F452408

General Info

Members Datasets Scaffolds Average Seq Length
481 235 962 196

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10304771|Ga0157380_103047712
Length 231
Sequence VRLDRGGEAQHALVDHIAAGAVGAYENRHAPKYDSNTMAEQQMVDPHDPVMTGENSFIRFSHDGGKTITERVSHWRVLWSPAGQGHALFIESSLTGKIRVYADNPGVARFLQRTIETLLHKPFADESLPVIDATFERGGDSLSTVYERCTSTKDEIVMTWWDLLPPFILTMPPGAMGRPLGVYSTFLPAKSAQLSVNGEAAPGKVFLMDRFGKPASSCCLAWSESWTRPKG

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
166 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
167 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
214 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.79
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10304771 3300014326 Unclassified 1469
2 Ga0065707_10092303 3300005295 Bacteria 3791
3 Ga0065707_10299408 3300005295 Bacteria 1007
4 Ga0070690_100000289 3300005330 Bacteria 25771
5 Ga0070690_100008257 3300005330 Bacteria 5989
6 Ga0068869_100000299 3300005334 Bacteria 26389
7 Ga0070666_10097599 3300005335 Bacteria 2023
8 Ga0070680_100007424 3300005336 Bacteria 8367
9 Ga0070680_100054066 3300005336 Bacteria 3278
10 Ga0070680_100118235 3300005336 Bacteria 2211
11 Ga0070680_100319144 3300005336 Bacteria 1319
12 Ga0070682_100009020 3300005337 Bacteria 5637
13 Ga0068868_100000531 3300005338 Bacteria 25572
14 Ga0068868_100669514 3300005338 Unclassified 926
15 Ga0070660_100520049 3300005339 Unclassified 991
16 Ga0070689_100030482 3300005340 Bacteria 4095
17 Ga0070689_100129773 3300005340 Bacteria 2021
18 Ga0070691_10000308 3300005341 Bacteria 17176
19 Ga0070687_100000355 3300005343 Bacteria 15578
20 Ga0070692_10002606 3300005345 Bacteria 7035
21 Ga0070692_10014768 3300005345 Bacteria 3677
22 Ga0070692_10140121 3300005345 Bacteria 1368
23 Ga0070668_100015073 3300005347 Bacteria 5775
24 Ga0070669_100001513 3300005353 Bacteria 16797
25 Ga0070669_101001763 3300005353 Bacteria 717
26 Ga0070675_100073810 3300005354 Bacteria 2833
27 Ga0070671_100193753 3300005355 Bacteria 1723
28 Ga0070673_100043081 3300005364 Bacteria 3485
29 Ga0070688_100132976 3300005365 Bacteria 1681
30 Ga0070667_100260245 3300005367 Bacteria 1553
31 Ga0070703_10292745 3300005406 Bacteria 676
32 Ga0070713_100861940 3300005436 Bacteria 870
33 Ga0070710_10026915 3300005437 Bacteria 3062
34 Ga0070710_10422315 3300005437 Bacteria 898
35 Ga0070701_10000387 3300005438 Bacteria 14831
36 Ga0070705_100000472 3300005440 Bacteria 23179
37 Ga0070705_100207247 3300005440 Bacteria 1349
38 Ga0070700_100002641 3300005441 Bacteria 9172
39 Ga0070700_100041008 3300005441 Bacteria 2836
40 Ga0070700_100271855 3300005441 Bacteria 1225
41 Ga0070694_100000249 3300005444 Bacteria 28513
42 Ga0070694_100002755 3300005444 Bacteria 10423
43 Ga0070694_100098558 3300005444 Bacteria 2064
44 Ga0070681_10012996 3300005458 Bacteria 8267
45 Ga0068867_100000430 3300005459 Bacteria 28048
46 Ga0068867_100000729 3300005459 Bacteria 22020
47 Ga0070685_10150194 3300005466 Bacteria 1476
48 Ga0070679_100089258 3300005530 Bacteria 3070
49 Ga0070684_100186191 3300005535 Bacteria 1888
50 Ga0070697_100557700 3300005536 Unclassified 1005
51 Ga0070697_100602411 3300005536 Bacteria 966
52 Ga0068853_100297181 3300005539 Bacteria 1492
53 Ga0070686_100000392 3300005544 Bacteria 27736
54 Ga0070686_100123711 3300005544 Bacteria 1779
55 Ga0070695_100000185 3300005545 Bacteria 29879
56 Ga0070695_100170007 3300005545 Bacteria 1537
57 Ga0070695_100302452 3300005545 Bacteria 1183
58 Ga0070696_100000519 3300005546 Bacteria 24408
59 Ga0070696_100002012 3300005546 Bacteria 13331
60 Ga0070696_100024749 3300005546 Unclassified 4080
61 Ga0070696_100104966 3300005546 Bacteria 2029
62 Ga0070693_100000135 3300005547 Bacteria 33350
63 Ga0070704_100000108 3300005549 Bacteria 28920
64 Ga0070704_100059890 3300005549 Bacteria 2718
65 Ga0070704_100281563 3300005549 Bacteria 1378
66 Ga0068855_100002231 3300005563 Bacteria 23944
67 Ga0068854_100069901 3300005578 Bacteria 2565
68 Ga0068856_100013516 3300005614 Bacteria 7903
69 Ga0070702_100000557 3300005615 Bacteria 13590
70 Ga0068859_100001399 3300005617 Bacteria 24477
71 Ga0068859_100415645 3300005617 Bacteria 1441
72 Ga0068864_100272380 3300005618 Bacteria 1578
73 Ga0068866_10001478 3300005718 Bacteria 10015
74 Ga0068866_10011132 3300005718 Bacteria 3880
75 Ga0068861_100001038 3300005719 Bacteria 17033
76 Ga0068861_100001358 3300005719 Bacteria 15388
77 Ga0068870_10031335 3300005840 Bacteria 2694
78 Ga0068870_10074676 3300005840 Bacteria 1858
79 Ga0068870_10143819 3300005840 Bacteria 1398
80 Ga0068858_100002880 3300005842 Bacteria 17301
81 Ga0068858_100381262 3300005842 Bacteria 1353
82 Ga0068860_100002413 3300005843 Bacteria 19606
83 Ga0068860_100030311 3300005843 Bacteria 5203
84 Ga0068862_100001204 3300005844 Bacteria 24408
85 Ga0068862_100003042 3300005844 Bacteria 14608
86 Ga0081455_10282901 3300005937 Bacteria 1197
87 Ga0081538_10012543 3300005981 Bacteria 6788
88 Ga0081538_10029503 3300005981 Bacteria 3745
89 Ga0081538_10158930 3300005981 Archaea 1008
90 Ga0081539_10000462 3300005985 Bacteria 86060
91 Ga0081539_10156379 3300005985 Bacteria 1091
92 Ga0070715_10041607 3300006163 Bacteria 1927
93 Ga0070716_100239610 3300006173 Bacteria 1229
94 Ga0097621_100001049 3300006237 Bacteria 19393
95 Ga0097621_100004130 3300006237 Bacteria 10069
96 Ga0068871_100000370 3300006358 Bacteria 31403
97 Ga0075428_100000993 3300006844 Bacteria 30002
98 Ga0075428_100046058 3300006844 Bacteria 4792
99 Ga0075428_100066543 3300006844 Bacteria 3945
100 Ga0075430_100002561 3300006846 Bacteria 15154
101 Ga0075430_100063087 3300006846 Bacteria 3113
102 Ga0075430_100240979 3300006846 Bacteria 1499
103 Ga0075430_100259332 3300006846 Bacteria 1440
104 Ga0075430_100805481 3300006846 Unclassified 774
105 Ga0075433_10007872 3300006852 Bacteria 8476
106 Ga0075433_10060982 3300006852 Bacteria 3304
107 Ga0075433_10083908 3300006852 Bacteria 2812
108 Ga0075433_10146936 3300006852 Bacteria 2096
109 Ga0075434_100002685 3300006871 Bacteria 15706
110 Ga0075434_100003359 3300006871 Bacteria 14318
111 Ga0075434_100819664 3300006871 Unclassified 946
112 Ga0075429_100002816 3300006880 Bacteria 14713
113 Ga0075429_100029625 3300006880 Bacteria 4753
114 Ga0075429_100201568 3300006880 Bacteria 1743
115 Ga0068865_100000283 3300006881 Bacteria 27881
116 Ga0075436_100001357 3300006914 Bacteria 16645
117 Ga0075436_100001687 3300006914 Bacteria 15098
118 Ga0075436_100125878 3300006914 Bacteria 1795
119 Ga0075436_100133195 3300006914 Unclassified 1744
120 Ga0097620_100001399 3300006931 Bacteria 24477
121 Ga0097620_100415648 3300006931 Bacteria 1441
122 Ga0075435_100001908 3300007076 Bacteria 13571
123 Ga0075435_100010695 3300007076 Bacteria 6717
124 Ga0075435_100066737 3300007076 Bacteria 2928
125 Ga0075435_100082396 3300007076 Bacteria 2644
126 Ga0075435_100169260 3300007076 Unclassified 1843
127 Ga0099794_10014303 3300007265 Bacteria 3474
128 Ga0099794_10049642 3300007265 Bacteria 2017
129 Ga0099794_10309573 3300007265 Bacteria 818
130 Ga0111539_10023346 3300009094 Bacteria 7599
131 Ga0111539_10043841 3300009094 Bacteria 5362
132 Ga0111539_10203580 3300009094 Bacteria 2308
133 Ga0111539_10324651 3300009094 Bacteria 1791
134 Ga0111539_11771401 3300009094 Unclassified 716
135 Ga0105245_10001066 3300009098 Bacteria 24858
136 Ga0105245_11521162 3300009098 Bacteria 720
137 Ga0114129_10001138 3300009147 Bacteria 35164
138 Ga0114129_10574848 3300009147 Bacteria 1463
139 Ga0114129_11740793 3300009147 Bacteria 759
140 Ga0105243_10000708 3300009148 Bacteria 32162
141 Ga0105243_10011238 3300009148 Bacteria 6773
142 Ga0105241_10015810 3300009174 Bacteria 5529
143 Ga0105242_10001614 3300009176 Bacteria 17755
144 Ga0105249_10105216 3300009553 Bacteria 2660
145 Ga0105246_10847718 3300011119 Bacteria 815
146 Ga0157378_10001153 3300013297 Bacteria 24026
147 Ga0157375_10315645 3300013308 Bacteria 1727
148 Ga0157375_11945511 3300013308 Bacteria 698
149 Ga0157380_10067139 3300014326 Bacteria 2887
150 Ga0157380_10297575 3300014326 Bacteria 1485
151 Ga0157376_10069460 3300014969 Bacteria 2987
152 Ga0207653_10183994 3300025885 Bacteria 782
153 Ga0207692_10103784 3300025898 Bacteria 1565
154 Ga0207642_10000750 3300025899 Bacteria 10038
155 Ga0207642_10233633 3300025899 Bacteria 1034
156 Ga0207688_10324524 3300025901 Bacteria 945
157 Ga0207688_10441730 3300025901 Bacteria 810
158 Ga0207680_10080910 3300025903 Bacteria 2041
159 Ga0207645_10011013 3300025907 Bacteria 6189
160 Ga0207645_10461702 3300025907 Bacteria 858
161 Ga0207643_10078476 3300025908 Bacteria 1910
162 Ga0207643_10105152 3300025908 Unclassified 1658
163 Ga0207654_10149829 3300025911 Bacteria 1496
164 Ga0207707_10005380 3300025912 Bacteria 11196
165 Ga0207660_10003212 3300025917 Bacteria 10697
166 Ga0207660_10229694 3300025917 Bacteria 1459
167 Ga0207660_10294765 3300025917 Bacteria 1290
168 Ga0207660_10372891 3300025917 Bacteria 1146
169 Ga0207662_10000191 3300025918 Bacteria 28718
170 Ga0207662_10099427 3300025918 Bacteria 1801
171 Ga0207652_10108716 3300025921 Bacteria 2457
172 Ga0207681_10010837 3300025923 Bacteria 5600
173 Ga0207659_10026847 3300025926 Bacteria 3891
174 Ga0207687_10001813 3300025927 Bacteria 14697
175 Ga0207687_10942383 3300025927 Bacteria 739
176 Ga0207706_10122008 3300025933 Bacteria 2292
177 Ga0207706_10225684 3300025933 Bacteria 1639
178 Ga0207686_10001418 3300025934 Bacteria 13594
179 Ga0207709_10001098 3300025935 Bacteria 19845
180 Ga0207709_10011819 3300025935 Bacteria 4814
181 Ga0207670_10073371 3300025936 Bacteria 2373
182 Ga0207670_10382736 3300025936 Bacteria 1121
183 Ga0207704_10000409 3300025938 Bacteria 19434
184 Ga0207665_10121669 3300025939 Bacteria 1844
185 Ga0207665_10287049 3300025939 Unclassified 1226
186 Ga0207691_10237865 3300025940 Bacteria 1575
187 Ga0207711_10063905 3300025941 Bacteria 3178
188 Ga0207689_10000921 3300025942 Bacteria 28235
189 Ga0207689_10030133 3300025942 Bacteria 4522
190 Ga0207689_10132073 3300025942 Bacteria 2055
191 Ga0207661_10772329 3300025944 Bacteria 885
192 Ga0207667_10017372 3300025949 Bacteria 8098
193 Ga0207651_10188337 3300025960 Bacteria 1644
194 Ga0207712_10107656 3300025961 Bacteria 2085
195 Ga0207712_10151309 3300025961 Bacteria 1793
196 Ga0207668_10017408 3300025972 Bacteria 4503
197 Ga0207640_10001592 3300025981 Bacteria 12198
198 Ga0207677_10000592 3300026023 Bacteria 22464
199 Ga0207677_10795514 3300026023 Bacteria 846
200 Ga0207703_10007345 3300026035 Bacteria 8758
201 Ga0207708_10000451 3300026075 Bacteria 31936
202 Ga0207708_10015956 3300026075 Bacteria 5640
203 Ga0207708_10113037 3300026075 Bacteria 2110
204 Ga0207708_10256728 3300026075 Unclassified 1410
205 Ga0207708_10273928 3300026075 Bacteria 1366
206 Ga0207641_10164194 3300026088 Bacteria 2021
207 Ga0207648_10000245 3300026089 Bacteria 58564
208 Ga0207648_10001462 3300026089 Bacteria 25984
209 Ga0207648_10217501 3300026089 Bacteria 1697
210 Ga0207676_10089139 3300026095 Bacteria 2527
211 Ga0207675_100001447 3300026118 Bacteria 23783
212 Ga0207675_100001475 3300026118 Bacteria 23622
213 Ga0207698_10157694 3300026142 Bacteria 1980
214 Ga0209969_1001665 3300027360 Bacteria 3068
215 Ga0209981_1010380 3300027378 Unclassified 1277
216 Ga0210000_1004416 3300027462 Bacteria 2033
217 Ga0209968_1010400 3300027526 Bacteria 1430
218 Ga0209999_1002327 3300027543 Bacteria 3347
219 Ga0209983_1019420 3300027665 Unclassified 1413
220 Ga0209971_1025164 3300027682 Bacteria 1422
221 Ga0209966_1021078 3300027695 Bacteria 1266
222 Ga0209998_10027903 3300027717 Bacteria 1239
223 Ga0207428_10004232 3300027907 Bacteria 13746
224 Ga0207428_10120497 3300027907 Bacteria 2012
225 Ga0207428_10210576 3300027907 Bacteria 1460
226 Ga0207428_10320466 3300027907 Bacteria 1145
227 Ga0268265_10000627 3300028380 Bacteria 35202
228 Ga0268265_10004164 3300028380 Bacteria 10135
229 Ga0268265_10271889 3300028380 Bacteria 1512
230 Ga0268264_10003335 3300028381 Bacteria 13874
231 Ga0268264_10118738 3300028381 Bacteria 2328
232 Ga0307408_100139276 3300031548 Bacteria 1903
233 Ga0307408_100527858 3300031548 Unclassified 1038
234 Ga0307408_100565214 3300031548 Bacteria 1006
235 Ga0307405_10320258 3300031731 Bacteria 1184
236 Ga0307413_10249539 3300031824 Bacteria 1316
237 Ga0307406_10449195 3300031901 Bacteria 1034
238 Ga0307409_100448831 3300031995 Bacteria 1244
239 Ga0307416_100332377 3300032002 Unclassified 1528
240 Ga0307411_10132689 3300032005 Bacteria 1823
241 Ga0307411_10305319 3300032005 Bacteria 1278
242 Ga0307415_100283976 3300032126 Bacteria 1363
243 Ga0373948_0006694 3300034817 Bacteria 1914
244 Ga0373938_0002986 3300034957 Bacteria 2741
245 Ga0373926_0001851 3300035083 Bacteria 6586
246 Ga0373940_0041139 3300035088 Bacteria 1270
247 Ga0373944_0003060 3300035089 Bacteria 4298
248 Ga0373952_0006344 3300035092 Bacteria 2182
249 Ga0373952_0021777 3300035092 Bacteria 1356
250 Ga0373932_0002139 3300035112 Bacteria 5133
251 Ga0373936_0022250 3300035113 Bacteria 2468
252 Ga0373939_0040560 3300035114 Bacteria 1399
253 Ga0373941_0034993 3300035115 Bacteria 1518
254 Ga0373941_0046767 3300035115 Bacteria 1361
255 Ga0373945_0017554 3300035116 Bacteria 2423
256 Ga0373953_0007492 3300035117 Bacteria 3658
257 Ga0373954_0000040 3300035118 Bacteria 47568
258 Ga0373956_0021330 3300035119 Bacteria 2764
259 Ga0373957_0015053 3300035120 Bacteria 2655
260 Ga0373960_0006356 3300035121 Bacteria 2770
261 Ga0373943_0026170 3300035170 Bacteria 2731
262 Ga0373946_0004376 3300035171 Bacteria 5059
263 Ga0373955_0009824 3300035172 Bacteria 4499
264 Ga0373955_0058778 3300035172 Bacteria 2116
265 Ga0373961_0012585 3300035241 Bacteria 2121
266 Ga0373924_0002130 3300035410 Bacteria 6621
267 Ga0373931_0008988 3300035691 Bacteria 4763
268 Ga0373931_0474508 3300035691 Bacteria 803
269 Ga0373935_0024504 3300035692 Bacteria 3714
270 Ga0373927_0007300 3300035695 Bacteria 7492
271 Ga0373933_0014146 3300035724 Bacteria 4431
272 Ga0373933_0025364 3300035724 Bacteria 3399
273 Ga0373947_0024500 3300035725 Bacteria 3516
274 Ga0373947_0049723 3300035725 Bacteria 2518
275 Ga0373937_0000988 3300036401 Bacteria 24146
276 Ga0373937_0017415 3300036401 Bacteria 6400
277 Ga0451847_0499941 3300041503 Bacteria 532
278 Ga0439441_054169 3300042001 Bacteria 832
279 Ga0439446_0001604 3300042156 Bacteria 5206
280 Ga0439434_0002357 3300042435 Bacteria 5495
281 Ga0439435_0000676 3300042436 Bacteria 5657
282 Ga0439435_0001802 3300042436 Bacteria 4086
283 Ga0439444_0003955 3300042437 Bacteria 2122
284 Ga0439460_0011547 3300042461 Bacteria 2279
285 Ga0439460_0050577 3300042461 Bacteria 1245
286 Ga0451577_0197282 3300042876 Unclassified 1817
287 Ga0451577_0937778 3300042876 Bacteria 779
288 Ga0453684_0534890 3300044712 Bacteria 1293
289 Ga0453684_0693635 3300044712 Bacteria 1107
290 Ga0453684_0718111 3300044712 Bacteria 1084
291 Ga0466960_0266113 3300044901 Bacteria 957
292 Ga0451576_0003473 3300045051 Bacteria 21579
293 Ga0451576_0041755 3300045051 Bacteria 4847
294 Ga0451576_0049688 3300045051 Bacteria 4401
295 Ga0451576_0130939 3300045051 Bacteria 2615
296 Ga0451576_0338298 3300045051 Bacteria 1575
297 Ga0451576_0726942 3300045051 Unclassified 1043
298 Ga0495603_0000212 3300046455 Bacteria 30148
299 Ga0495580_0000358 3300046472 Bacteria 37269
300 Ga0495582_0021748 3300046473 Bacteria 3510
301 Ga0495639_0015755 3300046475 Bacteria 3278
302 Ga0495594_0123671 3300046499 Bacteria 1463
303 Ga0495666_0004532 3300046526 Bacteria 7020
304 Ga0495586_0003782 3300046535 Bacteria 8110
305 Ga0495598_0095085 3300046537 Bacteria 978
306 Ga0495598_0136173 3300046537 Unclassified 846
307 Ga0495621_0118121 3300046539 Bacteria 1023
308 Ga0495659_0059044 3300046664 Bacteria 1413
309 Ga0495647_0000273 3300046681 Bacteria 14274
310 Ga0495658_0000620 3300046683 Bacteria 19327
311 Ga0495669_0052662 3300046684 Bacteria 1829
312 Ga0495581_0020108 3300047315 Bacteria 3876
313 Ga0495676_0025953 3300047321 Bacteria 5050
314 Ga0495684_0401699 3300047471 Bacteria 962
315 Ga0501031_0080387 3300049568 Bacteria 2125
316 Ga0501031_0125343 3300049568 Bacteria 1678
317 Ga0501032_0026573 3300049569 Bacteria 3979
318 Ga0501032_0506401 3300049569 Bacteria 771
319 Ga0501033_0026957 3300049570 Bacteria 4322
320 Ga0501033_0107900 3300049570 Bacteria 2028
321 Ga0501033_0136267 3300049570 Bacteria 1776
322 Ga0501033_0147409 3300049570 Unclassified 1699
323 Ga0501033_0259421 3300049570 Bacteria 1230
324 Ga0501036_0005718 3300049572 Bacteria 10087
325 Ga0501036_0023503 3300049572 Bacteria 5193
326 Ga0501036_0109159 3300049572 Bacteria 2338
327 Ga0501036_0170571 3300049572 Bacteria 1833
328 Ga0501036_0521248 3300049572 Bacteria 988
329 Ga0501037_0032098 3300049573 Bacteria 3877
330 Ga0501037_0056811 3300049573 Bacteria 2858
331 Ga0501037_0201470 3300049573 Unclassified 1406
332 Ga0501038_0000994 3300049574 Bacteria 25505
333 Ga0501038_0078941 3300049574 Bacteria 2776
334 Ga0501038_0147337 3300049574 Bacteria 1921
335 Ga0501038_0172055 3300049574 Unclassified 1752
336 Ga0501039_0012598 3300049575 Bacteria 6462
337 Ga0501039_0025541 3300049575 Bacteria 4540
338 Ga0501039_0038534 3300049575 Bacteria 3690
339 Ga0501039_0066053 3300049575 Bacteria 2807
340 Ga0501039_0085694 3300049575 Bacteria 2454
341 Ga0501039_0181306 3300049575 Unclassified 1656
342 Ga0501039_1376423 3300049575 Bacteria 543
343 Ga0501040_0000864 3300049576 Bacteria 19006
344 Ga0501040_0014446 3300049576 Bacteria 5202
345 Ga0501040_0023359 3300049576 Bacteria 4146
346 Ga0501040_0112159 3300049576 Bacteria 1907
347 Ga0501040_0139155 3300049576 Unclassified 1709
348 Ga0501040_0341269 3300049576 Unclassified 1072
349 Ga0501040_0647391 3300049576 Bacteria 764
350 Ga0501041_0003607 3300049577 Bacteria 8904
351 Ga0501041_0003756 3300049577 Bacteria 8737
352 Ga0501041_0011565 3300049577 Bacteria 5220
353 Ga0501041_0033160 3300049577 Bacteria 3123
354 Ga0501041_0044267 3300049577 Bacteria 2706
355 Ga0501041_0078132 3300049577 Bacteria 2036
356 Ga0501042_0000634 3300049578 Bacteria 18814
357 Ga0501042_0021872 3300049578 Bacteria 4463
358 Ga0501042_0062530 3300049578 Bacteria 2660
359 Ga0501042_0090466 3300049578 Bacteria 2196
360 Ga0501042_0158785 3300049578 Bacteria 1631
361 Ga0501042_0320945 3300049578 Unclassified 1119
362 Ga0501042_0715622 3300049578 Unclassified 728
363 Ga0501043_0027582 3300049579 Bacteria 4458
364 Ga0501043_0031676 3300049579 Bacteria 4157
365 Ga0501043_0156835 3300049579 Unclassified 1780
366 Ga0501043_0158812 3300049579 Bacteria 1767
367 Ga0501046_0004336 3300049580 Bacteria 12915
368 Ga0501046_0040314 3300049580 Bacteria 3733
369 Ga0501047_0598834 3300049581 Bacteria 924
370 Ga0501048_0000293 3300049582 Bacteria 34000
371 Ga0501048_0010482 3300049582 Bacteria 6918
372 Ga0501048_0046197 3300049582 Bacteria 3109
373 Ga0501048_0085162 3300049582 Bacteria 2229
374 Ga0501048_0103847 3300049582 Unclassified 2005
375 Ga0501048_0108063 3300049582 Bacteria 1964
376 Ga0501068_0026063 3300049584 Bacteria 3442
377 Ga0501068_0040149 3300049584 Bacteria 2808
378 Ga0501068_0292368 3300049584 Bacteria 1042
379 Ga0501071_0003584 3300049587 Bacteria 9722
380 Ga0501071_0018669 3300049587 Bacteria 4807
381 Ga0501071_0025464 3300049587 Bacteria 4145
382 Ga0501071_0033833 3300049587 Bacteria 3633
383 Ga0501071_0080653 3300049587 Bacteria 2380
384 Ga0501071_0550496 3300049587 Bacteria 886
385 Ga0501071_0730571 3300049587 Bacteria 763
386 Ga0501072_0005763 3300049588 Bacteria 9432
387 Ga0501072_0006530 3300049588 Bacteria 8884
388 Ga0501072_0009493 3300049588 Bacteria 7398
389 Ga0501072_0029974 3300049588 Bacteria 4252
390 Ga0501072_0052255 3300049588 Bacteria 3217
391 Ga0501072_0315826 3300049588 Bacteria 1242
392 Ga0501072_0354553 3300049588 Bacteria 1164
393 Ga0501072_0706530 3300049588 Bacteria 792
394 Ga0501074_0022239 3300049590 Bacteria 4608
395 Ga0501074_0127897 3300049590 Bacteria 1818
396 Ga0501074_0575448 3300049590 Bacteria 797
397 Ga0501075_0003753 3300049591 Bacteria 10205
398 Ga0501075_0012748 3300049591 Bacteria 5982
399 Ga0501075_0036305 3300049591 Bacteria 3678
400 Ga0501075_0048333 3300049591 Bacteria 3197
401 Ga0501075_0160296 3300049591 Bacteria 1716
402 Ga0501075_0304505 3300049591 Bacteria 1214
403 Ga0501075_0837789 3300049591 Unclassified 700
404 Ga0501076_0001091 3300049592 Bacteria 17844
405 Ga0501076_0003405 3300049592 Bacteria 11164
406 Ga0501076_0006238 3300049592 Bacteria 8635
407 Ga0501076_0011555 3300049592 Bacteria 6583
408 Ga0501076_0103470 3300049592 Bacteria 2297
409 Ga0501077_0003064 3300049593 Bacteria 10032
410 Ga0501077_0010023 3300049593 Bacteria 5897
411 Ga0501214_019665 3300049659 Unclassified 846
412 Ga0501216_007342 3300049660 Bacteria 1714
413 Ga0501079_0003804 3300049741 Bacteria 11150
414 Ga0501079_0004238 3300049741 Bacteria 10636
415 Ga0501079_0011674 3300049741 Bacteria 6711
416 Ga0501079_0017031 3300049741 Bacteria 5550
417 Ga0501080_0010120 3300049742 Bacteria 8624
418 Ga0501080_0055773 3300049742 Bacteria 3680
419 Ga0501080_0070566 3300049742 Bacteria 3249
420 Ga0501080_0080758 3300049742 Bacteria 3022
421 Ga0501081_0000106 3300049743 Bacteria 35374
422 Ga0501081_0004989 3300049743 Bacteria 8544
423 Ga0501081_0006843 3300049743 Bacteria 7414
424 Ga0501081_0025673 3300049743 Bacteria 3966
425 Ga0501081_0149592 3300049743 Bacteria 1677
426 Ga0501081_0404509 3300049743 Bacteria 1011
427 Ga0501083_0063161 3300049744 Bacteria 2470
428 Ga0501083_0137531 3300049744 Bacteria 1600
429 Ga0501083_0175069 3300049744 Bacteria 1402
430 Ga0501283_016456 3300049779 Bacteria 1148
431 Ga0501035_0150629 3300049822 Bacteria 2019
432 Ga0501044_0450507 3300049823 Bacteria 1194
433 Ga0501045_0004598 3300049824 Bacteria 9528
434 Ga0501045_0007096 3300049824 Bacteria 7766
435 Ga0501045_0007341 3300049824 Bacteria 7664
436 Ga0501045_0045108 3300049824 Bacteria 3210
437 Ga0501045_0183045 3300049824 Unclassified 1561
438 Ga0501045_0305411 3300049824 Bacteria 1184
439 Ga0501045_0645483 3300049824 Unclassified 782
440 nmdc:mga05p37_5151_c1 3300050507 Bacteria 15316
441 nmdc:mga05p37_720787_c1 3300050507 Bacteria 1104
442 nmdc:mga09592_157036_c1 3300050508 Bacteria 1964
443 nmdc:mga09592_5031_c1 3300050508 Bacteria 10722
444 nmdc:mga0qj67_188814_c1 3300050509 Bacteria 1675
445 nmdc:mga0qj67_280305_c1 3300050509 Bacteria 1351
446 nmdc:mga0qj67_30276_c1 3300050509 Bacteria 4211
447 nmdc:mga0qj67_749021_c1 3300050509 Unclassified 775
448 nmdc:mga06r32_106764_c1 3300050510 Bacteria 2751
449 nmdc:mga06r32_820774_c1 3300050510 Bacteria 890
450 nmdc:mga08y16_18790_c1 3300050511 Bacteria 7282
451 nmdc:mga08y16_270673_c1 3300050511 Bacteria 1754
452 nmdc:mga08y16_33511_c1 3300050511 Bacteria 5394
453 nmdc:mga08y16_54366_c1 3300050511 Bacteria 4184
454 nmdc:mga08y16_69948_c1 3300050511 Bacteria 3659
455 nmdc:mga0n895_1570_c1 3300050512 Bacteria 17182
456 nmdc:mga0n895_201043_c1 3300050512 Bacteria 2023
457 nmdc:mga0n895_373291_c1 3300050512 Unclassified 1444
458 nmdc:mga0n895_78559_c1 3300050512 Bacteria 3285
459 nmdc:mga0rr50_381_c1 3300050513 Bacteria 24264
460 nmdc:mga0rr50_65809_c1 3300050513 Bacteria 2747
461 nmdc:mga0rr50_78257_c1 3300050513 Bacteria 2544
462 nmdc:mga08x19_18392_c1 3300050514 Bacteria 4283
463 nmdc:mga08x19_2762_c1 3300050514 Bacteria 10593
464 nmdc:mga0a205_117023_c1 3300050515 Bacteria 2564
465 nmdc:mga0a205_128314_c1 3300050515 Bacteria 2436
466 nmdc:mga0a205_269416_c1 3300050515 Bacteria 1580
467 nmdc:mga0a205_93_c2 3300050515 Bacteria 37118
468 Ga0495601_0240439 3300053077 Bacteria 1182
469 Ga0501084_0010682 3300054114 Bacteria 7599
470 Ga0501084_0028948 3300054114 Bacteria 4631
471 Ga0501084_0085086 3300054114 Bacteria 2655
472 Ga0501082_0000529 3300060353 Bacteria 33995
473 Ga0501082_0003995 3300060353 Bacteria 12872
474 Ga0501082_0015736 3300060353 Bacteria 6506
475 Ga0501082_0019934 3300060353 Bacteria 5779
476 Ga0501082_0213684 3300060353 Bacteria 1678
477 Ga0501082_0647668 3300060353 Bacteria 925
478 Ga0530510_0000975 3300061734 Bacteria 18912
479 Ga0530510_0002046 3300061734 Bacteria 13863
480 Ga0530510_0002851 3300061734 Bacteria 11883
481 Ga0530510_0097676 3300061734 Bacteria 2147
482 Ga0157380_10304771
483 Ga0065707_10092303
484 Ga0065707_10299408
485 Ga0070690_100000289
486 Ga0070690_100008257
487 Ga0068869_100000299
488 Ga0070666_10097599
489 Ga0070680_100007424
490 Ga0070680_100054066
491 Ga0070680_100118235
492 Ga0070680_100319144
493 Ga0070682_100009020
494 Ga0068868_100000531
495 Ga0068868_100669514
496 Ga0070660_100520049
497 Ga0070689_100030482
498 Ga0070689_100129773
499 Ga0070691_10000308
500 Ga0070687_100000355
501 Ga0070692_10002606
502 Ga0070692_10014768
503 Ga0070692_10140121
504 Ga0070668_100015073
505 Ga0070669_100001513
506 Ga0070669_101001763
507 Ga0070675_100073810
508 Ga0070671_100193753
509 Ga0070673_100043081
510 Ga0070688_100132976
511 Ga0070667_100260245
512 Ga0070703_10292745
513 Ga0070713_100861940
514 Ga0070710_10026915
515 Ga0070710_10422315
516 Ga0070701_10000387
517 Ga0070705_100000472
518 Ga0070705_100207247
519 Ga0070700_100002641
520 Ga0070700_100041008
521 Ga0070700_100271855
522 Ga0070694_100000249
523 Ga0070694_100002755
524 Ga0070694_100098558
525 Ga0070681_10012996
526 Ga0068867_100000430
527 Ga0068867_100000729
528 Ga0070685_10150194
529 Ga0070679_100089258
530 Ga0070684_100186191
531 Ga0070697_100557700
532 Ga0070697_100602411
533 Ga0068853_100297181
534 Ga0070686_100000392
535 Ga0070686_100123711
536 Ga0070695_100000185
537 Ga0070695_100170007
538 Ga0070695_100302452
539 Ga0070696_100000519
540 Ga0070696_100002012
541 Ga0070696_100024749
542 Ga0070696_100104966
543 Ga0070693_100000135
544 Ga0070704_100000108
545 Ga0070704_100059890
546 Ga0070704_100281563
547 Ga0068855_100002231
548 Ga0068854_100069901
549 Ga0068856_100013516
550 Ga0070702_100000557
551 Ga0068859_100001399
552 Ga0068859_100415645
553 Ga0068864_100272380
554 Ga0068866_10001478
555 Ga0068866_10011132
556 Ga0068861_100001038
557 Ga0068861_100001358
558 Ga0068870_10031335
559 Ga0068870_10074676
560 Ga0068870_10143819
561 Ga0068858_100002880
562 Ga0068858_100381262
563 Ga0068860_100002413
564 Ga0068860_100030311
565 Ga0068862_100001204
566 Ga0068862_100003042
567 Ga0081455_10282901
568 Ga0081538_10012543
569 Ga0081538_10029503
570 Ga0081538_10158930
571 Ga0081539_10000462
572 Ga0081539_10156379
573 Ga0070715_10041607
574 Ga0070716_100239610
575 Ga0097621_100001049
576 Ga0097621_100004130
577 Ga0068871_100000370
578 Ga0075428_100000993
579 Ga0075428_100046058
580 Ga0075428_100066543
581 Ga0075430_100002561
582 Ga0075430_100063087
583 Ga0075430_100240979
584 Ga0075430_100259332
585 Ga0075430_100805481
586 Ga0075433_10007872
587 Ga0075433_10060982
588 Ga0075433_10083908
589 Ga0075433_10146936
590 Ga0075434_100002685
591 Ga0075434_100003359
592 Ga0075434_100819664
593 Ga0075429_100002816
594 Ga0075429_100029625
595 Ga0075429_100201568
596 Ga0068865_100000283
597 Ga0075436_100001357
598 Ga0075436_100001687
599 Ga0075436_100125878
600 Ga0075436_100133195
601 Ga0097620_100001399
602 Ga0097620_100415648
603 Ga0075435_100001908
604 Ga0075435_100010695
605 Ga0075435_100066737
606 Ga0075435_100082396
607 Ga0075435_100169260
608 Ga0099794_10014303
609 Ga0099794_10049642
610 Ga0099794_10309573
611 Ga0111539_10023346
612 Ga0111539_10043841
613 Ga0111539_10203580
614 Ga0111539_10324651
615 Ga0111539_11771401
616 Ga0105245_10001066
617 Ga0105245_11521162
618 Ga0114129_10001138
619 Ga0114129_10574848
620 Ga0114129_11740793
621 Ga0105243_10000708
622 Ga0105243_10011238
623 Ga0105241_10015810
624 Ga0105242_10001614
625 Ga0105249_10105216
626 Ga0105246_10847718
627 Ga0157378_10001153
628 Ga0157375_10315645
629 Ga0157375_11945511
630 Ga0157380_10067139
631 Ga0157380_10297575
632 Ga0157376_10069460
633 Ga0207653_10183994
634 Ga0207692_10103784
635 Ga0207642_10000750
636 Ga0207642_10233633
637 Ga0207688_10324524
638 Ga0207688_10441730
639 Ga0207680_10080910
640 Ga0207645_10011013
641 Ga0207645_10461702
642 Ga0207643_10078476
643 Ga0207643_10105152
644 Ga0207654_10149829
645 Ga0207707_10005380
646 Ga0207660_10003212
647 Ga0207660_10229694
648 Ga0207660_10294765
649 Ga0207660_10372891
650 Ga0207662_10000191
651 Ga0207662_10099427
652 Ga0207652_10108716
653 Ga0207681_10010837
654 Ga0207659_10026847
655 Ga0207687_10001813
656 Ga0207687_10942383
657 Ga0207706_10122008
658 Ga0207706_10225684
659 Ga0207686_10001418
660 Ga0207709_10001098
661 Ga0207709_10011819
662 Ga0207670_10073371
663 Ga0207670_10382736
664 Ga0207704_10000409
665 Ga0207665_10121669
666 Ga0207665_10287049
667 Ga0207691_10237865
668 Ga0207711_10063905
669 Ga0207689_10000921
670 Ga0207689_10030133
671 Ga0207689_10132073
672 Ga0207661_10772329
673 Ga0207667_10017372
674 Ga0207651_10188337
675 Ga0207712_10107656
676 Ga0207712_10151309
677 Ga0207668_10017408
678 Ga0207640_10001592
679 Ga0207677_10000592
680 Ga0207677_10795514
681 Ga0207703_10007345
682 Ga0207708_10000451
683 Ga0207708_10015956
684 Ga0207708_10113037
685 Ga0207708_10256728
686 Ga0207708_10273928
687 Ga0207641_10164194
688 Ga0207648_10000245
689 Ga0207648_10001462
690 Ga0207648_10217501
691 Ga0207676_10089139
692 Ga0207675_100001447
693 Ga0207675_100001475
694 Ga0207698_10157694
695 Ga0209969_1001665
696 Ga0209981_1010380
697 Ga0210000_1004416
698 Ga0209968_1010400
699 Ga0209999_1002327
700 Ga0209983_1019420
701 Ga0209971_1025164
702 Ga0209966_1021078
703 Ga0209998_10027903
704 Ga0207428_10004232
705 Ga0207428_10120497
706 Ga0207428_10210576
707 Ga0207428_10320466
708 Ga0268265_10000627
709 Ga0268265_10004164
710 Ga0268265_10271889
711 Ga0268264_10003335
712 Ga0268264_10118738
713 Ga0307408_100139276
714 Ga0307408_100527858
715 Ga0307408_100565214
716 Ga0307405_10320258
717 Ga0307413_10249539
718 Ga0307406_10449195
719 Ga0307409_100448831
720 Ga0307416_100332377
721 Ga0307411_10132689
722 Ga0307411_10305319
723 Ga0307415_100283976
724 Ga0373948_0006694
725 Ga0373938_0002986
726 Ga0373926_0001851
727 Ga0373940_0041139
728 Ga0373944_0003060
729 Ga0373952_0006344
730 Ga0373952_0021777
731 Ga0373932_0002139
732 Ga0373936_0022250
733 Ga0373939_0040560
734 Ga0373941_0034993
735 Ga0373941_0046767
736 Ga0373945_0017554
737 Ga0373953_0007492
738 Ga0373954_0000040
739 Ga0373956_0021330
740 Ga0373957_0015053
741 Ga0373960_0006356
742 Ga0373943_0026170
743 Ga0373946_0004376
744 Ga0373955_0009824
745 Ga0373955_0058778
746 Ga0373961_0012585
747 Ga0373924_0002130
748 Ga0373931_0008988
749 Ga0373931_0474508
750 Ga0373935_0024504
751 Ga0373927_0007300
752 Ga0373933_0014146
753 Ga0373933_0025364
754 Ga0373947_0024500
755 Ga0373947_0049723
756 Ga0373937_0000988
757 Ga0373937_0017415
758 Ga0451847_0499941
759 Ga0439441_054169
760 Ga0439446_0001604
761 Ga0439434_0002357
762 Ga0439435_0000676
763 Ga0439435_0001802
764 Ga0439444_0003955
765 Ga0439460_0011547
766 Ga0439460_0050577
767 Ga0451577_0197282
768 Ga0451577_0937778
769 Ga0453684_0534890
770 Ga0453684_0693635
771 Ga0453684_0718111
772 Ga0466960_0266113
773 Ga0451576_0003473
774 Ga0451576_0041755
775 Ga0451576_0049688
776 Ga0451576_0130939
777 Ga0451576_0338298
778 Ga0451576_0726942
779 Ga0495603_0000212
780 Ga0495580_0000358
781 Ga0495582_0021748
782 Ga0495639_0015755
783 Ga0495594_0123671
784 Ga0495666_0004532
785 Ga0495586_0003782
786 Ga0495598_0095085
787 Ga0495598_0136173
788 Ga0495621_0118121
789 Ga0495659_0059044
790 Ga0495647_0000273
791 Ga0495658_0000620
792 Ga0495669_0052662
793 Ga0495581_0020108
794 Ga0495676_0025953
795 Ga0495684_0401699
796 Ga0501031_0080387
797 Ga0501031_0125343
798 Ga0501032_0026573
799 Ga0501032_0506401
800 Ga0501033_0026957
801 Ga0501033_0107900
802 Ga0501033_0136267
803 Ga0501033_0147409
804 Ga0501033_0259421
805 Ga0501036_0005718
806 Ga0501036_0023503
807 Ga0501036_0109159
808 Ga0501036_0170571
809 Ga0501036_0521248
810 Ga0501037_0032098
811 Ga0501037_0056811
812 Ga0501037_0201470
813 Ga0501038_0000994
814 Ga0501038_0078941
815 Ga0501038_0147337
816 Ga0501038_0172055
817 Ga0501039_0012598
818 Ga0501039_0025541
819 Ga0501039_0038534
820 Ga0501039_0066053
821 Ga0501039_0085694
822 Ga0501039_0181306
823 Ga0501039_1376423
824 Ga0501040_0000864
825 Ga0501040_0014446
826 Ga0501040_0023359
827 Ga0501040_0112159
828 Ga0501040_0139155
829 Ga0501040_0341269
830 Ga0501040_0647391
831 Ga0501041_0003607
832 Ga0501041_0003756
833 Ga0501041_0011565
834 Ga0501041_0033160
835 Ga0501041_0044267
836 Ga0501041_0078132
837 Ga0501042_0000634
838 Ga0501042_0021872
839 Ga0501042_0062530
840 Ga0501042_0090466
841 Ga0501042_0158785
842 Ga0501042_0320945
843 Ga0501042_0715622
844 Ga0501043_0027582
845 Ga0501043_0031676
846 Ga0501043_0156835
847 Ga0501043_0158812
848 Ga0501046_0004336
849 Ga0501046_0040314
850 Ga0501047_0598834
851 Ga0501048_0000293
852 Ga0501048_0010482
853 Ga0501048_0046197
854 Ga0501048_0085162
855 Ga0501048_0103847
856 Ga0501048_0108063
857 Ga0501068_0026063
858 Ga0501068_0040149
859 Ga0501068_0292368
860 Ga0501071_0003584
861 Ga0501071_0018669
862 Ga0501071_0025464
863 Ga0501071_0033833
864 Ga0501071_0080653
865 Ga0501071_0550496
866 Ga0501071_0730571
867 Ga0501072_0005763
868 Ga0501072_0006530
869 Ga0501072_0009493
870 Ga0501072_0029974
871 Ga0501072_0052255
872 Ga0501072_0315826
873 Ga0501072_0354553
874 Ga0501072_0706530
875 Ga0501074_0022239
876 Ga0501074_0127897
877 Ga0501074_0575448
878 Ga0501075_0003753
879 Ga0501075_0012748
880 Ga0501075_0036305
881 Ga0501075_0048333
882 Ga0501075_0160296
883 Ga0501075_0304505
884 Ga0501075_0837789
885 Ga0501076_0001091
886 Ga0501076_0003405
887 Ga0501076_0006238
888 Ga0501076_0011555
889 Ga0501076_0103470
890 Ga0501077_0003064
891 Ga0501077_0010023
892 Ga0501214_019665
893 Ga0501216_007342
894 Ga0501079_0003804
895 Ga0501079_0004238
896 Ga0501079_0011674
897 Ga0501079_0017031
898 Ga0501080_0010120
899 Ga0501080_0055773
900 Ga0501080_0070566
901 Ga0501080_0080758
902 Ga0501081_0000106
903 Ga0501081_0004989
904 Ga0501081_0006843
905 Ga0501081_0025673
906 Ga0501081_0149592
907 Ga0501081_0404509
908 Ga0501083_0063161
909 Ga0501083_0137531
910 Ga0501083_0175069
911 Ga0501283_016456
912 Ga0501035_0150629
913 Ga0501044_0450507
914 Ga0501045_0004598
915 Ga0501045_0007096
916 Ga0501045_0007341
917 Ga0501045_0045108
918 Ga0501045_0183045
919 Ga0501045_0305411
920 Ga0501045_0645483
921 nmdc:mga05p37_5151_c1
922 nmdc:mga05p37_720787_c1
923 nmdc:mga09592_157036_c1
924 nmdc:mga09592_5031_c1
925 nmdc:mga0qj67_188814_c1
926 nmdc:mga0qj67_280305_c1
927 nmdc:mga0qj67_30276_c1
928 nmdc:mga0qj67_749021_c1
929 nmdc:mga06r32_106764_c1
930 nmdc:mga06r32_820774_c1
931 nmdc:mga08y16_18790_c1
932 nmdc:mga08y16_270673_c1
933 nmdc:mga08y16_33511_c1
934 nmdc:mga08y16_54366_c1
935 nmdc:mga08y16_69948_c1
936 nmdc:mga0n895_1570_c1
937 nmdc:mga0n895_201043_c1
938 nmdc:mga0n895_373291_c1
939 nmdc:mga0n895_78559_c1
940 nmdc:mga0rr50_381_c1
941 nmdc:mga0rr50_65809_c1
942 nmdc:mga0rr50_78257_c1
943 nmdc:mga08x19_18392_c1
944 nmdc:mga08x19_2762_c1
945 nmdc:mga0a205_117023_c1
946 nmdc:mga0a205_128314_c1
947 nmdc:mga0a205_269416_c1
948 nmdc:mga0a205_93_c2
949 Ga0495601_0240439
950 Ga0501084_0010682
951 Ga0501084_0028948
952 Ga0501084_0085086
953 Ga0501082_0000529
954 Ga0501082_0003995
955 Ga0501082_0015736
956 Ga0501082_0019934
957 Ga0501082_0213684
958 Ga0501082_0647668
959 Ga0530510_0000975
960 Ga0530510_0002046
961 Ga0530510_0002851
962 Ga0530510_0097676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pun-assembly1.cif.gz_B structures of 5-methylthioribose kinase reveal substrate specificity and unusual mode of nucleotide binding 0.6579 92 125
4aee-assembly2.cif.gz_B crystal structure of maltogenic amylase from s.marinus 0.6177 96 138
2zid-assembly1.cif.gz_A crystal structure of dextran glucosidase e236q complex with isomaltotriose 0.6129 97 133
6hhm-assembly1.cif.gz_A crystal structure of the family s1_7 ulvan-specific sulfatase fa22070 from formosa agariphila 0.586 83 125
2ckp-assembly1.cif.gz_A crystal structure of human choline kinase alpha-2 in complex with adp 0.5792 97 125
ID Description Score Start End Superfamily
2v7sA00 Alpha Beta;2-Layer Sandwich;TBP-like; 0.7449 98 126 3.30.2030.20
4i8oB02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Bacterial toxin RNase RnlA/LsoA, N repeated domain 0.7041 97 125 3.30.160.690
af_A0A0P0WM50_5_185_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.6002 101 125 3.40.1110.10
af_A4ID90_1_243_3.30.230.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.5943 97 131 3.30.230.70
af_A0A1D6IKI0_5_255_3.30.230.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.5821 97 131 3.30.230.70
ID Description Score Start End GO Terms
AF-A0A1F4FYX6-F1-model_v4 Uncharacterized protein 0.9951 6 194
AF-A0A1F4FYX6-F1-model_v4 Uncharacterized protein 0.9898 6 194
AF-A0A177R4M3-F1-model_v4 deleted 0.9815 4 194
AF-A0A2V6Y191-F1-model_v4 Uncharacterized protein 0.9797 1 175
AF-A0A2V6UYB3-F1-model_v4 Uncharacterized protein 0.9754 1 194

Map