified 1917
295 Ga0207691_10001609 3300025940 Bacteria 22430
296 Ga0207691_10021175 3300025940 Bacteria 6143
297 Ga0207691_10040504 3300025940 Bacteria 4303
298 Ga0207711_10023269 3300025941 Bacteria 5184
299 Ga0207711_10033869 3300025941 Bacteria 4324
300 Ga0207689_10002159 3300025942 Bacteria 18500
301 Ga0207661_10287170 3300025944 Bacteria 1472
302 Ga0207679_10075851 3300025945 Bacteria 2553
303 Ga0207679_10081940 3300025945 Bacteria 2469
304 Ga0207667_10000038 3300025949 Bacteria 280720
305 Ga0207667_10000525 3300025949 Bacteria 50627
306 Ga0207667_10007338 3300025949 Bacteria 13269
307 Ga0207667_10011273 3300025949 Bacteria 10396
308 Ga0207667_10062204 3300025949 Bacteria 3904
309 Ga0207651_10000001 3300025960 Bacteria 516823
310 Ga0207651_10012408 3300025960 Bacteria 4822
311 Ga0207651_10020343 3300025960 Bacteria 4003
312 Ga0207712_10006935 3300025961 Bacteria 7147
313 Ga0207712_10080228 3300025961 Bacteria 2373
314 Ga0207640_10001904 3300025981 Bacteria 11203
315 Ga0207640_10028144 3300025981 Bacteria 3433
316 Ga0207640_10124394 3300025981 Bacteria 1854
317 Ga0207640_10156327 3300025981 Bacteria 1681
318 Ga0207658_10047329 3300025986 Bacteria 3147
319 Ga0207658_10263190 3300025986 Bacteria 1470
320 Ga0207677_10000016 3300026023 Bacteria 153771
321 Ga0207677_10017913 3300026023 Bacteria 4238
322 Ga0207703_10025102 3300026035 Bacteria 4687
323 Ga0207703_10045573 3300026035 Bacteria 3528
324 Ga0207639_10000100 3300026041 Bacteria 70921
325 Ga0207639_10085754 3300026041 Bacteria 2505
326 Ga0207639_10191705 3300026041 Bacteria 1746
327 Ga0207678_10000007 3300026067 Bacteria 179943
328 Ga0207678_10002851 3300026067 Bacteria 15681
329 Ga0207678_10141069 3300026067 Bacteria 2056
330 Ga0207708_10071259 3300026075 Bacteria 2662
331 Ga0207702_10000447 3300026078 Bacteria 46576
332 Ga0207702_10000959 3300026078 Bacteria 29645
333 Ga0207702_10002844 3300026078 Bacteria 16184
334 Ga0207702_10023208 3300026078 Bacteria 5144
335 Ga0207641_10497351 3300026088 Bacteria 1183
336 Ga0207648_10000042 3300026089 Bacteria 114885
337 Ga0207648_10002179 3300026089 Bacteria 21248
338 Ga0207648_10057292 3300026089 Bacteria 3399
339 Ga0207676_10191504 3300026095 Bacteria 1800
340 Ga0207676_10241653 3300026095 Bacteria 1620
341 Ga0207676_10255818 3300026095 Bacteria 1578
342 Ga0207674_10001906 3300026116 Bacteria 26496
343 Ga0207674_10215621 3300026116 Bacteria 1868
344 Ga0207675_100043571 3300026118 Bacteria 4191
345 Ga0207683_10003596 3300026121 Bacteria 13514
346 Ga0207683_10045788 3300026121 Bacteria 3826
347 Ga0207698_10043667 3300026142 Bacteria 3360
348 Ga0207698_10098916 3300026142 Unclassified 2411
349 Ga0268266_10000103 3300028379 Bacteria 179736
350 Ga0268264_10371189 3300028381 Bacteria 1367
351 Ga0265338_10146926 3300028800 Bacteria 1838
352 Ga0265330_10012699 3300031235 Bacteria 3934
353 Ga0307408_100243376 3300031548 Bacteria 1479
354 Ga0265313_10118462 3300031595 Bacteria 1157
355 Ga0265314_10000420 3300031711 Bacteria 57180
356 Ga0265342_10004424 3300031712 Bacteria 11081
357 Ga0307405_10013715 3300031731 Bacteria 4330
358 Ga0307413_10012299 3300031824 Bacteria 4254
359 Ga0307410_10058567 3300031852 Bacteria 2626
360 Ga0307406_10108276 3300031901 Bacteria 1907
361 Ga0307406_10134431 3300031901 Bacteria 1741
362 Ga0307406_10242171 3300031901 Bacteria 1353
363 Ga0307407_10012169 3300031903 Bacteria 4127
364 Ga0307407_10090473 3300031903 Bacteria 1874
365 Ga0307412_10006690 3300031911 Bacteria 6535
366 Ga0307412_10065118 3300031911 Bacteria 2465
367 Ga0307412_10225938 3300031911 Bacteria 1438
368 Ga0307409_100000049 3300031995 Bacteria 42215
369 Ga0307409_100081170 3300031995 Bacteria 2620
370 Ga0307416_100020682 3300032002 Bacteria 4703
371 Ga0307416_100059825 3300032002 Bacteria 3098
372 Ga0307416_100311741 3300032002 Bacteria 1570
373 Ga0307414_10001517 3300032004 Bacteria 12061
374 Ga0307414_10002005 3300032004 Bacteria 10566
375 Ga0307414_10015197 3300032004 Bacteria 4641
376 Ga0307414_10090727 3300032004 Bacteria 2269
377 Ga0307411_10003770 3300032005 Bacteria 7118
378 Ga0307411_10024109 3300032005 Bacteria 3620
379 Ga0307415_100012691 3300032126 Bacteria 4881
380 Ga0307415_100072536 3300032126 Bacteria 2425
381 Ga0373944_0078838 3300035089 Bacteria 1085
382 Ga0373946_0071372 3300035171 Bacteria 1501
383 Ga0373955_0066547 3300035172 Bacteria 2003
384 Ga0373927_0066085 3300035695 Bacteria 2339
385 Ga0373927_0249265 3300035695 Bacteria 1167
386 Ga0373933_0107381 3300035724 Bacteria 1737
387 Ga0373947_0002938 3300035725 Bacteria 10172
388 Ga0373937_0031347 3300036401 Bacteria 4817
389 Ga0373925_0005490 3300037068 Bacteria 9437
390 Ga0373925_0020760 3300037068 Bacteria 4786
391 Ga0395899_0000542 3300037312 Bacteria 40992
392 Ga0395899_0000670 3300037312 Bacteria 34678
393 Ga0395900_0000266 3300037418 Bacteria 81348
394 Ga0395900_0000858 3300037418 Bacteria 40064
395 Ga0395900_0048376 3300037418 Bacteria 4380
396 Ga0395900_0077183 3300037418 Bacteria 3422
397 Ga0395900_0153815 3300037418 Bacteria 2350
398 Ga0395898_0031953 3300037466 Bacteria 5256
399 Ga0395898_0087020 3300037466 Bacteria 3011
400 Ga0395905_0032393 3300037471 Bacteria 4916
401 Ga0395905_0056648 3300037471 Bacteria 3666
402 Ga0395905_0086871 3300037471 Bacteria 2932
403 Ga0395901_0000174 3300038443 Bacteria 83279
404 Ga0395901_0001090 3300038443 Bacteria 28972
405 Ga0436365_0873465 3300039437 Bacteria 246686
406 Ga0466966_0278427 3300044684 Bacteria 1006
407 Ga0466963_0073094 3300044694 Bacteria 2311
408 Ga0466957_0000110 3300044842 Bacteria 34092
409 Ga0466957_0047316 3300044842 Bacteria 2613
410 Ga0466958_0018902 3300045836 Bacteria 4005
411 Ga0495662_0110848 3300046476 Bacteria 1345
412 Ga0495607_0148876 3300046501 Bacteria 1200
413 Ga0495606_0014096 3300046507 Bacteria 6260
414 Ga0495608_0171874 3300046511 Bacteria 1374
415 Ga0495610_0001958 3300046512 Bacteria 17717
416 Ga0495616_0000039 3300046513 Bacteria 123105
417 Ga0495620_0005136 3300046515 Bacteria 7328
418 Ga0495640_0213547 3300046533 Bacteria 1219
419 Ga0495587_0056814 3300046536 Bacteria 2302
420 Ga0495668_0002367 3300046616 Bacteria 15688
421 Ga0495668_0019330 3300046616 Bacteria 3928
422 Ga0495659_0011624 3300046664 Bacteria 2837
423 Ga0495604_0040539 3300047317 Bacteria 3656
424 Ga0495673_0043190 3300047469 Bacteria 2019
425 Ga0495681_0064465 3300047470 Bacteria 1678
426 Ga0495602_0041948 3300048088 Bacteria 4173
427 Ga0496100_0004476 3300048903 Bacteria 7415
428 Ga0496101_0170136 3300048904 Bacteria 1674
429 Ga0496102_0093685 3300048905 Bacteria 2783
430 Ga0496102_0219376 3300048905 Bacteria 1792
431 Ga0496103_0043024 3300048906 Bacteria 2780
432 Ga0496103_0247426 3300048906 Bacteria 1147
433 Ga0496104_0057604 3300048907 Bacteria 3676
434 Ga0496104_0256513 3300048907 Bacteria 1661
435 Ga0496106_0072192 3300048909 Bacteria 2639
436 Ga0496107_0042753 3300048910 Bacteria 3254
437 Ga0496108_0059350 3300048911 Bacteria 3217
438 Ga0496109_0385281 3300048912 Bacteria 1324
439 Ga0496110_0002065 3300048913 Bacteria 14971
440 Ga0496111_0217129 3300048914 Bacteria 1420
441 Ga0496112_0306038 3300048915 Bacteria 1534
442 Ga0496113_0025194 3300048916 Bacteria 4237
443 Ga0496113_0169859 3300048916 Bacteria 1727
444 Ga0496115_0112407 3300048918 Bacteria 2238
445 Ga0496116_0080339 3300048919 Bacteria 2025
446 Ga0496118_0019117 3300048921 Bacteria 6137
447 Ga0496119_0018618 3300048922 Bacteria 5159
448 Ga0496119_0020412 3300048922 Bacteria 4836
449 Ga0496120_0021094 3300048923 Bacteria 4122
450 Ga0496121_0044531 3300048924 Bacteria 3826
451 Ga0496121_0056589 3300048924 Bacteria 3256
452 Ga0496123_0018447 3300048926 Bacteria 5552
453 Ga0496125_0002931 3300048928 Bacteria 21477
454 Ga0501071_0065744 3300049587 Bacteria 2634
455 Ga0501207_000035 3300049654 Bacteria 9749
456 Ga0501216_012479 3300049660 Bacteria 1396
457 Ga0501227_002723 3300049665 Bacteria 3881
458 Ga0501225_0005997 3300049705 Bacteria 3553
459 Ga0501035_0037959 3300049822 Bacteria 4361
460 nmdc:mga08y16_64741_c1 3300050511 Bacteria 3816
461 Ga0500578_0000043 3300053086 Bacteria 128295
462 Ga0500608_012256 3300053122 Bacteria 3753
463 2585146439 2582581279 Bacteria 4980720
464 2643896993 2643221577 Bacteria 3710843
465 2643916079 2643221581 Bacteria 3893603
466 2644234536 2643221642 Bacteria 5357871
467 2739791024 2739367756 Bacteria 4553612
468 2819554385 2818991438 Bacteria 5793701
469 2884963644 2884960567 Bacteria 5437054
470 2895503646 2895498888 Bacteria 5283788
471 2895515532 2895511927 Bacteria 6802080
472 2895524712 2895522137 Bacteria 3284416
473 2895527663 2895525241 Bacteria 3388457
474 2923519779 2923516293 Bacteria 3716336
475 2928531337 2928531327 Bacteria 5101314
476 2946790455 2946787523 Bacteria 4366789
477 2990269130 2990265787 Bacteria 3943888
478 2990269283 2990265787 Bacteria 3943888
479 2993694833 2993693658 Bacteria 4040749
480 2993697374 2993693658 Bacteria 4040749
481 3000867803 3000865235 Bacteria 3106258
482 8002870005 8002869464 Bacteria 3588529
483 Ga0070659_100009513
484 JGI24737J22298_10008882
485 JGI24735J21928_10017258
486 JGI25406J46586_10004109
487 JGI25165J46597_1000120
488 JGI25153J46596_10001019
489 rootH2_10056391
490 rootH1_10007730
491 Ga0055542_1008800
492 Ga0055529_1000068
493 Ga0055537_1000488
494 Ga0055524_1000095
495 Ga0055536_1000379
496 Ga0055528_1002530
497 Ga0055530_10009361
498 Ga0055530_10011078
499 Ga0055531_10000560
500 Ga0055531_10007451
501 Ga0065165_1000840
502 Ga0065165_1002885
503 Ga0065165_1005700
504 Ga0065712_10072716
505 Ga0065715_10111295
506 Ga0070658_10000013
507 Ga0070658_10000734
508 Ga0070658_10165864
509 Ga0070676_10011018
510 Ga0070676_10153346
511 Ga0070690_100001641
512 Ga0070690_100011164
513 Ga0070670_100001022
514 Ga0070670_100291914
515 Ga0068869_100000655
516 Ga0070666_10023221
517 Ga0070666_10085003
518 Ga0070666_10099997
519 Ga0070680_100040989
520 Ga0068868_100000025
521 Ga0068868_100044910
522 Ga0068868_100045315
523 Ga0068868_100318508
524 Ga0070660_100000888
525 Ga0070660_100004197
526 Ga0070660_100043986
527 Ga0070689_100155280
528 Ga0070687_100076446
529 Ga0070687_100078462
530 Ga0070661_100013638
531 Ga0070661_100094129
532 Ga0070661_100202611
533 Ga0070669_100017299
534 Ga0070669_100025370
535 Ga0070669_100084425
536 Ga0070675_100000925
537 Ga0070675_100165130
538 Ga0070671_100001039
539 Ga0070671_100318883
540 Ga0070674_100032237
541 Ga0070673_100000016
542 Ga0070673_100001707
543 Ga0070673_100034457
544 Ga0070688_100135175
545 Ga0070659_100011148
546 Ga0070659_100028786
547 Ga0070659_100184379
548 Ga0070667_100061776
549 Ga0070714_100019094
550 Ga0070714_100277689
551 Ga0070701_10028617
552 Ga0070711_100097786
553 Ga0070694_100001287
554 Ga0070663_100000572
555 Ga0070663_100030580
556 Ga0070678_100002092
557 Ga0070678_100070387
558 Ga0070662_100035107
559 Ga0070662_100036785
560 Ga0070662_100111639
561 Ga0070681_10008869
562 Ga0068867_100000299
563 Ga0068867_100018326
564 Ga0070679_100157760
565 Ga0068853_100022796
566 Ga0068853_100087520
567 Ga0068853_100135534
568 Ga0070672_100000571
569 Ga0070672_100045039
570 Ga0070672_100124758
571 Ga0070695_100302992
572 Ga0070665_100054088
573 Ga0068855_100001290
574 Ga0068855_100009554
575 Ga0070664_100025677
576 Ga0070664_100035410
577 Ga0070664_100222953
578 Ga0070664_100280478
579 Ga0068857_100005243
580 Ga0068857_100046973
581 Ga0068854_100026880
582 Ga0068854_100057892
583 Ga0068854_100102813
584 Ga0068854_100412887
585 Ga0068856_100002933
586 Ga0068856_100026258
587 Ga0068856_100091891
588 Ga0068852_100056659
589 Ga0068852_100133802
590 Ga0068852_100306172
591 Ga0068859_100009808
592 Ga0068859_100035981
593 Ga0068859_100050186
594 Ga0068864_100030745
595 Ga0068864_100090763
596 Ga0068864_100138745
597 Ga0068866_10003217
598 Ga0068866_10040172
599 Ga0068861_100093255
600 Ga0068861_100393129
601 Ga0068851_10000356
602 Ga0068851_10043143
603 Ga0068863_100048009
604 Ga0068863_100386428
605 Ga0068858_100040666
606 Ga0068858_100042945
607 Ga0068858_100255061
608 Ga0068860_100046349
609 Ga0068860_100079374
610 Ga0068862_100049996
611 Ga0068862_100052122
612 Ga0081539_10003170
613 Ga0081539_10027851
614 Ga0081539_10039290
615 Ga0070716_100063790
616 Ga0070712_100450048
617 Ga0097621_100000367
618 Ga0097621_100006959
619 Ga0097621_100046372
620 Ga0097621_100259326
621 Ga0068871_100000479
622 Ga0068871_100002343
623 Ga0068871_100351726
624 Ga0075433_10221019
625 Ga0075429_100040112
626 Ga0068865_100000026
627 Ga0068865_100004123
628 Ga0097620_100009808
629 Ga0097620_100035978
630 Ga0097620_100050187
631 Ga0105244_10132662
632 Ga0105240_10028301
633 Ga0105240_10031815
634 Ga0105240_10043192
635 Ga0111539_10322898
636 Ga0111539_10546648
637 Ga0105245_10000078
638 Ga0105245_10088225
639 Ga0105245_10114809
640 Ga0105245_10280750
641 Ga0105243_10001224
642 Ga0105243_10016028
643 Ga0105241_10013272
644 Ga0105241_10087190
645 Ga0105241_10165217
646 Ga0105242_10006070
647 Ga0105242_10019056
648 Ga0105237_10029531
649 Ga0105238_10007923
650 Ga0105249_10011695
651 Ga0105249_10011803
652 Ga0105239_10015928
653 Ga0105246_10000711
654 Ga0105246_10407780
655 Ga0157373_10044608
656 Ga0157370_10002033
657 Ga0157370_10012906
658 Ga0157370_10331321
659 Ga0157370_10349195
660 Ga0157369_10048030
661 Ga0157369_10127079
662 Ga0157369_10341700
663 Ga0157374_10000087
664 Ga0157374_10121444
665 Ga0157374_10723579
666 Ga0157378_10000083
667 Ga0157378_10090407
668 Ga0157378_10259048
669 Ga0163162_10163688
670 Ga0163162_10241179
671 Ga0157372_10097702
672 Ga0157375_10002225
673 Ga0157375_10162430
674 Ga0157375_10688484
675 Ga0163163_10023927
676 Ga0163163_10043736
677 Ga0163163_10098263
678 Ga0157380_10109062
679 Ga0157379_10237541
680 Ga0157376_10000071
681 Ga0157376_10052882
682 Ga0163161_10043519
683 Ga0213876_10001857
684 Ga0209147_100266
685 Ga0209437_108758
686 Ga0209026_1002564
687 Ga0209148_1000061
688 Ga0209233_1000003
689 Ga0209233_1000026
690 Ga0209233_1014267
691 Ga0209565_1000008
692 Ga0209565_1000522
693 Ga0209455_1000026
694 Ga0209673_1000645
695 Ga0209673_1001385
696 Ga0209676_1000483
697 Ga0209564_1008979
698 Ga0209758_1003157
699 Ga0209758_1005516
700 Ga0209050_1000010
701 Ga0209050_1000215
702 Ga0209050_1001022
703 Ga0209050_1002559
704 Ga0209256_1000009
705 Ga0209256_1000010
706 Ga0209256_1002486
707 Ga0209257_1000027
708 Ga0209257_1000532
709 Ga0209257_1004045
710 Ga0207697_10088367
711 Ga0207656_10014892
712 Ga0207656_10031456
713 Ga0207682_10084397
714 Ga0207642_10011848
715 Ga0207680_10018488
716 Ga0207647_10004220
717 Ga0207645_10000217
718 Ga0207645_10062188
719 Ga0207645_10151062
720 Ga0207705_10000002
721 Ga0207705_10000018
722 Ga0207705_10031816
723 Ga0207705_10032851
724 Ga0207684_10005643
725 Ga0207707_10001374
726 Ga0207695_10016004
727 Ga0207695_10055766
728 Ga0207695_10108723
729 Ga0207695_10130137
730 Ga0207695_10315698
731 Ga0207671_10213979
732 Ga0207693_10034480
733 Ga0207663_10178228
734 Ga0207660_10039985
735 Ga0207660_10326127
736 Ga0207657_10000273
737 Ga0207657_10008526
738 Ga0207657_10083491
739 Ga0207657_10139722
740 Ga0207649_10002638
741 Ga0207649_10065359
742 Ga0207649_10197431
743 Ga0207649_10331634
744 Ga0207652_10055877
745 Ga0207652_10118673
746 Ga0207681_10012369
747 Ga0207681_10037243
748 Ga0207681_10304572
749 Ga0207694_10005534
750 Ga0207650_10019174
751 Ga0207659_10005328
752 Ga0207687_10000316
753 Ga0207687_10069976
754 Ga0207700_10053313
755 Ga0207664_10036629
756 Ga0207664_10098427
757 Ga0207644_10032375
758 Ga0207644_10039932
759 Ga0207690_10007103
760 Ga0207690_10014886
761 Ga0207690_10042225
762 Ga0207706_10043075
763 Ga0207706_10056210
764 Ga0207706_10078142
765 Ga0207686_10001161
766 Ga0207686_10018341
767 Ga0207686_10048023
768 Ga0207709_10000187
769 Ga0207670_10028365
770 Ga0207669_10022506
771 Ga0207669_10038279
772 Ga0207704_10000006
773 Ga0207704_10021819
774 Ga0207704_10436103
775 Ga0207665_10112182
776 Ga0207691_10001609
777 Ga0207691_10021175
778 Ga0207691_10040504
779 Ga0207711_10023269
780 Ga0207711_10033869
781 Ga0207689_10002159
782 Ga0207661_10287170
783 Ga0207679_10075851
784 Ga0207679_10081940
785 Ga0207667_10000038
786 Ga0207667_10000525
787 Ga0207667_10007338
788 Ga0207667_10011273
789 Ga0207667_10062204
790 Ga0207651_10000001
791 Ga0207651_10012408
792 Ga0207651_10020343
793 Ga0207712_10006935
794 Ga0207712_10080228
795 Ga0207640_10001904
796 Ga0207640_10028144
797 Ga0207640_10124394
798 Ga0207640_10156327
799 Ga0207658_10047329
800 Ga0207658_10263190
801 Ga0207677_10000016
802 Ga0207677_10017913
803 Ga0207703_10025102
804 Ga0207703_10045573
805 Ga0207639_10000100
806 Ga0207639_10085754
807 Ga0207639_10191705
808 Ga0207678_10000007
809 Ga0207678_10002851
810 Ga0207678_10141069
811 Ga0207708_10071259
812 Ga0207702_10000447
813 Ga0207702_10000959
814 Ga0207702_10002844
815 Ga0207702_10023208
816 Ga0207641_10497351
817 Ga0207648_10000042
818 Ga0207648_10002179
819 Ga0207648_10057292
820 Ga0207676_10191504
821 Ga0207676_10241653
822 Ga0207676_10255818
823 Ga0207674_10001906
824 Ga0207674_10215621
825 Ga0207675_100043571
826 Ga0207683_10003596
827 Ga0207683_10045788
828 Ga0207698_10043667
829 Ga0207698_10098916
830 Ga0268266_10000103
831 Ga0268264_10371189
832 Ga0265338_10146926
833 Ga0265330_10012699
834 Ga0307408_100243376
835 Ga0265313_10118462
836 Ga0265314_10000420
837 Ga0265342_10004424
838 Ga0307405_10013715
839 Ga0307413_10012299
840 Ga0307410_10058567
841 Ga0307406_10108276
842 Ga0307406_10134431
843 Ga0307406_10242171
844 Ga0307407_10012169
845 Ga0307407_10090473
846 Ga0307412_10006690
847 Ga0307412_10065118
848 Ga0307412_10225938
849 Ga0307409_100000049
850 Ga0307409_100081170
851 Ga0307416_100020682
852 Ga0307416_100059825
853 Ga0307416_100311741
854 Ga0307414_10001517
855 Ga0307414_10002005
856 Ga0307414_10015197
857 Ga0307414_10090727
858 Ga0307411_10003770
859 Ga0307411_10024109
860 Ga0307415_100012691
861 Ga0307415_100072536
862 Ga0373944_0078838
863 Ga0373946_0071372
864 Ga0373955_0066547
865 Ga0373927_0066085
866 Ga0373927_0249265
867 Ga0373933_0107381
868 Ga0373947_0002938
869 Ga0373937_0031347
870 Ga0373925_0005490
871 Ga0373925_0020760
872 Ga0395899_0000542
873 Ga0395899_0000670
874 Ga0395900_0000266
875 Ga0395900_0000858
876 Ga0395900_0048376
877 Ga0395900_0077183
878 Ga0395900_0153815
879 Ga0395898_0031953
880 Ga0395898_0087020
881 Ga0395905_0032393
882 Ga0395905_0056648
883 Ga0395905_0086871
884 Ga0395901_0000174
885 Ga0395901_0001090
886 Ga0436365_0873465
887 Ga0466966_0278427
888 Ga0466963_0073094
889 Ga0466957_0000110
890 Ga0466957_0047316
891 Ga0466958_0018902
892 Ga0495662_0110848
893 Ga0495607_0148876
894 Ga0495606_0014096
895 Ga0495608_0171874
896 Ga0495610_0001958
897 Ga0495616_0000039
898 Ga0495620_0005136
899 Ga0495640_0213547
900 Ga0495587_0056814
901 Ga0495668_0002367
902 Ga0495668_0019330
903 Ga0495659_0011624
904 Ga0495604_0040539
905 Ga0495673_0043190
906 Ga0495681_0064465
907 Ga0495602_0041948
908 Ga0496100_0004476
909 Ga0496101_0170136
910 Ga0496102_0093685
911 Ga0496102_0219376
912 Ga0496103_0043024
913 Ga0496103_0247426
914 Ga0496104_0057604
915 Ga0496104_0256513
916 Ga0496106_0072192
917 Ga0496107_0042753
918 Ga0496108_0059350
919 Ga0496109_0385281
920 Ga0496110_0002065
921 Ga0496111_0217129
922 Ga0496112_0306038
923 Ga0496113_0025194
924 Ga0496113_0169859
925 Ga0496115_0112407
926 Ga0496116_0080339
927 Ga0496118_0019117
928 Ga0496119_0018618
929 Ga0496119_0020412
930 Ga0496120_0021094
931 Ga0496121_0044531
932 Ga0496121_0056589
933 Ga0496123_0018447
934 Ga0496125_0002931
935 Ga0501071_0065744
936 Ga0501207_000035
937 Ga0501216_012479
938 Ga0501227_002723
939 Ga0501225_0005997
940 Ga0501035_0037959
941 nmdc:mga08y16_64741_c1
942 Ga0500578_0000043
943 Ga0500608_012256
944 2585146439
945 2643896993
946 2643916079
947 2644234536
948 2739791024
949 2819554385
950 2884963644
951 2895503646
952 2895515532
953 2895524712
954 2895527663
955 2923519779
956 2928531337
957 2946790455
958 2990269130
959 2990269283
960 2993694833
961 2993697374
962 3000867803
963 8002870005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

233

305

0.86

PF20434

BD-FAE

BD-FAE

230

295

0.86

PF01738

DLH

Dienelactone hydrolase family

147

360

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q3k-assembly1.cif.gz_B crystal structure of mgs-m1, an alpha/beta hydrolase enzyme from a medee basin deep-sea metagenome library 0.7673 83 315
1w76-assembly1.cif.gz_A orthorhombic form of torpedo californica acetylcholinesterase (ache) complexed with bis-acting galanthamine derivative 0.758 81 235
3hxk-assembly1.cif.gz_A crystal structure of a sugar hydrolase (yeeb) from lactococcus lactis, northeast structural genomics consortium target kr108 0.75 83 312
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.7488 84 311
8gs3-assembly1.cif.gz_B cryo-em structure of human neuroligin 3 0.7387 83 240
ID Description Score Start End Superfamily
af_A0A1D6EGD3_55_198_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8021 99 219 3.40.50.1820
4q3kA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7682 83 315 3.40.50.1820
3hxkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7489 83 312 3.40.50.1820
af_Q21266_11_550_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7487 84 236 3.40.50.1820
af_Q9UT29_165_337_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7426 85 250 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2T5UBH4-F1-model_v4 Acetyl esterase/lipase 0.9616 30 317 GO:0016787
AF-V4PKI7-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.961 40 319 GO:0016787
AF-F6ICZ9-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9581 29 319 GO:0016787
AF-V4PKI7-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9577 40 319 GO:0016787
AF-A0A437JFY0-F1-model_v4 Alpha/beta hydrolase 0.954 30 319 GO:0016787

Map