F452398

General Info

Members Datasets Scaffolds Average Seq Length
481 285 442 156

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10000369|Ga0105237_100003698
Length 177
Sequence MFSIFDTGYGLSTMVHGLKKEMIEIFTDGASSGNPGPGGYGVILRSGKHYKELSEGFRKTTNNRMELLAVIKGLEALKNLKQDVTIYSDSKYVIDAIEKRWVHGWLQKGFAGKKNKDLWLRYLEVSKLHNIKFVWVRGHAGHPENERCDVLAVAAGKQKNLLIDSVFEMESAKVNLL

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
4 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
5 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
6 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
7 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
8 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
9 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
12 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
13 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
14 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
15 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
16 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
17 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
18 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
19 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
20 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
21 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
22 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
23 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
24 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
25 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
26 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
27 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
28 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
29 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
30 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
31 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
32 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
33 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
34 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
35 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
36 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
40 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
41 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
42 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
43 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
51 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
166 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
167 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
176 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
177 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
178 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
179 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
209 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
212 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
213 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
214 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
215 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
216 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
217 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
259 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
260 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
261 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
262 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
263 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
264 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
268 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
269 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
270 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
271 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
272 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
273 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
276 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
277 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
281 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
282 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
283 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
284 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
285 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.68
Metatranscriptomes 0.21
Isolates 8.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.6
Nodule 1.04
Rhizoplane 0.83
Rhizosphere 75.47
Stem 0
Stem Tuber 0
Unclassified 12.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1008041 3300001904 Bacteria 1758
2 JGI24736J21556_1011064 3300001904 Bacteria 1470
3 JGI24746J21847_1002798 3300001977 Bacteria 2749
4 JGI24740J21852_10020235 3300001979 Bacteria 2325
5 JGI24739J22299_10001544 3300001989 Bacteria 8705
6 JGI24737J22298_10013794 3300001990 Bacteria 2628
7 JGI24033J26618_1016329 3300002155 Bacteria 921
8 JGI25162J39368_1014132 3300002737 Bacteria 861
9 JGI25164J39214_1001587 3300002772 Bacteria 4839
10 JGI25150J39212_1000001 3300002774 Bacteria 1318726
11 JGI25151J46595_10000005 3300003187 Bacteria 431598
12 JGI25165J46597_1002850 3300003214 Bacteria 4950
13 JGI25153J46596_10000040 3300003215 Bacteria 165523
14 JGI25153J46596_10021007 3300003215 Bacteria 2447
15 JGI25153J46596_10101928 3300003215 Bacteria 674
16 rootH2_10001039 3300003320 Bacteria 81374
17 rootH2_10001334 3300003320 Bacteria 238709
18 rootH2_10017315 3300003320 Unclassified 1873
19 rootH2_10041545 3300003320 Bacteria 5499
20 rootH2_10060705 3300003320 Bacteria 1878
21 rootH2_10266715 3300003320 Bacteria 1223
22 rootH1_10017298 3300003323 Bacteria 12898
23 rootH1_10033426 3300003323 Bacteria 1810
24 rootH1_10190008 3300003323 Bacteria 2939
25 rootH1_10191747 3300003323 Bacteria 7483
26 Ga0055526_1006478 3300003771 Bacteria 6343
27 Ga0055526_1037810 3300003771 Bacteria 1254
28 Ga0055543_1033345 3300004625 Bacteria 891
29 Ga0058863_11560710 3300004799 Bacteria 2604
30 Ga0065165_1000017 3300005262 Bacteria 278286
31 Ga0065714_10007825 3300005288 Bacteria 4587
32 Ga0065714_10093461 3300005288 Bacteria 1846
33 Ga0065714_10266310 3300005288 Bacteria 747
34 Ga0065714_10267194 3300005288 Bacteria 746
35 Ga0065704_10077830 3300005289 Bacteria 4598
36 Ga0065704_10083427 3300005289 Bacteria 3468
37 Ga0065704_10286111 3300005289 Bacteria 913
38 Ga0065715_10053278 3300005293 Bacteria 1004
39 Ga0065715_10129933 3300005293 Bacteria 2036
40 Ga0070658_10001193 3300005327 Bacteria 22232
41 Ga0070658_10011975 3300005327 Bacteria 6963
42 Ga0070658_10073466 3300005327 Bacteria 2804
43 Ga0070658_10665976 3300005327 Bacteria 903
44 Ga0070658_11834097 3300005327 Bacteria 524
45 Ga0070676_10013119 3300005328 Bacteria 4539
46 Ga0070683_100161534 3300005329 Bacteria 2126
47 Ga0070683_100744376 3300005329 Bacteria 939
48 Ga0070690_100591507 3300005330 Unclassified 841
49 Ga0070670_101145201 3300005331 Bacteria 710
50 Ga0068869_101865636 3300005334 Bacteria 538
51 Ga0070680_100249628 3300005336 Bacteria 1500
52 Ga0070682_100087449 3300005337 Bacteria 2032
53 Ga0070660_100040854 3300005339 Bacteria 3533
54 Ga0070660_100086538 3300005339 Bacteria 2466
55 Ga0070660_100657047 3300005339 Bacteria 878
56 Ga0070660_100710381 3300005339 Bacteria 843
57 Ga0070660_101646264 3300005339 Bacteria 546
58 Ga0070661_100081505 3300005344 Bacteria 2389
59 Ga0070675_101238109 3300005354 Bacteria 687
60 Ga0070671_100001929 3300005355 Bacteria 15895
61 Ga0070659_100105121 3300005366 Bacteria 2275
62 Ga0070662_100000011 3300005457 Bacteria 133652
63 Ga0070681_10016457 3300005458 Bacteria 7383
64 Ga0068867_100000336 3300005459 Bacteria 31030
65 Ga0070679_100077453 3300005530 Bacteria 3314
66 Ga0070679_100198391 3300005530 Bacteria 1973
67 Ga0070679_100528729 3300005530 Bacteria 1123
68 Ga0070679_100640936 3300005530 Bacteria 1005
69 Ga0070679_101018515 3300005530 Bacteria 772
70 Ga0070684_100566999 3300005535 Bacteria 1054
71 Ga0068853_100021688 3300005539 Bacteria 5358
72 Ga0068853_100136640 3300005539 Bacteria 2198
73 Ga0068853_100272122 3300005539 Bacteria 1560
74 Ga0070686_100343384 3300005544 Unclassified 1119
75 Ga0070665_100000003 3300005548 Bacteria 811857
76 Ga0070665_100432461 3300005548 Unclassified 1325
77 Ga0068855_100000048 3300005563 Bacteria 145334
78 Ga0068855_100000154 3300005563 Bacteria 87746
79 Ga0068855_100069500 3300005563 Bacteria 4098
80 Ga0068855_100185066 3300005563 Bacteria 2353
81 Ga0070664_100000753 3300005564 Bacteria 25015
82 Ga0068857_100272380 3300005577 Bacteria 1556
83 Ga0068854_101064152 3300005578 Bacteria 719
84 Ga0068856_100002764 3300005614 Bacteria 17969
85 Ga0068856_100003065 3300005614 Bacteria 17072
86 Ga0068856_100036671 3300005614 Bacteria 4808
87 Ga0068856_100071287 3300005614 Bacteria 3439
88 Ga0068856_100413836 3300005614 Bacteria 1368
89 Ga0068852_100128301 3300005616 Bacteria 2332
90 Ga0068851_10040098 3300005834 Bacteria 2353
91 Ga0070717_10418582 3300006028 Bacteria 1205
92 Ga0075366_10420739 3300006195 Bacteria 823
93 Ga0097621_100273481 3300006237 Bacteria 1485
94 Ga0075429_100152805 3300006880 Unclassified 2021
95 Ga0099824_1000332 3300006942 Bacteria 51674
96 Ga0079104_1000079 3300006946 Bacteria 141480
97 Ga0099826_10055889 3300006948 Bacteria 2610
98 Ga0105251_10059959 3300009011 Bacteria 1793
99 Ga0105244_10000054 3300009036 Bacteria 133715
100 Ga0105244_10279180 3300009036 Bacteria 775
101 Ga0105250_10018715 3300009092 Bacteria 2803
102 Ga0105240_10000126 3300009093 Bacteria 157403
103 Ga0105240_10007367 3300009093 Bacteria 16004
104 Ga0105240_10022807 3300009093 Bacteria 8294
105 Ga0105240_10028692 3300009093 Bacteria 7262
106 Ga0105240_10042710 3300009093 Bacteria 5775
107 Ga0105240_10158153 3300009093 Bacteria 2693
108 Ga0105240_10629887 3300009093 Bacteria 1178
109 Ga0105240_10852703 3300009093 Unclassified 983
110 Ga0111539_10004976 3300009094 Bacteria 17290
111 Ga0105243_10000751 3300009148 Bacteria 31062
112 Ga0105243_10932017 3300009148 Bacteria 866
113 Ga0105241_10004170 3300009174 Bacteria 10671
114 Ga0105241_10005229 3300009174 Bacteria 9585
115 Ga0105241_10484057 3300009174 Bacteria 1100
116 Ga0105242_10209588 3300009176 Bacteria 1736
117 Ga0105237_10000369 3300009545 Bacteria 63892
118 Ga0105237_10000693 3300009545 Bacteria 46571
119 Ga0105237_10001305 3300009545 Bacteria 33170
120 Ga0105237_10286235 3300009545 Bacteria 1651
121 Ga0105237_10412748 3300009545 Bacteria 1355
122 Ga0105238_10066500 3300009551 Bacteria 3606
123 Ga0105238_10203312 3300009551 Bacteria 1957
124 Ga0105249_10206685 3300009553 Bacteria 1924
125 Ga0105239_10000005 3300010375 Bacteria 496066
126 Ga0105239_10004103 3300010375 Bacteria 17516
127 Ga0105239_10008586 3300010375 Bacteria 11588
128 Ga0105239_10095629 3300010375 Bacteria 3282
129 Ga0105239_10689180 3300010375 Bacteria 1168
130 Ga0105239_10965464 3300010375 Bacteria 979
131 Ga0105246_10164155 3300011119 Bacteria 1695
132 Ga0157373_10000003 3300013100 Bacteria 454601
133 Ga0157373_10211255 3300013100 Bacteria 1368
134 Ga0157371_10001870 3300013102 Bacteria 21071
135 Ga0157371_10004511 3300013102 Bacteria 12130
136 Ga0157371_10060197 3300013102 Bacteria 2692
137 Ga0157370_10001146 3300013104 Bacteria 33059
138 Ga0157370_10004531 3300013104 Bacteria 15922
139 Ga0157370_10009149 3300013104 Bacteria 10619
140 Ga0157370_10011201 3300013104 Bacteria 9403
141 Ga0157370_10131061 3300013104 Bacteria 2339
142 Ga0157370_10225684 3300013104 Bacteria 1734
143 Ga0157370_10324947 3300013104 Bacteria 1419
144 Ga0157370_10704489 3300013104 Bacteria 922
145 Ga0157370_10979978 3300013104 Bacteria 766
146 Ga0157369_10000039 3300013105 Bacteria 188947
147 Ga0157369_10000235 3300013105 Bacteria 76779
148 Ga0157369_10128134 3300013105 Bacteria 2690
149 Ga0157374_10001810 3300013296 Bacteria 18003
150 Ga0157374_10003984 3300013296 Bacteria 12410
151 Ga0157374_10128206 3300013296 Bacteria 2454
152 Ga0157374_10581001 3300013296 Bacteria 1130
153 Ga0157374_10971145 3300013296 Bacteria 868
154 Ga0157378_10033060 3300013297 Bacteria 4571
155 Ga0157378_10152286 3300013297 Bacteria 2155
156 Ga0163162_10000024 3300013306 Bacteria 188515
157 Ga0163162_10011025 3300013306 Bacteria 8804
158 Ga0157372_10000001 3300013307 Bacteria 791349
159 Ga0157372_10136124 3300013307 Bacteria 2829
160 Ga0157372_10582955 3300013307 Bacteria 1304
161 Ga0157375_10031178 3300013308 Bacteria 5035
162 Ga0157375_10049189 3300013308 Bacteria 4129
163 Ga0157375_10099569 3300013308 Bacteria 2986
164 Ga0157375_11104470 3300013308 Bacteria 928
165 Ga0157380_10000577 3300014326 Bacteria 22580
166 Ga0157380_10490972 3300014326 Bacteria 1190
167 Ga0157376_10154346 3300014969 Bacteria 2074
168 Ga0182006_1003444 3300015261 Bacteria 8087
169 Ga0182006_1012113 3300015261 Bacteria 3777
170 Ga0182006_1017945 3300015261 Bacteria 2998
171 Ga0182006_1062809 3300015261 Bacteria 1396
172 Ga0182007_10031939 3300015262 Bacteria 1791
173 Ga0183373_1003 3300015682 Bacteria 558813
174 Ga0163161_10000435 3300017792 Bacteria 35025
175 Ga0163161_10005417 3300017792 Bacteria 8859
176 Ga0163161_10193482 3300017792 Bacteria 1564
177 Ga0163161_11231303 3300017792 Bacteria 648
178 Ga0213872_10044569 3300021361 Bacteria 2018
179 Ga0209563_104904 3300025230 Bacteria 2495
180 Ga0207427_100337 3300025231 Bacteria 31041
181 Ga0209437_100008 3300025233 Bacteria 921142
182 Ga0207425_1000002 3300025245 Bacteria 1362590
183 Ga0209026_1002878 3300025250 Bacteria 6069
184 Ga0209148_1037961 3300025254 Bacteria 680
185 Ga0209129_1000002 3300025258 Bacteria 1359086
186 Ga0209233_1000024 3300025261 Bacteria 695418
187 Ga0209565_1020465 3300025263 Bacteria 1396
188 Ga0209455_1003025 3300025272 Bacteria 6160
189 Ga0209673_1000354 3300025273 Bacteria 83443
190 Ga0209025_1000004 3300025294 Bacteria 1361782
191 Ga0209564_1002882 3300025295 Bacteria 12597
192 Ga0209564_1017339 3300025295 Bacteria 2812
193 Ga0209564_1036935 3300025295 Bacteria 1385
194 Ga0209758_1000006 3300025297 Bacteria 1359562
195 Ga0209758_1005472 3300025297 Bacteria 9758
196 Ga0209758_1009644 3300025297 Bacteria 5950
197 Ga0209050_1000163 3300025298 Bacteria 154895
198 Ga0209050_1001692 3300025298 Bacteria 22112
199 Ga0207426_1017541 3300025302 Bacteria 2542
200 Ga0209257_1004987 3300025304 Bacteria 9700
201 Ga0207656_10033802 3300025321 Bacteria 2132
202 Ga0207696_1092663 3300025711 Bacteria 827
203 Ga0207655_1000003 3300025728 Bacteria 1081376
204 Ga0207647_10000320 3300025904 Bacteria 39775
205 Ga0207705_10000916 3300025909 Bacteria 24137
206 Ga0207705_10163405 3300025909 Bacteria 1674
207 Ga0207705_10410399 3300025909 Bacteria 1048
208 Ga0207705_10490022 3300025909 Bacteria 954
209 Ga0207654_10004213 3300025911 Bacteria 7259
210 Ga0207654_10033112 3300025911 Bacteria 2862
211 Ga0207654_10138361 3300025911 Bacteria 1550
212 Ga0207707_10226646 3300025912 Bacteria 1626
213 Ga0207695_10002316 3300025913 Bacteria 28406
214 Ga0207695_10005491 3300025913 Bacteria 16782
215 Ga0207695_10036409 3300025913 Bacteria 5320
216 Ga0207695_10097374 3300025913 Bacteria 2943
217 Ga0207695_10282213 3300025913 Bacteria 1554
218 Ga0207695_10446380 3300025913 Bacteria 1177
219 Ga0207671_10001816 3300025914 Bacteria 23813
220 Ga0207671_11493536 3300025914 Bacteria 522
221 Ga0207660_10021308 3300025917 Bacteria 4358
222 Ga0207657_10052408 3300025919 Bacteria 3541
223 Ga0207657_10095699 3300025919 Bacteria 2471
224 Ga0207657_10436433 3300025919 Bacteria 1028
225 Ga0207649_10056297 3300025920 Bacteria 2455
226 Ga0207649_11070707 3300025920 Bacteria 636
227 Ga0207652_10116971 3300025921 Bacteria 2368
228 Ga0207652_10117117 3300025921 Bacteria 2367
229 Ga0207652_10822373 3300025921 Bacteria 824
230 Ga0207652_11163589 3300025921 Bacteria 673
231 Ga0207694_10033806 3300025924 Bacteria 3918
232 Ga0207644_10006890 3300025931 Bacteria 7400
233 Ga0207690_10292353 3300025932 Bacteria 1272
234 Ga0207706_10000399 3300025933 Bacteria 46832
235 Ga0207686_10067395 3300025934 Bacteria 2290
236 Ga0207686_10120667 3300025934 Bacteria 1784
237 Ga0207709_10000613 3300025935 Bacteria 29386
238 Ga0207661_10558389 3300025944 Bacteria 1049
239 Ga0207679_10007783 3300025945 Bacteria 6809
240 Ga0207667_10000023 3300025949 Bacteria 362527
241 Ga0207667_10000458 3300025949 Bacteria 54772
242 Ga0207667_10094727 3300025949 Bacteria 3083
243 Ga0207667_10127198 3300025949 Bacteria 2625
244 Ga0207667_10176376 3300025949 Bacteria 2195
245 Ga0207640_10771356 3300025981 Bacteria 831
246 Ga0207677_11401949 3300026023 Bacteria 644
247 Ga0207639_10015809 3300026041 Bacteria 5328
248 Ga0207639_10262603 3300026041 Bacteria 1511
249 Ga0207639_10873566 3300026041 Bacteria 840
250 Ga0207678_10028897 3300026067 Bacteria 4839
251 Ga0207678_10500585 3300026067 Bacteria 1059
252 Ga0207702_10002053 3300026078 Bacteria 19491
253 Ga0207702_10002997 3300026078 Bacteria 15705
254 Ga0207702_10010569 3300026078 Bacteria 7714
255 Ga0207702_10014916 3300026078 Bacteria 6445
256 Ga0207702_10049738 3300026078 Bacteria 3537
257 Ga0207702_10592795 3300026078 Bacteria 1087
258 Ga0207648_10002337 3300026089 Bacteria 20457
259 Ga0209281_1000367 3300027111 Bacteria 73152
260 Ga0209489_110463 3300027361 Bacteria 10435
261 Ga0209984_1009501 3300027424 Bacteria 1237
262 Ga0209995_1028970 3300027471 Bacteria 925
263 Ga0209974_10094111 3300027876 Bacteria 1041
264 Ga0207428_10040953 3300027907 Unclassified 3752
265 Ga0268266_10000380 3300028379 Bacteria 67791
266 Ga0268266_10660192 3300028379 Unclassified 1007
267 Ga0307517_10018211 3300028786 Bacteria 9101
268 Ga0307517_10116158 3300028786 Bacteria 2005
269 Ga0307515_10179941 3300028794 Bacteria 2068
270 Ga0265338_10003745 3300028800 Bacteria 21128
271 Ga0265338_10020261 3300028800 Bacteria 7007
272 Ga0316177_1161218 3300030731 Bacteria 2658
273 Ga0316176_1046024 3300030732 Bacteria 10598
274 Ga0316179_1049245 3300030734 Bacteria 3685
275 Ga0316183_1108470 3300030742 Bacteria 14315
276 Ga0316181_1057819 3300030744 Unclassified 3590
277 Ga0265327_10014396 3300031251 Bacteria 5176
278 Ga0265327_10321588 3300031251 Bacteria 679
279 Ga0307513_10102164 3300031456 Bacteria 2887
280 Ga0307513_10583486 3300031456 Bacteria 828
281 Ga0307513_10706695 3300031456 Bacteria 714
282 Ga0307509_10419011 3300031507 Bacteria 1040
283 Ga0307408_100000014 3300031548 Bacteria 377369
284 Ga0307408_100000277 3300031548 Bacteria 51510
285 Ga0316575_10357306 3300031665 Bacteria 623
286 Ga0316578_10049891 3300031728 Bacteria 2447
287 Ga0307405_10000001 3300031731 Bacteria 1731270
288 Ga0307405_10859346 3300031731 Bacteria 764
289 Ga0316577_10484275 3300031733 Bacteria 703
290 Ga0307413_10083240 3300031824 Bacteria 2058
291 Ga0307410_10000452 3300031852 Bacteria 16534
292 Ga0307406_10000028 3300031901 Bacteria 91602
293 Ga0307406_10011134 3300031901 Bacteria 5096
294 Ga0307407_10000047 3300031903 Bacteria 59255
295 Ga0307407_10000122 3300031903 Bacteria 24812
296 Ga0307412_10000020 3300031911 Bacteria 258377
297 Ga0307412_10350900 3300031911 Bacteria 1184
298 Ga0307412_10582936 3300031911 Bacteria 944
299 Ga0307412_10850280 3300031911 Bacteria 796
300 Ga0307409_100300643 3300031995 Bacteria 1493
301 Ga0307416_100000066 3300032002 Bacteria 94549
302 Ga0307416_100098840 3300032002 Bacteria 2532
303 Ga0307414_10000022 3300032004 Bacteria 212123
304 Ga0307414_10001438 3300032004 Bacteria 12349
305 Ga0307414_10009109 3300032004 Bacteria 5685
306 Ga0307414_10029885 3300032004 Bacteria 3552
307 Ga0307414_10054030 3300032004 Bacteria 2804
308 Ga0307414_11781217 3300032004 Bacteria 574
309 Ga0307411_10000003 3300032005 Bacteria 477556
310 Ga0307411_10115831 3300032005 Bacteria 1928
311 Ga0307411_10317610 3300032005 Bacteria 1256
312 Ga0316580_10012184 3300032139 Bacteria 2618
313 Ga0307510_10046146 3300033180 Bacteria 4690
314 Ga0307510_10088124 3300033180 Bacteria 2965
315 Ga0373941_0010000 3300035115 Bacteria 2408
316 Ga0316582_0081755 3300036647 Bacteria 2111
317 Ga0316582_1219342 3300036647 Bacteria 512
318 Ga0316584_0109064 3300036712 Bacteria 2071
319 Ga0316584_0242697 3300036712 Bacteria 1318
320 Ga0373925_0909631 3300037068 Bacteria 725
321 Ga0395899_0000342 3300037312 Bacteria 57838
322 Ga0395899_0000926 3300037312 Bacteria 27634
323 Ga0395899_0094312 3300037312 Bacteria 2166
324 Ga0395899_0425673 3300037312 Bacteria 874
325 Ga0395900_0000014 3300037418 Bacteria 386513
326 Ga0395900_0000773 3300037418 Bacteria 42584
327 Ga0395900_0006203 3300037418 Bacteria 12484
328 Ga0395900_0957407 3300037418 Bacteria 777
329 Ga0395898_0032913 3300037466 Bacteria 5175
330 Ga0395898_0151221 3300037466 Bacteria 2221
331 Ga0395905_0000037 3300037471 Bacteria 261808
332 Ga0395905_0000278 3300037471 Bacteria 75859
333 Ga0395905_0084793 3300037471 Bacteria 2969
334 Ga0395901_0000219 3300038443 Bacteria 71884
335 Ga0395901_0095935 3300038443 Bacteria 3108
336 Ga0395901_0514646 3300038443 Bacteria 1217
337 Ga0400483_040298 3300039062 Bacteria 25488
338 Ga0400483_235084 3300039062 Bacteria 30922
339 Ga0400489_58902 3300039093 Bacteria 18858
340 Ga0400489_91956 3300039093 Unclassified 2057
341 Ga0436361_0255105 3300039447 Bacteria 22008
342 Ga0439447_000078 3300041407 Bacteria 34377
343 Ga0439466_0000251 3300041411 Bacteria 21210
344 Ga0439466_0120499 3300041411 Bacteria 810
345 Ga0439452_022120 3300042010 Bacteria 1649
346 Ga0450890_000033 3300042127 Bacteria 33599
347 Ga0450891_009733 3300042129 Bacteria 886
348 Ga0450889_001361 3300042144 Bacteria 2525
349 Ga0450893_0000030 3300042532 Bacteria 13954
350 Ga0450893_0000552 3300042532 Bacteria 5322
351 Ga0450893_0074561 3300042532 Bacteria 663
352 Ga0451577_0013136 3300042876 Bacteria 7760
353 Ga0451577_0040689 3300042876 Bacteria 4172
354 Ga0451577_0100614 3300042876 Unclassified 2582
355 Ga0466969_0029203 3300044656 Bacteria 2817
356 Ga0466966_0006438 3300044684 Bacteria 7769
357 Ga0453684_0001251 3300044712 Bacteria 76833
358 Ga0453684_0003241 3300044712 Bacteria 37219
359 Ga0453684_0005835 3300044712 Bacteria 23953
360 Ga0453684_0011125 3300044712 Bacteria 15178
361 Ga0466959_0309372 3300045049 Bacteria 1081
362 Ga0466959_0394457 3300045049 Bacteria 941
363 Ga0451576_0005663 3300045051 Bacteria 15602
364 Ga0451576_0035518 3300045051 Bacteria 5287
365 Ga0451576_0246456 3300045051 Unclassified 1867
366 Ga0451576_0413795 3300045051 Bacteria 1414
367 Ga0466958_0024872 3300045836 Bacteria 3526
368 Ga0495627_004635 3300046453 Bacteria 5700
369 Ga0495592_0798118 3300046454 Bacteria 561
370 Ga0495638_0000197 3300046460 Bacteria 86853
371 Ga0495638_0348930 3300046460 Bacteria 782
372 Ga0495651_0040628 3300046462 Bacteria 3617
373 Ga0495651_0952598 3300046462 Bacteria 523
374 Ga0495596_0111884 3300046500 Bacteria 1060
375 Ga0495606_0006128 3300046507 Bacteria 11221
376 Ga0495606_0307295 3300046507 Bacteria 857
377 Ga0495606_0452268 3300046507 Bacteria 658
378 Ga0495631_0164347 3300046518 Bacteria 952
379 Ga0495643_0000067 3300046522 Bacteria 175403
380 Ga0495644_0092792 3300046523 Unclassified 1140
381 Ga0495642_0114285 3300046528 Bacteria 1156
382 Ga0495652_0066130 3300046529 Bacteria 3035
383 Ga0495654_0021091 3300046530 Bacteria 3392
384 Ga0495625_0087673 3300046660 Bacteria 2157
385 Ga0495661_0002029 3300046665 Bacteria 15942
386 Ga0495671_0294234 3300046692 Bacteria 781
387 Ga0495660_0068577 3300046810 Bacteria 1887
388 Ga0495674_1315786 3300047319 Bacteria 542
389 Ga0495676_0607086 3300047321 Bacteria 712
390 Ga0495683_0008615 3300047323 Bacteria 5450
391 Ga0495687_002833 3300047443 Bacteria 13355
392 Ga0495686_0001308 3300047472 Bacteria 27997
393 Ga0495686_0085903 3300047472 Bacteria 1915
394 Ga0496114_0000077 3300048917 Bacteria 70285
395 Ga0496115_0009354 3300048918 Bacteria 7281
396 Ga0496115_0045549 3300048918 Bacteria 3502
397 Ga0496115_0574659 3300048918 Bacteria 898
398 Ga0496116_0000002 3300048919 Bacteria 920291
399 Ga0496117_0202655 3300048920 Bacteria 1120
400 Ga0496118_0016127 3300048921 Bacteria 6871
401 Ga0496121_0046301 3300048924 Bacteria 3725
402 Ga0496121_0106865 3300048924 Bacteria 2145
403 Ga0496124_0006639 3300048927 Bacteria 12552
404 Ga0496125_0000024 3300048928 Bacteria 442149
405 Ga0496125_0000108 3300048928 Bacteria 196060
406 Ga0496125_0603760 3300048928 Bacteria 599
407 Ga0496126_0001907 3300048929 Bacteria 29948
408 Ga0496126_0009644 3300048929 Bacteria 10232
409 Ga0496126_0202781 3300048929 Bacteria 1674
410 Ga0496126_0294629 3300048929 Bacteria 1341
411 Ga0501032_0004372 3300049569 Bacteria 10662
412 Ga0501038_0458624 3300049574 Unclassified 979
413 Ga0501070_0678821 3300049586 Bacteria 816
414 Ga0501224_055189 3300049664 Bacteria 614
415 Ga0501238_000020 3300049671 Bacteria 29326
416 Ga0501243_087958 3300049675 Bacteria 613
417 Ga0501249_000002 3300049679 Bacteria 262756
418 Ga0501249_005428 3300049679 Bacteria 2606
419 Ga0501249_013801 3300049679 Bacteria 1719
420 Ga0501241_017365 3300049758 Bacteria 1314
421 Ga0501266_000003 3300049763 Bacteria 388836
422 Ga0501266_016273 3300049763 Bacteria 987
423 Ga0501280_008856 3300049776 Bacteria 1401
424 nmdc:mga0k408_295_c2 3300050493 Bacteria 15899
425 nmdc:mga08y16_19399_c1 3300050511 Bacteria 7169
426 nmdc:mga08y16_48000_c1 3300050511 Unclassified 4469
427 Ga0500635_0111090 3300053080 Bacteria 1018
428 Ga0500646_0005118 3300053090 Bacteria 3320
429 Ga0500641_0000033 3300053096 Bacteria 78369
430 Ga0500641_0000080 3300053096 Bacteria 38955
431 Ga0500641_0002296 3300053096 Bacteria 6785
432 Ga0500557_069813 3300053105 Bacteria 1151
433 Ga0500594_0008179 3300053118 Bacteria 2379
434 Ga0500608_000315 3300053122 Bacteria 18669
435 Ga0500642_0059641 3300053130 Bacteria 1709
436 Ga0500658_0000015 3300053134 Bacteria 151134
437 Ga0500573_0235647 3300053140 Bacteria 952
438 Ga0500590_154063 3300053148 Bacteria 1033
439 Ga0500604_0014778 3300053151 Bacteria 2129
440 Ga0500616_0000051 3300053153 Bacteria 296240
441 Ga0500622_0000121 3300053156 Bacteria 81831
442 Ga0500627_0218972 3300053158 Bacteria 850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10033426 rootH1_100334262 121
2 3300053090 Ga0500646_0005118 Ga0500646_0005118_2850_3248 130
3 3300053096 Ga0500641_0000080 Ga0500641_0000080_25578_26012 139
4 3300001977 JGI24746J21847_1002798 JGI24746J21847_10027982 143
5 3300005354 Ga0070675_101238109 Ga0070675_1012381092 143
6 3300005459 Ga0068867_100000336 Ga0068867_10000033611 143
7 3300009148 Ga0105243_10000751 Ga0105243_1000075127 143
8 3300009176 Ga0105242_10209588 Ga0105242_102095882 143
9 3300014969 Ga0157376_10154346 Ga0157376_101543462 143
10 3300025934 Ga0207686_10067395 Ga0207686_100673952 143
11 3300025935 Ga0207709_10000613 Ga0207709_1000061311 143
12 3300026089 Ga0207648_10002337 Ga0207648_1000233711 143
13 3300031548 Ga0307408_100000014 Ga0307408_100000014255 143
14 3300031911 Ga0307412_10000020 Ga0307412_1000002013 143
15 3300036647 Ga0316582_1219342 Ga0316582_1219342_28_480 143
16 3300042127 Ga0450890_000033 Ga0450890_000033_21678_22142 143
17 3300042532 Ga0450893_0000030 Ga0450893_0000030_11482_11946 143
18 3300042532 Ga0450893_0000552 Ga0450893_0000552_2600_3064 143
19 3300002155 JGI24033J26618_1016329 JGI24033J26618_10163292 147
20 3300003320 rootH2_10001039 rootH2_1000103956 147
21 3300005344 Ga0070661_100081505 Ga0070661_1000815052 147
22 3300005564 Ga0070664_100000753 Ga0070664_10000075322 147
23 3300025920 Ga0207649_10056297 Ga0207649_100562972 147
24 3300025945 Ga0207679_10007783 Ga0207679_100077836 147
25 3300031903 Ga0307407_10000047 Ga0307407_1000004713 147
26 3300032002 Ga0307416_100098840 Ga0307416_1000988401 147
27 3300032005 Ga0307411_10317610 Ga0307411_103176102 147
28 3300042129 Ga0450891_009733 Ga0450891_009733_267_731 147
29 3300042144 Ga0450889_001361 Ga0450889_001361_1673_2137 147
30 3300042532 Ga0450893_0074561 Ga0450893_0074561_120_584 147
31 3300049569 Ga0501032_0004372 Ga0501032_0004372_7378_7842 147
32 3300049586 Ga0501070_0678821 Ga0501070_0678821_18_482 147
33 3300005544 Ga0070686_100343384 Ga0070686_1003433842 148
34 iso_pu_bacteria 2842903701 2842909434 148
35 iso_pu_bacteria 2775506987 2776612814 149
36 iso_pu_bacteria 8054307821 8054309416 149
37 3300001989 JGI24739J22299_10001544 JGI24739J22299_100015446 150
38 3300003215 JGI25153J46596_10021007 JGI25153J46596_100210073 150
39 3300003215 JGI25153J46596_10101928 JGI25153J46596_101019282 150
40 3300003320 rootH2_10017315 rootH2_100173152 150
41 3300003771 Ga0055526_1006478 Ga0055526_10064784 150
42 3300003771 Ga0055526_1037810 Ga0055526_10378101 150
43 3300004625 Ga0055543_1033345 Ga0055543_10333451 150
44 3300005262 Ga0065165_1000017 Ga0065165_10000174 150
45 3300005548 Ga0070665_100432461 Ga0070665_1004324612 150
46 3300005563 Ga0068855_100000048 Ga0068855_10000004898 150
47 3300005614 Ga0068856_100413836 Ga0068856_1004138362 150
48 3300006195 Ga0075366_10420739 Ga0075366_104207392 150
49 3300025263 Ga0209565_1020465 Ga0209565_10204652 150
50 3300025273 Ga0209673_1000354 Ga0209673_100035459 150
51 3300025295 Ga0209564_1002882 Ga0209564_100288210 150
52 3300025295 Ga0209564_1017339 Ga0209564_10173392 150
53 3300025295 Ga0209564_1036935 Ga0209564_10369351 150
54 3300025297 Ga0209758_1005472 Ga0209758_10054725 150
55 3300025297 Ga0209758_1009644 Ga0209758_10096442 150
56 3300025298 Ga0209050_1000163 Ga0209050_100016351 150
57 3300025302 Ga0207426_1017541 Ga0207426_10175412 150
58 3300025304 Ga0209257_1004987 Ga0209257_10049874 150
59 3300025949 Ga0207667_10000023 Ga0207667_1000002360 150
60 3300026067 Ga0207678_10500585 Ga0207678_105005852 150
61 3300026078 Ga0207702_10592795 Ga0207702_105927952 150
62 3300028379 Ga0268266_10660192 Ga0268266_106601922 150
63 3300037312 Ga0395899_0425673 Ga0395899_0425673_319_828 150
64 3300037418 Ga0395900_0006203 Ga0395900_0006203_10664_11173 150
65 3300039062 Ga0400483_040298 Ga0400483_040298_3572_4033 150
66 3300039062 Ga0400483_235084 Ga0400483_235084_19972_20433 150
67 3300044712 Ga0453684_0005835 Ga0453684_0005835_7489_7950 150
68 3300044712 Ga0453684_0011125 Ga0453684_0011125_6966_7427 150
69 3300045051 Ga0451576_0005663 Ga0451576_0005663_8023_8484 150
70 3300048917 Ga0496114_0000077 Ga0496114_0000077_13621_14079 150
71 iso_pu_bacteria 2643221600 2644012040 150
72 iso_pu_bacteria 2643221716 2644641317 150
73 iso_pu_bacteria 2643221725 2644682555 150
74 iso_pu_bacteria 2738541279 2738733829 150
75 iso_pu_bacteria 2738541285 2738766214 150
76 iso_pu_bacteria 2738543007 2739215410 150
77 iso_pu_bacteria 2802428842 2802651329 150
78 iso_pu_bacteria 2839989709 2839989763 150
79 iso_pu_bacteria 2881359912 2881360693 150
80 iso_pu_bacteria 2904555929 2904557840 150
81 iso_pu_bacteria 2910245624 2910247107 150
82 iso_pu_bacteria 2919191525 2919192485 150
83 iso_pu_bacteria 2919683626 2919684064 150
84 iso_pu_bacteria 2977268062 2977268071 150
85 iso_pu_bacteria 8055419101 8055420029 150
86 iso_pu_bacteria 8055588893 8055589271 150
87 iso_pu_bacteria 8055592153 8055596930 150
88 3300032004 Ga0307414_10001438 Ga0307414_1000143817 151
89 3300036712 Ga0316584_0242697 Ga0316584_0242697_815_1294 151
90 3300042876 Ga0451577_0040689 Ga0451577_0040689_408_878 151
91 3300046453 Ga0495627_004635 Ga0495627_004635_3777_4247 151
92 iso_pu_bacteria 2513020052 2513235801 151
93 iso_pu_bacteria 2519899754 2520880569 151
94 iso_pu_bacteria 2643221667 2644371372 151
95 iso_pu_bacteria 2739367857 2740000276 151
96 iso_pu_bacteria 2739367858 2740005092 151
97 iso_pu_bacteria 2816332280 2817414212 151
98 iso_pu_bacteria 2857613821 2857617714 151
99 iso_pu_bacteria 2857618242 2857621499 151
100 iso_pu_bacteria 2903895155 2903895289 151
101 iso_pu_bacteria 2904419702 2904420311 151
102 iso_pu_bacteria 2919509842 2919513002 151
103 iso_pu_bacteria 2929150217 2929151370 151
104 iso_pu_bacteria 2958458903 2958459636 151
105 iso_pu_bacteria 2958512119 2958514253 151
106 iso_pu_bacteria 2965320100 2965322455 151
107 iso_pu_bacteria 8056440228 8056444300 151
108 3300005331 Ga0070670_101145201 Ga0070670_1011452012 152
109 3300005614 Ga0068856_100002764 Ga0068856_1000027645 152
110 3300025250 Ga0209026_1002878 Ga0209026_10028786 152
111 3300025254 Ga0209148_1037961 Ga0209148_10379611 152
112 3300026078 Ga0207702_10002997 Ga0207702_100029977 152
113 3300028800 Ga0265338_10003745 Ga0265338_1000374510 152
114 3300030731 Ga0316177_1161218 Ga0316177_11612182 152
115 3300030732 Ga0316176_1046024 Ga0316176_10460247 152
116 3300030742 Ga0316183_1108470 Ga0316183_11084707 152
117 3300030744 Ga0316181_1057819 Ga0316181_10578193 152
118 3300031251 Ga0265327_10014396 Ga0265327_100143962 152
119 3300037068 Ga0373925_0909631 Ga0373925_0909631_160_621 152
120 3300046507 Ga0495606_0452268 Ga0495606_0452268_41_499 152
121 3300046522 Ga0495643_0000067 Ga0495643_0000067_38123_38596 152
122 3300046660 Ga0495625_0087673 Ga0495625_0087673_249_722 152
123 3300046810 Ga0495660_0068577 Ga0495660_0068577_793_1266 152
124 3300047321 Ga0495676_0607086 Ga0495676_0607086_106_567 152
125 3300048924 Ga0496121_0046301 Ga0496121_0046301_2751_3224 152
126 iso_pu_bacteria 2739367656 2739617412 152
127 iso_pu_bacteria 2852623160 2852623742 152
128 iso_pu_bacteria 2884933994 2884937351 152
129 3300005337 Ga0070682_100087449 Ga0070682_1000874493 153
130 3300009036 Ga0105244_10000054 Ga0105244_100000542 153
131 3300009036 Ga0105244_10279180 Ga0105244_102791801 153
132 3300009092 Ga0105250_10018715 Ga0105250_100187154 153
133 3300013100 Ga0157373_10000003 Ga0157373_1000000310 153
134 3300013102 Ga0157371_10001870 Ga0157371_1000187015 153
135 3300013104 Ga0157370_10009149 Ga0157370_100091492 153
136 3300013104 Ga0157370_10011201 Ga0157370_100112012 153
137 3300013104 Ga0157370_10225684 Ga0157370_102256842 153
138 3300013105 Ga0157369_10000235 Ga0157369_1000023555 153
139 3300013308 Ga0157375_10099569 Ga0157375_100995694 153
140 3300015261 Ga0182006_1003444 Ga0182006_10034442 153
141 3300015261 Ga0182006_1017945 Ga0182006_10179455 153
142 3300015261 Ga0182006_1062809 Ga0182006_10628092 153
143 3300017792 Ga0163161_10000435 Ga0163161_1000043511 153
144 3300017792 Ga0163161_10005417 Ga0163161_100054176 153
145 3300017792 Ga0163161_10193482 Ga0163161_101934822 153
146 3300025711 Ga0207696_1092663 Ga0207696_10926632 153
147 3300025728 Ga0207655_1000003 Ga0207655_1000003338 153
148 3300031456 Ga0307513_10706695 Ga0307513_107066952 153
149 3300033180 Ga0307510_10046146 Ga0307510_100461461 153
150 3300037471 Ga0395905_0084793 Ga0395905_0084793_1294_1761 153
151 3300042010 Ga0439452_022120 Ga0439452_022120_322_798 153
152 3300048919 Ga0496116_0000002 Ga0496116_0000002_784540_785016 153
153 3300048920 Ga0496117_0202655 Ga0496117_0202655_512_988 153
154 3300048921 Ga0496118_0016127 Ga0496118_0016127_5436_5912 153
155 3300048924 Ga0496121_0106865 Ga0496121_0106865_1408_1884 153
156 3300048927 Ga0496124_0006639 Ga0496124_0006639_11514_11990 153
157 3300048928 Ga0496125_0000108 Ga0496125_0000108_122388_122864 153
158 3300048928 Ga0496125_0603760 Ga0496125_0603760_21_497 153
159 3300048929 Ga0496126_0001907 Ga0496126_0001907_25223_25699 153
160 3300048929 Ga0496126_0202781 Ga0496126_0202781_388_864 153
161 3300053140 Ga0500573_0235647 Ga0500573_0235647_189_665 153
162 3300053151 Ga0500604_0014778 Ga0500604_0014778_1465_1926 153
163 3300053158 Ga0500627_0218972 Ga0500627_0218972_266_727 153
164 3300003320 rootH2_10060705 rootH2_100607052 154
165 3300005288 Ga0065714_10007825 Ga0065714_100078254 154
166 3300005288 Ga0065714_10093461 Ga0065714_100934612 154
167 3300005289 Ga0065704_10077830 Ga0065704_100778306 154
168 3300005289 Ga0065704_10083427 Ga0065704_100834274 154
169 3300005293 Ga0065715_10053278 Ga0065715_100532781 154
170 3300005293 Ga0065715_10129933 Ga0065715_101299332 154
171 3300005327 Ga0070658_10011975 Ga0070658_100119752 154
172 3300005339 Ga0070660_100040854 Ga0070660_1000408542 154
173 3300005530 Ga0070679_100528729 Ga0070679_1005287291 154
174 3300005530 Ga0070679_100640936 Ga0070679_1006409362 154
175 3300005539 Ga0068853_100136640 Ga0068853_1001366402 154
176 3300005578 Ga0068854_101064152 Ga0068854_1010641521 154
177 3300005614 Ga0068856_100071287 Ga0068856_1000712872 154
178 3300005616 Ga0068852_100128301 Ga0068852_1001283012 154
179 3300005834 Ga0068851_10040098 Ga0068851_100400982 154
180 3300006028 Ga0070717_10418582 Ga0070717_104185821 154
181 3300006880 Ga0075429_100152805 Ga0075429_1001528054 154
182 3300006942 Ga0099824_1000332 Ga0099824_100033215 154
183 3300006946 Ga0079104_1000079 Ga0079104_1000079146 154
184 3300006948 Ga0099826_10055889 Ga0099826_100558892 154
185 3300009011 Ga0105251_10059959 Ga0105251_100599592 154
186 3300009093 Ga0105240_10028692 Ga0105240_100286926 154
187 3300009093 Ga0105240_10042710 Ga0105240_100427102 154
188 3300009094 Ga0111539_10004976 Ga0111539_100049765 154
189 3300009174 Ga0105241_10484057 Ga0105241_104840571 154
190 3300009545 Ga0105237_10001305 Ga0105237_100013054 154
191 3300009545 Ga0105237_10286235 Ga0105237_102862352 154
192 3300010375 Ga0105239_10689180 Ga0105239_106891802 154
193 3300013104 Ga0157370_10001146 Ga0157370_1000114622 154
194 3300013104 Ga0157370_10004531 Ga0157370_1000453117 154
195 3300013104 Ga0157370_10131061 Ga0157370_101310612 154
196 3300015261 Ga0182006_1012113 Ga0182006_10121133 154
197 3300015682 Ga0183373_1003 Ga0183373_1003375 154
198 3300017792 Ga0163161_11231303 Ga0163161_112313031 154
199 3300025272 Ga0209455_1003025 Ga0209455_10030255 154
200 3300025321 Ga0207656_10033802 Ga0207656_100338023 154
201 3300025909 Ga0207705_10163405 Ga0207705_101634052 154
202 3300025911 Ga0207654_10138361 Ga0207654_101383612 154
203 3300025913 Ga0207695_10036409 Ga0207695_100364092 154
204 3300025913 Ga0207695_10097374 Ga0207695_100973743 154
205 3300025919 Ga0207657_10052408 Ga0207657_100524084 154
206 3300025921 Ga0207652_10822373 Ga0207652_108223731 154
207 3300026041 Ga0207639_10262603 Ga0207639_102626032 154
208 3300026041 Ga0207639_10873566 Ga0207639_108735662 154
209 3300026078 Ga0207702_10049738 Ga0207702_100497384 154
210 3300027111 Ga0209281_1000367 Ga0209281_100036768 154
211 3300027361 Ga0209489_110463 Ga0209489_1104635 154
212 3300027424 Ga0209984_1009501 Ga0209984_10095012 154
213 3300027471 Ga0209995_1028970 Ga0209995_10289702 154
214 3300027876 Ga0209974_10094111 Ga0209974_100941112 154
215 3300028786 Ga0307517_10116158 Ga0307517_101161582 154
216 3300028794 Ga0307515_10179941 Ga0307515_101799412 154
217 3300030734 Ga0316179_1049245 Ga0316179_10492453 154
218 3300031456 Ga0307513_10583486 Ga0307513_105834862 154
219 3300031507 Ga0307509_10419011 Ga0307509_104190112 154
220 3300031548 Ga0307408_100000277 Ga0307408_10000027732 154
221 3300031731 Ga0307405_10000001 Ga0307405_10000001311 154
222 3300031731 Ga0307405_10859346 Ga0307405_108593462 154
223 3300031824 Ga0307413_10083240 Ga0307413_100832402 154
224 3300031852 Ga0307410_10000452 Ga0307410_100004527 154
225 3300031901 Ga0307406_10000028 Ga0307406_1000002881 154
226 3300031901 Ga0307406_10011134 Ga0307406_100111348 154
227 3300031903 Ga0307407_10000122 Ga0307407_1000012219 154
228 3300031911 Ga0307412_10350900 Ga0307412_103509002 154
229 3300031995 Ga0307409_100300643 Ga0307409_1003006432 154
230 3300032002 Ga0307416_100000066 Ga0307416_1000000662 154
231 3300032004 Ga0307414_10000022 Ga0307414_10000022137 154
232 3300032004 Ga0307414_10029885 Ga0307414_100298851 154
233 3300032004 Ga0307414_10054030 Ga0307414_100540304 154
234 3300032004 Ga0307414_11781217 Ga0307414_117812171 154
235 3300032005 Ga0307411_10000003 Ga0307411_10000003194 154
236 3300032005 Ga0307411_10115831 Ga0307411_101158313 154
237 3300037312 Ga0395899_0000926 Ga0395899_0000926_12335_12799 154
238 3300037418 Ga0395900_0000014 Ga0395900_0000014_256244_256708 154
239 3300037418 Ga0395900_0000773 Ga0395900_0000773_32248_32715 154
240 3300037466 Ga0395898_0032913 Ga0395898_0032913_2874_3338 154
241 3300037471 Ga0395905_0000037 Ga0395905_0000037_256234_256698 154
242 3300038443 Ga0395901_0000219 Ga0395901_0000219_64848_65312 154
243 3300041407 Ga0439447_000078 Ga0439447_000078_32914_33393 154
244 3300041411 Ga0439466_0000251 Ga0439466_0000251_20001_20480 154
245 3300041411 Ga0439466_0120499 Ga0439466_0120499_266_745 154
246 3300042876 Ga0451577_0013136 Ga0451577_0013136_3573_4037 154
247 3300044712 Ga0453684_0001251 Ga0453684_0001251_72774_73238 154
248 3300045051 Ga0451576_0246456 Ga0451576_0246456_1083_1547 154
249 3300045051 Ga0451576_0413795 Ga0451576_0413795_593_1057 154
250 3300046462 Ga0495651_0040628 Ga0495651_0040628_2501_2965 154
251 3300046507 Ga0495606_0006128 Ga0495606_0006128_6312_6791 154
252 3300046529 Ga0495652_0066130 Ga0495652_0066130_2558_3022 154
253 3300046530 Ga0495654_0021091 Ga0495654_0021091_436_915 154
254 3300046692 Ga0495671_0294234 Ga0495671_0294234_48_530 154
255 3300047472 Ga0495686_0085903 Ga0495686_0085903_130_594 154
256 3300048918 Ga0496115_0009354 Ga0496115_0009354_6503_6976 154
257 3300048918 Ga0496115_0045549 Ga0496115_0045549_247_726 154
258 3300048928 Ga0496125_0000024 Ga0496125_0000024_141704_142183 154
259 3300048929 Ga0496126_0009644 Ga0496126_0009644_3450_3929 154
260 3300049574 Ga0501038_0458624 Ga0501038_0458624_349_813 154
261 3300049664 Ga0501224_055189 Ga0501224_055189_79_558 154
262 3300049671 Ga0501238_000020 Ga0501238_000020_24153_24632 154
263 3300049675 Ga0501243_087958 Ga0501243_087958_54_533 154
264 3300049679 Ga0501249_005428 Ga0501249_005428_465_944 154
265 3300049679 Ga0501249_013801 Ga0501249_013801_751_1230 154
266 3300049758 Ga0501241_017365 Ga0501241_017365_673_1152 154
267 3300049763 Ga0501266_000003 Ga0501266_000003_101253_101732 154
268 3300049763 Ga0501266_016273 Ga0501266_016273_430_909 154
269 3300049776 Ga0501280_008856 Ga0501280_008856_491_970 154
270 3300050511 nmdc:mga08y16_48000_c1 nmdc:mga08y16_48000_c1_3334_3798 154
271 3300053096 Ga0500641_0000033 Ga0500641_0000033_76878_77360 154
272 3300053096 Ga0500641_0002296 Ga0500641_0002296_5347_5829 154
273 3300053118 Ga0500594_0008179 Ga0500594_0008179_373_855 154
274 3300053134 Ga0500658_0000015 Ga0500658_0000015_22044_22523 154
275 3300053148 Ga0500590_154063 Ga0500590_154063_59_538 154
276 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001875 155
277 3300003187 JGI25151J46595_10000005 JGI25151J46595_10000005329 155
278 3300003215 JGI25153J46596_10000040 JGI25153J46596_1000004092 155
279 3300005288 Ga0065714_10267194 Ga0065714_102671942 155
280 3300005327 Ga0070658_11834097 Ga0070658_118340971 155
281 3300005328 Ga0070676_10013119 Ga0070676_100131194 155
282 3300005329 Ga0070683_100161534 Ga0070683_1001615341 155
283 3300005330 Ga0070690_100591507 Ga0070690_1005915071 155
284 3300005535 Ga0070684_100566999 Ga0070684_1005669992 155
285 3300005563 Ga0068855_100185066 Ga0068855_1001850662 155
286 3300005577 Ga0068857_100272380 Ga0068857_1002723802 155
287 3300009553 Ga0105249_10206685 Ga0105249_102066852 155
288 3300013104 Ga0157370_10324947 Ga0157370_103249472 155
289 3300013104 Ga0157370_10979978 Ga0157370_109799782 155
290 3300013296 Ga0157374_10581001 Ga0157374_105810012 155
291 3300013296 Ga0157374_10971145 Ga0157374_109711452 155
292 3300014326 Ga0157380_10490972 Ga0157380_104909722 155
293 3300025245 Ga0207425_1000002 Ga0207425_1000002305 155
294 3300025258 Ga0209129_1000002 Ga0209129_1000002305 155
295 3300025294 Ga0209025_1000004 Ga0209025_1000004885 155
296 3300025297 Ga0209758_1000006 Ga0209758_1000006885 155
297 3300025298 Ga0209050_1001692 Ga0209050_10016922 155
298 3300025949 Ga0207667_10176376 Ga0207667_101763762 155
299 3300031456 Ga0307513_10102164 Ga0307513_101021642 155
300 3300032004 Ga0307414_10009109 Ga0307414_100091093 155
301 3300039093 Ga0400489_58902 Ga0400489_58902_2458_2937 155
302 3300039093 Ga0400489_91956 Ga0400489_91956_925_1404 155
303 3300042876 Ga0451577_0100614 Ga0451577_0100614_1555_2022 155
304 3300044712 Ga0453684_0003241 Ga0453684_0003241_35884_36351 155
305 3300045051 Ga0451576_0035518 Ga0451576_0035518_1054_1521 155
306 3300046460 Ga0495638_0000197 Ga0495638_0000197_82046_82513 155
307 3300046460 Ga0495638_0348930 Ga0495638_0348930_117_584 155
308 3300046462 Ga0495651_0952598 Ga0495651_0952598_10_477 155
309 3300049679 Ga0501249_000002 Ga0501249_000002_142896_143381 155
310 3300053105 Ga0500557_069813 Ga0500557_069813_529_996 155
311 3300053153 Ga0500616_0000051 Ga0500616_0000051_86613_87080 155
312 3300001904 JGI24736J21556_1008041 JGI24736J21556_10080412 156
313 3300001904 JGI24736J21556_1011064 JGI24736J21556_10110642 156
314 3300001979 JGI24740J21852_10020235 JGI24740J21852_100202352 156
315 3300001990 JGI24737J22298_10013794 JGI24737J22298_100137942 156
316 3300002737 JGI25162J39368_1014132 JGI25162J39368_10141321 156
317 3300002772 JGI25164J39214_1001587 JGI25164J39214_10015875 156
318 3300003214 JGI25165J46597_1002850 JGI25165J46597_10028505 156
319 3300003320 rootH2_10001334 rootH2_1000133419 156
320 3300003320 rootH2_10041545 rootH2_100415453 156
321 3300003320 rootH2_10266715 rootH2_102667152 156
322 3300003323 rootH1_10017298 rootH1_100172989 156
323 3300003323 rootH1_10190008 rootH1_101900082 156
324 3300003323 rootH1_10191747 rootH1_101917476 156
325 3300004799 Ga0058863_11560710 Ga0058863_115607102 156
326 3300005288 Ga0065714_10266310 Ga0065714_102663102 156
327 3300005289 Ga0065704_10286111 Ga0065704_102861112 156
328 3300005327 Ga0070658_10001193 Ga0070658_1000119315 156
329 3300005327 Ga0070658_10073466 Ga0070658_100734662 156
330 3300005327 Ga0070658_10665976 Ga0070658_106659761 156
331 3300005329 Ga0070683_100744376 Ga0070683_1007443761 156
332 3300005334 Ga0068869_101865636 Ga0068869_1018656361 156
333 3300005336 Ga0070680_100249628 Ga0070680_1002496282 156
334 3300005339 Ga0070660_100086538 Ga0070660_1000865382 156
335 3300005339 Ga0070660_100657047 Ga0070660_1006570471 156
336 3300005339 Ga0070660_100710381 Ga0070660_1007103811 156
337 3300005339 Ga0070660_101646264 Ga0070660_1016462641 156
338 3300005355 Ga0070671_100001929 Ga0070671_10000192910 156
339 3300005366 Ga0070659_100105121 Ga0070659_1001051212 156
340 3300005457 Ga0070662_100000011 Ga0070662_10000001134 156
341 3300005458 Ga0070681_10016457 Ga0070681_100164572 156
342 3300005530 Ga0070679_100077453 Ga0070679_1000774532 156
343 3300005530 Ga0070679_100198391 Ga0070679_1001983912 156
344 3300005530 Ga0070679_101018515 Ga0070679_1010185151 156
345 3300005539 Ga0068853_100021688 Ga0068853_1000216884 156
346 3300005539 Ga0068853_100272122 Ga0068853_1002721222 156
347 3300005548 Ga0070665_100000003 Ga0070665_100000003158 156
348 3300005563 Ga0068855_100000154 Ga0068855_10000015479 156
349 3300005563 Ga0068855_100069500 Ga0068855_1000695002 156
350 3300005614 Ga0068856_100003065 Ga0068856_10000306526 156
351 3300005614 Ga0068856_100036671 Ga0068856_1000366712 156
352 3300006237 Ga0097621_100273481 Ga0097621_1002734812 156
353 3300009093 Ga0105240_10000126 Ga0105240_1000012673 156
354 3300009093 Ga0105240_10007367 Ga0105240_100073678 156
355 3300009093 Ga0105240_10022807 Ga0105240_100228076 156
356 3300009093 Ga0105240_10158153 Ga0105240_101581532 156
357 3300009093 Ga0105240_10629887 Ga0105240_106298872 156
358 3300009093 Ga0105240_10852703 Ga0105240_108527032 156
359 3300009148 Ga0105243_10932017 Ga0105243_109320172 156
360 3300009174 Ga0105241_10004170 Ga0105241_100041709 156
361 3300009174 Ga0105241_10005229 Ga0105241_100052297 156
362 3300009545 Ga0105237_10000369 Ga0105237_100003698 156
363 3300009545 Ga0105237_10000693 Ga0105237_1000069328 156
364 3300009545 Ga0105237_10412748 Ga0105237_104127482 156
365 3300009551 Ga0105238_10066500 Ga0105238_100665002 156
366 3300009551 Ga0105238_10203312 Ga0105238_102033121 156
367 3300010375 Ga0105239_10000005 Ga0105239_10000005276 156
368 3300010375 Ga0105239_10004103 Ga0105239_100041037 156
369 3300010375 Ga0105239_10008586 Ga0105239_1000858610 156
370 3300010375 Ga0105239_10095629 Ga0105239_100956295 156
371 3300010375 Ga0105239_10965464 Ga0105239_109654642 156
372 3300011119 Ga0105246_10164155 Ga0105246_101641552 156
373 3300013100 Ga0157373_10211255 Ga0157373_102112552 156
374 3300013102 Ga0157371_10004511 Ga0157371_100045116 156
375 3300013102 Ga0157371_10060197 Ga0157371_100601972 156
376 3300013104 Ga0157370_10704489 Ga0157370_107044891 156
377 3300013105 Ga0157369_10000039 Ga0157369_10000039127 156
378 3300013105 Ga0157369_10128134 Ga0157369_101281342 156
379 3300013296 Ga0157374_10001810 Ga0157374_1000181011 156
380 3300013296 Ga0157374_10003984 Ga0157374_100039845 156
381 3300013296 Ga0157374_10128206 Ga0157374_101282062 156
382 3300013297 Ga0157378_10033060 Ga0157378_100330606 156
383 3300013297 Ga0157378_10152286 Ga0157378_101522862 156
384 3300013306 Ga0163162_10000024 Ga0163162_10000024129 156
385 3300013306 Ga0163162_10011025 Ga0163162_100110257 156
386 3300013307 Ga0157372_10000001 Ga0157372_10000001230 156
387 3300013307 Ga0157372_10136124 Ga0157372_101361241 156
388 3300013307 Ga0157372_10582955 Ga0157372_105829552 156
389 3300013308 Ga0157375_10031178 Ga0157375_100311783 156
390 3300013308 Ga0157375_10049189 Ga0157375_100491894 156
391 3300013308 Ga0157375_11104470 Ga0157375_111044702 156
392 3300014326 Ga0157380_10000577 Ga0157380_100005776 156
393 3300015262 Ga0182007_10031939 Ga0182007_100319392 156
394 3300021361 Ga0213872_10044569 Ga0213872_100445692 156
395 3300025230 Ga0209563_104904 Ga0209563_1049043 156
396 3300025231 Ga0207427_100337 Ga0207427_1003372 156
397 3300025233 Ga0209437_100008 Ga0209437_100008169 156
398 3300025261 Ga0209233_1000024 Ga0209233_1000024490 156
399 3300025904 Ga0207647_10000320 Ga0207647_1000032030 156
400 3300025909 Ga0207705_10000916 Ga0207705_1000091611 156
401 3300025909 Ga0207705_10410399 Ga0207705_104103992 156
402 3300025909 Ga0207705_10490022 Ga0207705_104900221 156
403 3300025911 Ga0207654_10004213 Ga0207654_100042137 156
404 3300025911 Ga0207654_10033112 Ga0207654_100331122 156
405 3300025912 Ga0207707_10226646 Ga0207707_102266463 156
406 3300025913 Ga0207695_10002316 Ga0207695_1000231612 156
407 3300025913 Ga0207695_10005491 Ga0207695_1000549110 156
408 3300025913 Ga0207695_10282213 Ga0207695_102822132 156
409 3300025913 Ga0207695_10446380 Ga0207695_104463801 156
410 3300025914 Ga0207671_10001816 Ga0207671_1000181612 156
411 3300025914 Ga0207671_11493536 Ga0207671_114935361 156
412 3300025917 Ga0207660_10021308 Ga0207660_100213082 156
413 3300025919 Ga0207657_10095699 Ga0207657_100956992 156
414 3300025919 Ga0207657_10436433 Ga0207657_104364331 156
415 3300025920 Ga0207649_11070707 Ga0207649_110707072 156
416 3300025921 Ga0207652_10116971 Ga0207652_101169712 156
417 3300025921 Ga0207652_10117117 Ga0207652_101171172 156
418 3300025921 Ga0207652_11163589 Ga0207652_111635891 156
419 3300025924 Ga0207694_10033806 Ga0207694_100338062 156
420 3300025931 Ga0207644_10006890 Ga0207644_100068909 156
421 3300025932 Ga0207690_10292353 Ga0207690_102923531 156
422 3300025933 Ga0207706_10000399 Ga0207706_1000039910 156
423 3300025934 Ga0207686_10120667 Ga0207686_101206671 156
424 3300025944 Ga0207661_10558389 Ga0207661_105583891 156
425 3300025949 Ga0207667_10000458 Ga0207667_1000045833 156
426 3300025949 Ga0207667_10094727 Ga0207667_100947272 156
427 3300025949 Ga0207667_10127198 Ga0207667_101271983 156
428 3300025981 Ga0207640_10771356 Ga0207640_107713561 156
429 3300026023 Ga0207677_11401949 Ga0207677_114019491 156
430 3300026041 Ga0207639_10015809 Ga0207639_100158094 156
431 3300026067 Ga0207678_10028897 Ga0207678_100288973 156
432 3300026078 Ga0207702_10002053 Ga0207702_1000205320 156
433 3300026078 Ga0207702_10010569 Ga0207702_100105692 156
434 3300026078 Ga0207702_10014916 Ga0207702_100149162 156
435 3300027907 Ga0207428_10040953 Ga0207428_100409532 156
436 3300028379 Ga0268266_10000380 Ga0268266_1000038046 156
437 3300028786 Ga0307517_10018211 Ga0307517_100182112 156
438 3300028800 Ga0265338_10020261 Ga0265338_100202617 156
439 3300031251 Ga0265327_10321588 Ga0265327_103215881 156
440 3300031665 Ga0316575_10357306 Ga0316575_103573061 156
441 3300031728 Ga0316578_10049891 Ga0316578_100498912 156
442 3300031733 Ga0316577_10484275 Ga0316577_104842751 156
443 3300031911 Ga0307412_10582936 Ga0307412_105829362 156
444 3300031911 Ga0307412_10850280 Ga0307412_108502801 156
445 3300032139 Ga0316580_10012184 Ga0316580_100121843 156
446 3300033180 Ga0307510_10088124 Ga0307510_100881241 156
447 3300035115 Ga0373941_0010000 Ga0373941_0010000_865_1335 156
448 3300036647 Ga0316582_0081755 Ga0316582_0081755_1515_1994 156
449 3300036712 Ga0316584_0109064 Ga0316584_0109064_1157_1636 156
450 3300037312 Ga0395899_0000342 Ga0395899_0000342_24586_25056 156
451 3300037312 Ga0395899_0094312 Ga0395899_0094312_620_1090 156
452 3300037418 Ga0395900_0957407 Ga0395900_0957407_151_621 156
453 3300037466 Ga0395898_0151221 Ga0395898_0151221_1690_2160 156
454 3300037471 Ga0395905_0000278 Ga0395905_0000278_12840_13310 156
455 3300038443 Ga0395901_0095935 Ga0395901_0095935_699_1169 156
456 3300038443 Ga0395901_0514646 Ga0395901_0514646_333_803 156
457 3300039447 Ga0436361_0255105 Ga0436361_0255105_20579_21049 156
458 3300044656 Ga0466969_0029203 Ga0466969_0029203_1665_2135 156
459 3300044684 Ga0466966_0006438 Ga0466966_0006438_790_1260 156
460 3300045049 Ga0466959_0309372 Ga0466959_0309372_180_650 156
461 3300045049 Ga0466959_0394457 Ga0466959_0394457_20_493 156
462 3300045836 Ga0466958_0024872 Ga0466958_0024872_718_1188 156
463 3300046454 Ga0495592_0798118 Ga0495592_0798118_72_542 156
464 3300046500 Ga0495596_0111884 Ga0495596_0111884_144_614 156
465 3300046507 Ga0495606_0307295 Ga0495606_0307295_177_647 156
466 3300046518 Ga0495631_0164347 Ga0495631_0164347_464_934 156
467 3300046523 Ga0495644_0092792 Ga0495644_0092792_281_751 156
468 3300046528 Ga0495642_0114285 Ga0495642_0114285_169_639 156
469 3300046665 Ga0495661_0002029 Ga0495661_0002029_5390_5860 156
470 3300047319 Ga0495674_1315786 Ga0495674_1315786_59_529 156
471 3300047323 Ga0495683_0008615 Ga0495683_0008615_4680_5150 156
472 3300047443 Ga0495687_002833 Ga0495687_002833_10191_10661 156
473 3300047472 Ga0495686_0001308 Ga0495686_0001308_12290_12760 156
474 3300048918 Ga0496115_0574659 Ga0496115_0574659_415_885 156
475 3300048929 Ga0496126_0294629 Ga0496126_0294629_96_566 156
476 3300050493 nmdc:mga0k408_295_c2 nmdc:mga0k408_295_c2_14980_15453 156
477 3300050511 nmdc:mga08y16_19399_c1 nmdc:mga08y16_19399_c1_2470_2940 156
478 3300053080 Ga0500635_0111090 Ga0500635_0111090_269_739 156
479 3300053122 Ga0500608_000315 Ga0500608_000315_13991_14461 156
480 3300053130 Ga0500642_0059641 Ga0500642_0059641_794_1264 156
481 3300053156 Ga0500622_0000121 Ga0500622_0000121_35345_35815 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00075

RNase_H

RNase H

20

157

0.91

PF13456

RVT_3

Reverse transcriptase-like

26

109

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h08-assembly1.cif.gz_A crystal structure of the ribonuclease h1 from chlorobium tepidum 0.9608 2 136
3h08-assembly2.cif.gz_B crystal structure of the ribonuclease h1 from chlorobium tepidum 0.9504 2 136
1jl2-assembly1.cif.gz_B crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h 0.9454 2 146
1wsj-assembly3.cif.gz_C crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9395 2 146
1goc-assembly1.cif.gz_A cooperative stabilization of escherichia coli ribonuclease hi by insertion of gly-80b and gly-77-> ala substitution 0.9368 1 143
ID Description Score Start End Superfamily
af_A0A0R0EHL2_85_153_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9706 1 54 3.30.420.10
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9175 2 146 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9114 2 143 3.30.420.10
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8906 2 146 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8696 2 143 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2R7K4D4-F1-model_v4 Ribonuclease HI 1.003 1 65 GO:0003676
GO:0004523
AF-A0A1I2VFF9-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9988 1 150 GO:0003676
GO:0004523
GO:0043137
AF-A0A2D5JIX7-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9975 1 150 GO:0003676
GO:0004523
GO:0043137
AF-A0A2M8FTY5-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9966 1 150 GO:0003676
GO:0004523
GO:0043137
AF-A0A2P8CI21-F1-model_v4 ribonuclease H (EC 3.1.26.4) 0.9962 2 144 GO:0003676
GO:0004523
GO:0043137

Feature Viewer

pLDDT pTM Quality
94.42 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map