F452402

General Info

Members Datasets Scaffolds Average Seq Length
481 331 962 141

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_11414701|Ga0157370_114147012
Length 160
Sequence MYVKRKNIQYVRKLKRSNEMKSTSYYPVIMTGDVAATAAFYMTHFRFQALFESDWYVHLQSAEDERINLAILDGSHETIPEQARGRVSGLLLNFEVEDVDTIYAACKTAGLPIMRDLRDEDFGQRHFITADPNGVLIDIIKPIPPSAEFAAMYDASALPA

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
54 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
55 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
81 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
100 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
101 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
102 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
105 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
106 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
107 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
108 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
109 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
110 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
111 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
112 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
113 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
114 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
115 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
116 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
119 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
120 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
123 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
124 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
125 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
126 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
181 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
194 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
200 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
201 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
202 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
203 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
204 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
205 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
206 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
207 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
208 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
209 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
210 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
211 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
212 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
213 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
214 2519899620 Rhizobium sp. Pop5 Isolate Nodule
215 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
216 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
217 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
218 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
219 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
220 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
221 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
222 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
223 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
224 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
225 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
226 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
227 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
228 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
229 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
230 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
231 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
232 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
233 2643221573 Lysobacter sp. Root604 Isolate Unclassified
234 2643221607 Rhizobium sp. Root73 Isolate Unclassified
235 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
236 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
237 2643221683 Variovorax sp. Root473 Isolate Unclassified
238 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
239 2643221688 Rhizobium sp. Root482 Isolate Unclassified
240 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
241 2643221720 Lysobacter sp. Root916 Isolate Unclassified
242 2643221728 Lysobacter sp. Root983 Isolate Unclassified
243 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
244 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
245 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
246 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
247 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
248 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
249 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
250 2791355256 Rhizobium sp. M10 Isolate Nodule
251 2791355261 Rhizobium sp. J15 Isolate Nodule
252 2791355262 Rhizobium sp. M1 Isolate Nodule
253 2791355265 Rhizobium sp. H4 Isolate Nodule
254 2791355266 Rhizobium sp. L43 Isolate Nodule
255 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
256 2802429633 Rhizobium anhuiense J3 Isolate Nodule
257 2802429634 Rhizobium anhuiense S10 Isolate Nodule
258 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
259 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
260 2802429637 Rhizobium anhuiense C15 Isolate Nodule
261 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
262 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
263 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
264 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
265 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
266 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
267 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
268 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
269 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
270 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
271 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
272 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
273 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
274 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
275 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
276 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
277 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
278 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
279 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
280 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
281 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
282 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
283 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
284 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
285 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
286 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
287 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
288 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
289 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
290 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
291 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
292 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
293 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
294 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
295 2928070936 Variovorax gossypii 1167 Isolate Unclassified
296 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
297 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
298 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
299 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
300 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
301 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
302 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
303 2996893221 Rhizobium sp. R635 Isolate Nodule
304 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
305 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
306 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
307 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
308 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
309 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
310 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
311 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
312 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
313 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
314 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
315 8005382845 Rhizobium sp. R634 Isolate Nodule
316 8005395548 Rhizobium sp. R339 Isolate Nodule
317 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
318 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
319 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
320 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
321 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
322 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
323 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
324 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
325 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
326 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
327 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
328 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
329 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
330 8024501048 Rhizobium sp. H4 Isolate Nodule
331 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.18
Metatranscriptomes 0
Isolates 26.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.69
Nodule 17.67
Rhizoplane 3.33
Rhizosphere 31.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_11414701 3300013104 Bacteria 626
2 JGI25152J39213_1003306 3300002773 Bacteria 5563
3 JGI25152J39213_1016576 3300002773 Bacteria 1417
4 JGI25150J39212_1002023 3300002774 Bacteria 5279
5 JGI25159J45721_1006082 3300002987 Bacteria 3666
6 JGI25159J45721_1028542 3300002987 Bacteria 930
7 JGI25151J46595_10001841 3300003187 Bacteria 13651
8 JGI25151J46595_10003849 3300003187 Bacteria 8119
9 JGI25151J46595_10006423 3300003187 Bacteria 5911
10 JGI25165J46597_1004474 3300003214 Bacteria 2983
11 JGI25153J46596_10002450 3300003215 Bacteria 10699
12 JGI25153J46596_10006473 3300003215 Bacteria 5911
13 rootH1_10070669 3300003316 Bacteria 4665
14 rootH2_10096900 3300003320 Bacteria 1452
15 rootL2_10173186 3300003322 Bacteria 2902
16 JGI25160J50197_1001905 3300003354 Bacteria 9991
17 JGI25160J50197_1009417 3300003354 Bacteria 3624
18 JGI25160J50197_1035407 3300003354 Bacteria 1225
19 JGI25161J50226_1002126 3300003374 Bacteria 5323
20 JGI25161J50226_1003374 3300003374 Bacteria 3681
21 Ga0055539_1005935 3300003752 Bacteria 1573
22 Ga0055526_1000562 3300003771 Bacteria 29362
23 Ga0055526_1006015 3300003771 Bacteria 6733
24 Ga0055526_1012689 3300003771 Bacteria 3645
25 Ga0055526_1015494 3300003771 Bacteria 3058
26 Ga0055537_1005017 3300003773 Bacteria 3630
27 Ga0055524_1001572 3300003775 Bacteria 12837
28 Ga0055524_1006120 3300003775 Bacteria 5264
29 Ga0055524_1010658 3300003775 Bacteria 3645
30 Ga0055524_1043490 3300003775 Bacteria 1104
31 Ga0055536_1000729 3300003781 Bacteria 22105
32 Ga0055534_1002865 3300003784 Bacteria 5736
33 Ga0055528_1000954 3300003790 Bacteria 19173
34 Ga0055528_1007348 3300003790 Bacteria 4880
35 Ga0055528_1011000 3300003790 Bacteria 3630
36 Ga0055528_1020713 3300003790 Bacteria 2122
37 Ga0055540_1000874 3300003792 Bacteria 19972
38 Ga0055540_1031352 3300003792 Bacteria 1222
39 Ga0055531_10110726 3300003794 Bacteria 548
40 Ga0055543_1000650 3300004625 Bacteria 18444
41 Ga0055543_1001944 3300004625 Bacteria 7373
42 Ga0065165_1000072 3300005262 Bacteria 165049
43 Ga0065165_1005274 3300005262 Bacteria 7373
44 Ga0065165_1013893 3300005262 Bacteria 3164
45 Ga0065165_1068144 3300005262 Bacteria 953
46 Ga0070660_100580907 3300005339 Bacteria 936
47 Ga0070669_100288796 3300005353 Bacteria 1316
48 Ga0070667_100020712 3300005367 Bacteria 5461
49 Ga0070663_101206172 3300005455 Bacteria 665
50 Ga0070665_100072449 3300005548 Bacteria 3453
51 Ga0070665_100963470 3300005548 Bacteria 866
52 Ga0068855_100045008 3300005563 Bacteria 5220
53 Ga0068855_100046688 3300005563 Bacteria 5119
54 Ga0068857_100636423 3300005577 Bacteria 1010
55 Ga0068854_100008048 3300005578 Bacteria 6756
56 Ga0068852_100278348 3300005616 Bacteria 1612
57 Ga0075363_100011984 3300006048 Bacteria 4168
58 Ga0075363_100204109 3300006048 Bacteria 1130
59 Ga0075364_10066973 3300006051 Bacteria 2360
60 Ga0075364_11051895 3300006051 Bacteria 553
61 Ga0075367_10002604 3300006178 Bacteria 8287
62 Ga0075367_10430070 3300006178 Bacteria 836
63 Ga0075369_10005260 3300006186 Bacteria 4825
64 Ga0075369_10177077 3300006186 Bacteria 980
65 Ga0075369_10636059 3300006186 Bacteria 512
66 Ga0075366_10003470 3300006195 Bacteria 8323
67 Ga0075366_10095246 3300006195 Bacteria 1785
68 Ga0075370_10034592 3300006353 Bacteria 2832
69 Ga0075370_10494401 3300006353 Bacteria 738
70 Ga0079104_1000063 3300006946 Bacteria 159519
71 Ga0099826_10000039 3300006948 Bacteria 99286
72 Ga0105251_10109610 3300009011 Bacteria 1258
73 Ga0105244_10040463 3300009036 Bacteria 2420
74 Ga0105240_10000012 3300009093 Bacteria 496639
75 Ga0105243_10000875 3300009148 Bacteria 28415
76 Ga0105237_10001271 3300009545 Bacteria 33636
77 Ga0105237_11470249 3300009545 Bacteria 688
78 Ga0105239_10005397 3300010375 Bacteria 15006
79 Ga0105239_10079004 3300010375 Bacteria 3621
80 Ga0157373_10257941 3300013100 Bacteria 1234
81 Ga0157373_11219558 3300013100 Bacteria 567
82 Ga0157370_10001804 3300013104 Bacteria 26400
83 Ga0157370_11168103 3300013104 Bacteria 695
84 Ga0157369_10004268 3300013105 Bacteria 16899
85 Ga0157369_11331926 3300013105 Bacteria 732
86 Ga0157372_10794576 3300013307 Bacteria 1100
87 Ga0182008_10017425 3300014497 Bacteria 3726
88 Ga0182007_10009304 3300015262 Bacteria 3971
89 Ga0182005_1003228 3300015265 Bacteria 5573
90 Ga0214544_1000652 3300021320 Bacteria 65892
91 Ga0214542_1000146 3300021321 Bacteria 103035
92 Ga0214543_1000054 3300021327 Bacteria 140288
93 Ga0209436_109717 3300025208 Bacteria 1808
94 Ga0207425_1000180 3300025245 Bacteria 52117
95 Ga0207425_1003975 3300025245 Bacteria 4547
96 Ga0207425_1042258 3300025245 Bacteria 864
97 Ga0209677_100556 3300025253 Bacteria 20628
98 Ga0209129_1000111 3300025258 Bacteria 148853
99 Ga0209129_1000203 3300025258 Bacteria 70739
100 Ga0209129_1000568 3300025258 Bacteria 25490
101 Ga0209129_1031523 3300025258 Bacteria 882
102 Ga0209233_1000161 3300025261 Bacteria 158607
103 Ga0209565_1000110 3300025263 Bacteria 119879
104 Ga0209673_1000037 3300025273 Bacteria 313804
105 Ga0209673_1000426 3300025273 Bacteria 73424
106 Ga0209673_1000670 3300025273 Bacteria 49698
107 Ga0209673_1005902 3300025273 Bacteria 6054
108 Ga0209673_1011858 3300025273 Bacteria 3559
109 Ga0209673_1077315 3300025273 Bacteria 773
110 Ga0209130_1000125 3300025284 Bacteria 124425
111 Ga0209130_1000205 3300025284 Bacteria 79260
112 Ga0209130_1002110 3300025284 Bacteria 10605
113 Ga0209675_1000192 3300025291 Bacteria 66905
114 Ga0209675_1001738 3300025291 Bacteria 11985
115 Ga0209676_1000484 3300025292 Bacteria 65041
116 Ga0209676_1044315 3300025292 Bacteria 1221
117 Ga0209676_1059260 3300025292 Bacteria 962
118 Ga0209025_1000116 3300025294 Bacteria 218293
119 Ga0209025_1000354 3300025294 Bacteria 98665
120 Ga0209025_1000566 3300025294 Bacteria 67702
121 Ga0209025_1031713 3300025294 Bacteria 2492
122 Ga0209025_1052349 3300025294 Bacteria 1612
123 Ga0209025_1073252 3300025294 Bacteria 1203
124 Ga0209564_1000155 3300025295 Bacteria 165859
125 Ga0209564_1000207 3300025295 Bacteria 135313
126 Ga0209564_1000379 3300025295 Bacteria 81420
127 Ga0209758_1000107 3300025297 Bacteria 218293
128 Ga0209758_1000674 3300025297 Bacteria 50969
129 Ga0209758_1004194 3300025297 Bacteria 12234
130 Ga0209758_1017850 3300025297 Bacteria 3508
131 Ga0209758_1068919 3300025297 Bacteria 1124
132 Ga0209256_1000087 3300025299 Bacteria 218290
133 Ga0209256_1000758 3300025299 Bacteria 41985
134 Ga0209256_1001345 3300025299 Bacteria 26077
135 Ga0209256_1001773 3300025299 Bacteria 20488
136 Ga0209256_1006537 3300025299 Bacteria 6118
137 Ga0207426_1000123 3300025302 Bacteria 218290
138 Ga0207426_1000296 3300025302 Bacteria 98032
139 Ga0207426_1000474 3300025302 Bacteria 61569
140 Ga0207426_1010167 3300025302 Bacteria 3672
141 Ga0207426_1064804 3300025302 Bacteria 1038
142 Ga0207426_1110173 3300025302 Bacteria 695
143 Ga0209051_1000636 3300025303 Bacteria 40363
144 Ga0209051_1007062 3300025303 Bacteria 6211
145 Ga0209051_1033281 3300025303 Bacteria 1951
146 Ga0209051_1037257 3300025303 Bacteria 1786
147 Ga0209051_1040409 3300025303 Bacteria 1672
148 Ga0209051_1048253 3300025303 Bacteria 1445
149 Ga0209257_1006616 3300025304 Bacteria 7376
150 Ga0209257_1016240 3300025304 Bacteria 3026
151 Ga0207695_10000097 3300025913 Bacteria 262517
152 Ga0207695_10366754 3300025913 Bacteria 1326
153 Ga0207671_10000289 3300025914 Bacteria 74385
154 Ga0207681_10239778 3300025923 Bacteria 1411
155 Ga0207694_10668560 3300025924 Bacteria 875
156 Ga0207694_11050778 3300025924 Bacteria 689
157 Ga0207709_10000389 3300025935 Bacteria 43589
158 Ga0207667_10082349 3300025949 Bacteria 3334
159 Ga0207658_10036414 3300025986 Bacteria 3528
160 Ga0209281_1000110 3300027111 Bacteria 215631
161 Ga0209282_1000058 3300027666 Bacteria 99152
162 Ga0209813_10026714 3300027866 Bacteria 1671
163 Ga0268266_11182979 3300028379 Bacteria 739
164 Ga0268266_11348678 3300028379 Bacteria 689
165 Ga0265337_1019994 3300028556 Bacteria 2104
166 Ga0265326_10010068 3300028558 Bacteria 2815
167 Ga0265334_10003173 3300028573 Bacteria 7503
168 Ga0265323_10003552 3300028653 Bacteria 6863
169 Ga0265336_10000104 3300028666 Bacteria 64094
170 Ga0307515_10000285 3300028794 Bacteria 124535
171 Ga0307515_10027939 3300028794 Bacteria 9612
172 Ga0307515_10315337 3300028794 Bacteria 1235
173 Ga0265338_10000137 3300028800 Bacteria 135705
174 Ga0307513_10436181 3300031456 Bacteria 1037
175 Ga0307408_100036635 3300031548 Bacteria 3450
176 Ga0307405_10025479 3300031731 Bacteria 3397
177 Ga0307405_10100910 3300031731 Bacteria 1935
178 Ga0307405_11483338 3300031731 Bacteria 595
179 Ga0307413_10727427 3300031824 Bacteria 827
180 Ga0307410_10432208 3300031852 Bacteria 1070
181 Ga0307406_10003654 3300031901 Bacteria 8379
182 Ga0307406_10025129 3300031901 Bacteria 3564
183 Ga0307409_100138223 3300031995 Bacteria 2095
184 Ga0307411_10096263 3300032005 Bacteria 2080
185 Ga0439436_0019228 3300041404 Bacteria 2039
186 Ga0439436_0069911 3300041404 Bacteria 979
187 Ga0439436_0168031 3300041404 Bacteria 622
188 Ga0439439_0014957 3300041406 Bacteria 1892
189 Ga0439447_045362 3300041407 Bacteria 1061
190 Ga0439466_0141204 3300041411 Bacteria 739
191 Ga0439465_0017320 3300041413 Bacteria 2249
192 Ga0439465_0058018 3300041413 Bacteria 1279
193 Ga0451795_0431751 3300041456 Bacteria 926
194 Ga0451802_1417467 3300041460 Bacteria 515
195 Ga0451833_0058447 3300041491 Bacteria 752
196 Ga0451833_0423803 3300041491 Bacteria 1287
197 Ga0451835_0025022 3300041492 Bacteria 4591
198 Ga0451835_0587763 3300041492 Bacteria 739
199 Ga0451837_1195521 3300041494 Bacteria 747
200 Ga0451837_1313381 3300041494 Bacteria 1149
201 Ga0451839_0865211 3300041496 Bacteria 856
202 Ga0451841_1207741 3300041498 Bacteria 646
203 Ga0451845_0189690 3300041501 Bacteria 5806
204 Ga0451847_0407225 3300041503 Bacteria 3145
205 Ga0451849_1528707 3300041505 Bacteria 1392
206 Ga0451851_0631607 3300041507 Bacteria 1299
207 Ga0451843_0272987 3300041509 Bacteria 1959
208 Ga0451855_0989568 3300041511 Bacteria 1159
209 Ga0451855_2042030 3300041511 Bacteria 1790
210 Ga0451853_2899099 3300041512 Bacteria 1289
211 Ga0439431_0169816 3300041997 Bacteria 626
212 Ga0439442_150485 3300042002 Bacteria 518
213 Ga0439445_0170174 3300042004 Bacteria 638
214 Ga0439449_0145376 3300042007 Bacteria 884
215 Ga0439452_075985 3300042010 Bacteria 736
216 Ga0439452_090676 3300042010 Bacteria 661
217 Ga0450920_033874 3300042122 Bacteria 1010
218 Ga0450906_010034 3300042145 Bacteria 1796
219 Ga0450918_000905 3300042531 Bacteria 6223
220 Ga0495591_123417 3300046458 Bacteria 631
221 Ga0495638_0119641 3300046460 Bacteria 1557
222 Ga0495638_0284755 3300046460 Bacteria 896
223 Ga0495638_0534139 3300046460 Bacteria 585
224 Ga0495650_0045045 3300046471 Bacteria 1860
225 Ga0495650_0105142 3300046471 Bacteria 1055
226 Ga0495605_0015928 3300046474 Bacteria 4079
227 Ga0495605_0122411 3300046474 Bacteria 1178
228 Ga0495585_0073155 3300046492 Bacteria 1866
229 Ga0495585_0090720 3300046492 Bacteria 1646
230 Ga0495596_0000738 3300046500 Bacteria 20164
231 Ga0495607_0008050 3300046501 Bacteria 7238
232 Ga0495583_0046252 3300046506 Bacteria 2008
233 Ga0495606_0037728 3300046507 Bacteria 3278
234 Ga0495606_0044419 3300046507 Bacteria 2955
235 Ga0495610_0002945 3300046512 Bacteria 13742
236 Ga0495610_0019160 3300046512 Bacteria 3837
237 Ga0495610_0084029 3300046512 Bacteria 1455
238 Ga0495610_0220437 3300046512 Bacteria 766
239 Ga0495616_0034897 3300046513 Bacteria 2607
240 Ga0495616_0037836 3300046513 Bacteria 2479
241 Ga0495620_0056393 3300046515 Bacteria 1652
242 Ga0495632_0060127 3300046519 Bacteria 1847
243 Ga0495643_0052037 3300046522 Bacteria 2200
244 Ga0495643_0067686 3300046522 Bacteria 1880
245 Ga0495643_0446863 3300046522 Bacteria 563
246 Ga0495648_0109684 3300046524 Bacteria 1504
247 Ga0495609_0000943 3300046538 Bacteria 21055
248 Ga0495609_0086479 3300046538 Bacteria 1367
249 Ga0495597_0188362 3300046542 Bacteria 831
250 Ga0495633_0007601 3300046558 Bacteria 6211
251 Ga0495633_0057257 3300046558 Bacteria 1831
252 Ga0495656_0367284 3300046615 Bacteria 748
253 Ga0495656_0441287 3300046615 Bacteria 685
254 Ga0495625_0037308 3300046660 Bacteria 3566
255 Ga0495625_0065573 3300046660 Bacteria 2559
256 Ga0495661_0010519 3300046665 Bacteria 6310
257 Ga0495588_0085400 3300046674 Bacteria 1650
258 Ga0495670_0038029 3300046691 Bacteria 2399
259 Ga0495671_0001086 3300046692 Bacteria 18821
260 Ga0495649_0011484 3300046694 Bacteria 5192
261 Ga0495649_0026554 3300046694 Bacteria 3219
262 Ga0495649_0214823 3300046694 Bacteria 996
263 Ga0495660_0169450 3300046810 Bacteria 1064
264 Ga0495672_0002271 3300047320 Bacteria 17861
265 Ga0495672_0528807 3300047320 Bacteria 520
266 Ga0495683_0262811 3300047323 Bacteria 753
267 Ga0495685_080747 3300047447 Bacteria 1083
268 Ga0495673_0067724 3300047469 Bacteria 1510
269 Ga0495673_0153688 3300047469 Bacteria 888
270 Ga0495686_0031679 3300047472 Bacteria 3426
271 Ga0495615_0009826 3300048090 Bacteria 1894
272 Ga0496100_0242040 3300048903 Bacteria 1331
273 Ga0496101_0092727 3300048904 Bacteria 2249
274 Ga0496103_0047279 3300048906 Bacteria 2658
275 Ga0496106_0003583 3300048909 Bacteria 11571
276 Ga0496106_0128093 3300048909 Bacteria 1989
277 Ga0496106_0156112 3300048909 Bacteria 1802
278 Ga0496107_0070478 3300048910 Bacteria 2538
279 Ga0496113_0127353 3300048916 Bacteria 1995
280 Ga0496113_1315248 3300048916 Bacteria 562
281 Ga0496114_0109193 3300048917 Bacteria 2369
282 Ga0496116_0014321 3300048919 Bacteria 6339
283 Ga0496116_0016495 3300048919 Bacteria 5775
284 Ga0496116_0030810 3300048919 Bacteria 3849
285 Ga0496116_0324914 3300048919 Bacteria 718
286 Ga0496116_0359465 3300048919 Bacteria 663
287 Ga0496117_0483545 3300048920 Bacteria 604
288 Ga0496118_0006891 3300048921 Bacteria 12302
289 Ga0496118_0014905 3300048921 Bacteria 7240
290 Ga0496119_0089645 3300048922 Bacteria 1751
291 Ga0496119_0408245 3300048922 Bacteria 647
292 Ga0496120_0019402 3300048923 Bacteria 4350
293 Ga0496121_0005527 3300048924 Bacteria 16152
294 Ga0496121_0010414 3300048924 Bacteria 10492
295 Ga0496121_0011115 3300048924 Bacteria 10045
296 Ga0496121_0036881 3300048924 Bacteria 4350
297 Ga0496121_0110756 3300048924 Bacteria 2094
298 Ga0496121_0568675 3300048924 Bacteria 706
299 Ga0496122_0010611 3300048925 Bacteria 9462
300 Ga0496122_0012504 3300048925 Bacteria 8439
301 Ga0496122_0015579 3300048925 Bacteria 7256
302 Ga0496122_0256138 3300048925 Bacteria 975
303 Ga0496122_0267392 3300048925 Bacteria 944
304 Ga0496123_0002314 3300048926 Bacteria 23928
305 Ga0496123_0003695 3300048926 Bacteria 16847
306 Ga0496123_0021755 3300048926 Bacteria 4972
307 Ga0496123_0168276 3300048926 Bacteria 1159
308 Ga0496124_0007502 3300048927 Bacteria 11582
309 Ga0496124_0014927 3300048927 Bacteria 7479
310 Ga0496124_0146774 3300048927 Bacteria 1855
311 Ga0496124_0617528 3300048927 Bacteria 702
312 Ga0496125_0022386 3300048928 Bacteria 5870
313 Ga0496125_0085958 3300048928 Bacteria 2381
314 Ga0496125_0614801 3300048928 Bacteria 591
315 Ga0496126_0000522 3300048929 Bacteria 74922
316 Ga0496126_0012811 3300048929 Bacteria 8571
317 Ga0496126_0156564 3300048929 Bacteria 1949
318 Ga0496126_0386811 3300048929 Bacteria 1137
319 Ga0496126_0583990 3300048929 Bacteria 882
320 Ga0496126_1021689 3300048929 Bacteria 619
321 Ga0501034_0010344 3300049571 Bacteria 9723
322 Ga0501034_0107266 3300049571 Bacteria 2785
323 Ga0501034_0490021 3300049571 Bacteria 1144
324 Ga0501040_0742398 3300049576 Bacteria 710
325 Ga0501043_0556925 3300049579 Bacteria 851
326 Ga0501070_0540242 3300049586 Bacteria 934
327 Ga0501238_055607 3300049671 Bacteria 598
328 Ga0501280_001541 3300049776 Bacteria 4181
329 nmdc:mga03683_1842_c1 3300050489 Bacteria 6441
330 nmdc:mga03n38_111186_c1 3300050490 Bacteria 1334
331 nmdc:mga03n38_584122_c1 3300050490 Bacteria 635
332 nmdc:mga00v17_37735_c2 3300050491 Bacteria 2483
333 nmdc:mga0yw44_13340_c1 3300050492 Bacteria 4323
334 nmdc:mga0k408_4827_c1 3300050493 Bacteria 7150
335 nmdc:mga06z11_14133_c1 3300050494 Bacteria 3528
336 nmdc:mga04h51_9894_c1 3300050495 Bacteria 2602
337 nmdc:mga07m45_5581_c1 3300050496 Bacteria 6280
338 nmdc:mga0sz30_4147_c1 3300050516 Bacteria 5222
339 Ga0500578_0107158 3300053086 Bacteria 1764
340 Ga0500644_0102723 3300053088 Bacteria 1089
341 Ga0500593_001264 3300053117 Bacteria 9144
342 Ga0500597_201365 3300053120 Bacteria 836
343 Ga0500658_0006087 3300053134 Bacteria 4486
344 Ga0500658_0007038 3300053134 Bacteria 4161
345 Ga0500659_0229825 3300053135 Bacteria 873
346 Ga0500568_0000005 3300053139 Bacteria 614296
347 Ga0500568_0002693 3300053139 Bacteria 10297
348 Ga0500622_0001576 3300053156 Bacteria 17943
349 Ga0500627_0080689 3300053158 Bacteria 1450
350 Ga0500633_0000642 3300053160 Bacteria 5817
351 Ga0500636_0000119 3300053177 Bacteria 41322
352 Ga0500645_091951 3300053730 Bacteria 860
353 2509447991 2509276033 Bacteria 7180565
354 2510134929 2510065019 Bacteria 6903379
355 2513573716 2513237084 Bacteria 7231967
356 2513631225 2513237093 Bacteria 7545552
357 2513710880 2513237103 Bacteria 7647401
358 2513957364 2513237150 Bacteria 6553639
359 2514001607 2513237159 Bacteria 6810126
360 2514044738 2513237165 Bacteria 6771773
361 2515743621 2515154134 Bacteria 7220242
362 2517037652 2516653077 Bacteria 7555578
363 2517096734 2517093000 Bacteria 7412387
364 2520381378 2519899620 Bacteria 6499161
365 2535519319 2534681796 Bacteria 7146037
366 2585164275 2582581283 Bacteria 6030556
367 2585202368 2582581294 Bacteria 6626667
368 2585264506 2582581306 Bacteria 6450535
369 2585278090 2582581308 Bacteria 7413247
370 2585389870 2582581865 Bacteria 6644329
371 2585528982 2585427526 Bacteria 7258840
372 2585532250 2585427527 Bacteria 7273426
373 2585540927 2585427528 Bacteria 6842387
374 2585552610 2585427530 Bacteria 7383882
375 2585839689 2585427593 Bacteria 7141551
376 2586001851 2585427634 Bacteria 6455027
377 2599625998 2599185214 Bacteria 8209958
378 2599674920 2599185226 Bacteria 8233575
379 2599683814 2599185227 Bacteria 8246414
380 2599695583 2599185229 Bacteria 8216126
381 2599720017 2599185236 Bacteria 6875203
382 2616307608 2615840626 Bacteria 7921970
383 2643878185 2643221573 Bacteria 4784121
384 2644051789 2643221607 Bacteria 6314006
385 2644201596 2643221636 Bacteria 6583769
386 2644241971 2643221643 Bacteria 5749658
387 2644468849 2643221683 Bacteria 5749203
388 2644480657 2643221686 Bacteria 6310811
389 2644495821 2643221688 Bacteria 5260751
390 2644498627 2643221689 Bacteria 6042950
391 2644659489 2643221720 Bacteria 4694283
392 2644700761 2643221728 Bacteria 4797149
393 2720614888 2718218232 Bacteria 6720332
394 2723028301 2721755556 Bacteria 6745503
395 2723561929 2721755684 Bacteria 6859907
396 2725950822 2724679232 Bacteria 7646494
397 2730109237 2728369352 Bacteria 6745171
398 2739035483 2738541333 Bacteria 7106503
399 2766065228 2765235942 Bacteria 7445910
400 2793293538 2791355256 Bacteria 6798008
401 2793327865 2791355261 Bacteria 6661293
402 2793333478 2791355262 Bacteria 6774204
403 2793353787 2791355265 Bacteria 6539969
404 2793359608 2791355266 Bacteria 7116587
405 2805935328 2802429606 Bacteria 6346811
406 2806044470 2802429633 Bacteria 7341974
407 2806052671 2802429634 Bacteria 7083200
408 2806058971 2802429635 Bacteria 7650140
409 2806068366 2802429636 Bacteria 7597525
410 2806074486 2802429637 Bacteria 7067217
411 2819640495 2818991453 Bacteria 7181617
412 2821126263 2821123053 Bacteria 7836056
413 2834641250 2834641062 Bacteria 5559922
414 2838019194 2838016132 Bacteria 6577831
415 2838047453 2838042994 Bacteria 6046894
416 2838663639 2838661181 Bacteria 7385261
417 2838674635 2838668709 Bacteria 6671819
418 2838707007 2838701080 Bacteria 6669771
419 2838737261 2838736955 Bacteria 5760694
420 2841842370 2841840854 Bacteria 5761912
421 2842113339 2842110456 Bacteria 7656360
422 2842142150 2842140634 Bacteria 5759631
423 2842151697 2842146304 Bacteria 5957337
424 2842170046 2842163707 Bacteria 6916235
425 2842198630 2842192696 Bacteria 6147454
426 2842208403 2842205361 Bacteria 6340321
427 2842219983 2842217011 Bacteria 7497767
428 2842256784 2842250916 Bacteria 6579627
429 2842281588 2842278818 Bacteria 6340002
430 2842288712 2842285085 Bacteria 6011953
431 2842321298 2842317721 Bacteria 6793725
432 2842406621 2842402390 Bacteria 6681310
433 2842412952 2842409023 Bacteria 6687331
434 2842419595 2842415677 Bacteria 6596907
435 2842495545 2842489311 Bacteria 6620893
436 2842499064 2842495871 Bacteria 6820686
437 2842527208 2842521101 Bacteria 6569494
438 2854921500 2854916844 Bacteria 5725939
439 2857518809 2857516855 Bacteria 7787325
440 2857532824 2857531043 Bacteria 6754041
441 2889795338 2889790730 Bacteria 5689708
442 2889919367 2889914905 Bacteria 5702301
443 2913298470 2913295892 Bacteria 6333755
444 2919104664 2919100787 Bacteria 7710546
445 2928076230 2928070936 Bacteria 8062541
446 2933589370 2933586486 Bacteria 7667493
447 2935907459 2935901341 Bacteria 7341747
448 2936374782 2936367885 Bacteria 7324495
449 2936380474 2936375103 Bacteria 6652732
450 2937847551 2937843397 Bacteria 5256375
451 2989352014 2989349275 Bacteria 6349068
452 2996314226 2996310559 Bacteria 6357320
453 2996894646 2996893221 Bacteria 5823108
454 3003931304 3003930520 Bacteria 5667563
455 3005417372 3005416602 Bacteria 7064308
456 3005449370 3005445848 Bacteria 6906074
457 639650088 639633055 Bacteria 7751309
458 644746489 644736347 Bacteria 6476522
459 8003401068 8003400568 Bacteria 5535898
460 8005294179 8005289223 Bacteria 6634003
461 8005306593 8005301065 Bacteria 6614431
462 8005309482 8005307578 Bacteria 7395396
463 8005320380 8005314921 Bacteria 7072929
464 8005378465 8005376324 Bacteria 6590079
465 8005383756 8005382845 Bacteria 6732062
466 8005401083 8005395548 Bacteria 6806915
467 8005434037 8005430974 Bacteria 6689030
468 8005501750 8005497431 Bacteria 6477605
469 8005546996 8005542996 Bacteria 7077758
470 8005559073 8005556819 Bacteria 6908598
471 8005566869 8005563573 Bacteria 7153261
472 8005574856 8005570704 Bacteria 6957481
473 8005623104 8005619151 Bacteria 7030230
474 8005631588 8005626139 Bacteria 6534237
475 8005673172 8005668836 Bacteria 6953162
476 8005693711 8005688590 Bacteria 6610080
477 8018170311 8018163183 Bacteria 7277977
478 8023687452 8023680758 Bacteria 7729763
479 8024482036 8024479707 Bacteria 6954785
480 8024505852 8024501048 Bacteria 6427847
481 8056387109 8056382006 Bacteria 6408074
482 Ga0157370_11414701
483 JGI25152J39213_1003306
484 JGI25152J39213_1016576
485 JGI25150J39212_1002023
486 JGI25159J45721_1006082
487 JGI25159J45721_1028542
488 JGI25151J46595_10001841
489 JGI25151J46595_10003849
490 JGI25151J46595_10006423
491 JGI25165J46597_1004474
492 JGI25153J46596_10002450
493 JGI25153J46596_10006473
494 rootH1_10070669
495 rootH2_10096900
496 rootL2_10173186
497 JGI25160J50197_1001905
498 JGI25160J50197_1009417
499 JGI25160J50197_1035407
500 JGI25161J50226_1002126
501 JGI25161J50226_1003374
502 Ga0055539_1005935
503 Ga0055526_1000562
504 Ga0055526_1006015
505 Ga0055526_1012689
506 Ga0055526_1015494
507 Ga0055537_1005017
508 Ga0055524_1001572
509 Ga0055524_1006120
510 Ga0055524_1010658
511 Ga0055524_1043490
512 Ga0055536_1000729
513 Ga0055534_1002865
514 Ga0055528_1000954
515 Ga0055528_1007348
516 Ga0055528_1011000
517 Ga0055528_1020713
518 Ga0055540_1000874
519 Ga0055540_1031352
520 Ga0055531_10110726
521 Ga0055543_1000650
522 Ga0055543_1001944
523 Ga0065165_1000072
524 Ga0065165_1005274
525 Ga0065165_1013893
526 Ga0065165_1068144
527 Ga0070660_100580907
528 Ga0070669_100288796
529 Ga0070667_100020712
530 Ga0070663_101206172
531 Ga0070665_100072449
532 Ga0070665_100963470
533 Ga0068855_100045008
534 Ga0068855_100046688
535 Ga0068857_100636423
536 Ga0068854_100008048
537 Ga0068852_100278348
538 Ga0075363_100011984
539 Ga0075363_100204109
540 Ga0075364_10066973
541 Ga0075364_11051895
542 Ga0075367_10002604
543 Ga0075367_10430070
544 Ga0075369_10005260
545 Ga0075369_10177077
546 Ga0075369_10636059
547 Ga0075366_10003470
548 Ga0075366_10095246
549 Ga0075370_10034592
550 Ga0075370_10494401
551 Ga0079104_1000063
552 Ga0099826_10000039
553 Ga0105251_10109610
554 Ga0105244_10040463
555 Ga0105240_10000012
556 Ga0105243_10000875
557 Ga0105237_10001271
558 Ga0105237_11470249
559 Ga0105239_10005397
560 Ga0105239_10079004
561 Ga0157373_10257941
562 Ga0157373_11219558
563 Ga0157370_10001804
564 Ga0157370_11168103
565 Ga0157369_10004268
566 Ga0157369_11331926
567 Ga0157372_10794576
568 Ga0182008_10017425
569 Ga0182007_10009304
570 Ga0182005_1003228
571 Ga0214544_1000652
572 Ga0214542_1000146
573 Ga0214543_1000054
574 Ga0209436_109717
575 Ga0207425_1000180
576 Ga0207425_1003975
577 Ga0207425_1042258
578 Ga0209677_100556
579 Ga0209129_1000111
580 Ga0209129_1000203
581 Ga0209129_1000568
582 Ga0209129_1031523
583 Ga0209233_1000161
584 Ga0209565_1000110
585 Ga0209673_1000037
586 Ga0209673_1000426
587 Ga0209673_1000670
588 Ga0209673_1005902
589 Ga0209673_1011858
590 Ga0209673_1077315
591 Ga0209130_1000125
592 Ga0209130_1000205
593 Ga0209130_1002110
594 Ga0209675_1000192
595 Ga0209675_1001738
596 Ga0209676_1000484
597 Ga0209676_1044315
598 Ga0209676_1059260
599 Ga0209025_1000116
600 Ga0209025_1000354
601 Ga0209025_1000566
602 Ga0209025_1031713
603 Ga0209025_1052349
604 Ga0209025_1073252
605 Ga0209564_1000155
606 Ga0209564_1000207
607 Ga0209564_1000379
608 Ga0209758_1000107
609 Ga0209758_1000674
610 Ga0209758_1004194
611 Ga0209758_1017850
612 Ga0209758_1068919
613 Ga0209256_1000087
614 Ga0209256_1000758
615 Ga0209256_1001345
616 Ga0209256_1001773
617 Ga0209256_1006537
618 Ga0207426_1000123
619 Ga0207426_1000296
620 Ga0207426_1000474
621 Ga0207426_1010167
622 Ga0207426_1064804
623 Ga0207426_1110173
624 Ga0209051_1000636
625 Ga0209051_1007062
626 Ga0209051_1033281
627 Ga0209051_1037257
628 Ga0209051_1040409
629 Ga0209051_1048253
630 Ga0209257_1006616
631 Ga0209257_1016240
632 Ga0207695_10000097
633 Ga0207695_10366754
634 Ga0207671_10000289
635 Ga0207681_10239778
636 Ga0207694_10668560
637 Ga0207694_11050778
638 Ga0207709_10000389
639 Ga0207667_10082349
640 Ga0207658_10036414
641 Ga0209281_1000110
642 Ga0209282_1000058
643 Ga0209813_10026714
644 Ga0268266_11182979
645 Ga0268266_11348678
646 Ga0265337_1019994
647 Ga0265326_10010068
648 Ga0265334_10003173
649 Ga0265323_10003552
650 Ga0265336_10000104
651 Ga0307515_10000285
652 Ga0307515_10027939
653 Ga0307515_10315337
654 Ga0265338_10000137
655 Ga0307513_10436181
656 Ga0307408_100036635
657 Ga0307405_10025479
658 Ga0307405_10100910
659 Ga0307405_11483338
660 Ga0307413_10727427
661 Ga0307410_10432208
662 Ga0307406_10003654
663 Ga0307406_10025129
664 Ga0307409_100138223
665 Ga0307411_10096263
666 Ga0439436_0019228
667 Ga0439436_0069911
668 Ga0439436_0168031
669 Ga0439439_0014957
670 Ga0439447_045362
671 Ga0439466_0141204
672 Ga0439465_0017320
673 Ga0439465_0058018
674 Ga0451795_0431751
675 Ga0451802_1417467
676 Ga0451833_0058447
677 Ga0451833_0423803
678 Ga0451835_0025022
679 Ga0451835_0587763
680 Ga0451837_1195521
681 Ga0451837_1313381
682 Ga0451839_0865211
683 Ga0451841_1207741
684 Ga0451845_0189690
685 Ga0451847_0407225
686 Ga0451849_1528707
687 Ga0451851_0631607
688 Ga0451843_0272987
689 Ga0451855_0989568
690 Ga0451855_2042030
691 Ga0451853_2899099
692 Ga0439431_0169816
693 Ga0439442_150485
694 Ga0439445_0170174
695 Ga0439449_0145376
696 Ga0439452_075985
697 Ga0439452_090676
698 Ga0450920_033874
699 Ga0450906_010034
700 Ga0450918_000905
701 Ga0495591_123417
702 Ga0495638_0119641
703 Ga0495638_0284755
704 Ga0495638_0534139
705 Ga0495650_0045045
706 Ga0495650_0105142
707 Ga0495605_0015928
708 Ga0495605_0122411
709 Ga0495585_0073155
710 Ga0495585_0090720
711 Ga0495596_0000738
712 Ga0495607_0008050
713 Ga0495583_0046252
714 Ga0495606_0037728
715 Ga0495606_0044419
716 Ga0495610_0002945
717 Ga0495610_0019160
718 Ga0495610_0084029
719 Ga0495610_0220437
720 Ga0495616_0034897
721 Ga0495616_0037836
722 Ga0495620_0056393
723 Ga0495632_0060127
724 Ga0495643_0052037
725 Ga0495643_0067686
726 Ga0495643_0446863
727 Ga0495648_0109684
728 Ga0495609_0000943
729 Ga0495609_0086479
730 Ga0495597_0188362
731 Ga0495633_0007601
732 Ga0495633_0057257
733 Ga0495656_0367284
734 Ga0495656_0441287
735 Ga0495625_0037308
736 Ga0495625_0065573
737 Ga0495661_0010519
738 Ga0495588_0085400
739 Ga0495670_0038029
740 Ga0495671_0001086
741 Ga0495649_0011484
742 Ga0495649_0026554
743 Ga0495649_0214823
744 Ga0495660_0169450
745 Ga0495672_0002271
746 Ga0495672_0528807
747 Ga0495683_0262811
748 Ga0495685_080747
749 Ga0495673_0067724
750 Ga0495673_0153688
751 Ga0495686_0031679
752 Ga0495615_0009826
753 Ga0496100_0242040
754 Ga0496101_0092727
755 Ga0496103_0047279
756 Ga0496106_0003583
757 Ga0496106_0128093
758 Ga0496106_0156112
759 Ga0496107_0070478
760 Ga0496113_0127353
761 Ga0496113_1315248
762 Ga0496114_0109193
763 Ga0496116_0014321
764 Ga0496116_0016495
765 Ga0496116_0030810
766 Ga0496116_0324914
767 Ga0496116_0359465
768 Ga0496117_0483545
769 Ga0496118_0006891
770 Ga0496118_0014905
771 Ga0496119_0089645
772 Ga0496119_0408245
773 Ga0496120_0019402
774 Ga0496121_0005527
775 Ga0496121_0010414
776 Ga0496121_0011115
777 Ga0496121_0036881
778 Ga0496121_0110756
779 Ga0496121_0568675
780 Ga0496122_0010611
781 Ga0496122_0012504
782 Ga0496122_0015579
783 Ga0496122_0256138
784 Ga0496122_0267392
785 Ga0496123_0002314
786 Ga0496123_0003695
787 Ga0496123_0021755
788 Ga0496123_0168276
789 Ga0496124_0007502
790 Ga0496124_0014927
791 Ga0496124_0146774
792 Ga0496124_0617528
793 Ga0496125_0022386
794 Ga0496125_0085958
795 Ga0496125_0614801
796 Ga0496126_0000522
797 Ga0496126_0012811
798 Ga0496126_0156564
799 Ga0496126_0386811
800 Ga0496126_0583990
801 Ga0496126_1021689
802 Ga0501034_0010344
803 Ga0501034_0107266
804 Ga0501034_0490021
805 Ga0501040_0742398
806 Ga0501043_0556925
807 Ga0501070_0540242
808 Ga0501238_055607
809 Ga0501280_001541
810 nmdc:mga03683_1842_c1
811 nmdc:mga03n38_111186_c1
812 nmdc:mga03n38_584122_c1
813 nmdc:mga00v17_37735_c2
814 nmdc:mga0yw44_13340_c1
815 nmdc:mga0k408_4827_c1
816 nmdc:mga06z11_14133_c1
817 nmdc:mga04h51_9894_c1
818 nmdc:mga07m45_5581_c1
819 nmdc:mga0sz30_4147_c1
820 Ga0500578_0107158
821 Ga0500644_0102723
822 Ga0500593_001264
823 Ga0500597_201365
824 Ga0500658_0006087
825 Ga0500658_0007038
826 Ga0500659_0229825
827 Ga0500568_0000005
828 Ga0500568_0002693
829 Ga0500622_0001576
830 Ga0500627_0080689
831 Ga0500633_0000642
832 Ga0500636_0000119
833 Ga0500645_091951
834 2509447991
835 2510134929
836 2513573716
837 2513631225
838 2513710880
839 2513957364
840 2514001607
841 2514044738
842 2515743621
843 2517037652
844 2517096734
845 2520381378
846 2535519319
847 2585164275
848 2585202368
849 2585264506
850 2585278090
851 2585389870
852 2585528982
853 2585532250
854 2585540927
855 2585552610
856 2585839689
857 2586001851
858 2599625998
859 2599674920
860 2599683814
861 2599695583
862 2599720017
863 2616307608
864 2643878185
865 2644051789
866 2644201596
867 2644241971
868 2644468849
869 2644480657
870 2644495821
871 2644498627
872 2644659489
873 2644700761
874 2720614888
875 2723028301
876 2723561929
877 2725950822
878 2730109237
879 2739035483
880 2766065228
881 2793293538
882 2793327865
883 2793333478
884 2793353787
885 2793359608
886 2805935328
887 2806044470
888 2806052671
889 2806058971
890 2806068366
891 2806074486
892 2819640495
893 2821126263
894 2834641250
895 2838019194
896 2838047453
897 2838663639
898 2838674635
899 2838707007
900 2838737261
901 2841842370
902 2842113339
903 2842142150
904 2842151697
905 2842170046
906 2842198630
907 2842208403
908 2842219983
909 2842256784
910 2842281588
911 2842288712
912 2842321298
913 2842406621
914 2842412952
915 2842419595
916 2842495545
917 2842499064
918 2842527208
919 2854921500
920 2857518809
921 2857532824
922 2889795338
923 2889919367
924 2913298470
925 2919104664
926 2928076230
927 2933589370
928 2935907459
929 2936374782
930 2936380474
931 2937847551
932 2989352014
933 2996314226
934 2996894646
935 3003931304
936 3005417372
937 3005449370
938 639650088
939 644746489
940 8003401068
941 8005294179
942 8005306593
943 8005309482
944 8005320380
945 8005378465
946 8005383756
947 8005401083
948 8005434037
949 8005501750
950 8005546996
951 8005559073
952 8005566869
953 8005574856
954 8005623104
955 8005631588
956 8005673172
957 8005693711
958 8018170311
959 8023687452
960 8024482036
961 8024505852
962 8056387109

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

139

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9747 4 125
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9616 3 125
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9538 3 125
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.9435 4 125
2i7r-assembly1.cif.gz_B conserved domain protein 0.8793 3 124
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9814 71 121 3.30.720.110
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9493 3 55 3.30.720.120
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9318 3 55 3.30.720.120
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.93 72 122 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9242 71 121 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1N6CYU6-F1-model_v4 Glyoxalase-like domain-containing protein 0.9905 1 135
AF-A0A420A7B3-F1-model_v4 deleted 0.9895 1 142
AF-A0A4Q2S6J7-F1-model_v4 Glyoxalase 0.9888 1 142
AF-A0A2Z3GG18-F1-model_v4 deleted 0.9886 1 142
AF-A0A5R8Y9J3-F1-model_v4 Glyoxalase 0.988 1 142

Map