F452498

General Info

Members Datasets Scaffolds Average Seq Length
481 316 401 252

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0031880|Ga0496126_0031880_1232_2134
Length 300
Sequence MASVKLSRWNHESLLIRLIVRSFGASRNMASGRADVRESAMKTILIIGIGAGDPDYITVQAVKALNRVDVFFLMDKGPAKQKLRALREELCRQHIKGHSYRFAEASSPPRDTAPADYRASVDELNREKQDVFERLIESELADGQTAGILVWGDPMLYDSTIRNIEAIVAGGCHHVAYEVIPGITAVQALAARHKIPLNRIAEPVLLTTGRKLAEGFPSGIDSVVVLLDGEDTYTRFADADVHGDMEIYWGAYLGTPDEILIAGKVADVVEQIHRRRTEARKAHGWIMDTYLMRKANKKAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
4 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
5 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
6 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
7 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
8 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
9 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
10 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
11 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
12 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
13 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
14 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
15 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
16 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
17 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
18 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
19 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
20 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
21 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
22 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
23 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
24 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
25 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
26 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
27 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
28 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
29 2643221629 Devosia sp. Root105 Isolate Unclassified
30 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
31 2643221662 Devosia sp. Root413D1 Isolate Unclassified
32 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
33 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
34 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
35 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
36 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
37 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
38 2773857925 Microvirga vignae BR3299 Isolate Unclassified
39 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
40 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
41 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
42 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
43 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
44 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
45 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
46 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
47 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
48 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
49 2808606448 Streptomyces sp. 193411 Isolate Unclassified
50 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
51 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
52 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
53 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
54 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
55 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
56 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
57 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
58 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
59 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
60 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
61 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
62 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
63 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
64 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
65 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
66 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
67 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
68 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
69 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
70 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
71 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
72 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
73 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
74 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
75 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
76 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
77 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
78 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
79 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
80 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
81 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
82 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
83 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
84 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
85 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
86 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
87 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
88 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
89 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
162 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
185 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
186 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
192 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
193 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
196 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
197 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
207 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
208 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
257 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
258 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
283 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
284 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
303 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
304 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
309 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
312 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
313 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
314 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
315 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
316 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.16
Metatranscriptomes 0.21
Isolates 16.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.65
Nodule 0.83
Rhizoplane 6.24
Rhizosphere 79.63
Stem 0
Stem Tuber 0
Unclassified 6.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_851299 2162886007 Bacteria 3739
2 JGI25153J46596_10002397 3300003215 Bacteria 10823
3 rootH2_10067181 3300003320 Bacteria 3283
4 Ga0006562J51391_1040981 3300003578 Bacteria 1350
5 Ga0055530_10000002 3300003791 Bacteria 300466
6 Ga0055540_1000009 3300003792 Bacteria 300466
7 Ga0065714_10002605 3300005288 Bacteria 36252
8 Ga0065704_10070398 3300005289 Bacteria 26773
9 Ga0070676_10110144 3300005328 Bacteria 1713
10 Ga0070683_100150862 3300005329 Bacteria 2203
11 Ga0070682_100049641 3300005337 Bacteria 2616
12 Ga0070671_100335004 3300005355 Bacteria 1290
13 Ga0070671_100382148 3300005355 Bacteria 1203
14 Ga0070714_100097408 3300005435 Bacteria 2586
15 Ga0070706_100167594 3300005467 Bacteria 2051
16 Ga0070698_100000237 3300005471 Bacteria 54801
17 Ga0070684_100171897 3300005535 Bacteria 1968
18 Ga0070684_100242068 3300005535 Bacteria 1648
19 Ga0070697_100070215 3300005536 Bacteria 2871
20 Ga0070665_100004963 3300005548 Bacteria 13793
21 Ga0070665_100098795 3300005548 Bacteria 2924
22 Ga0068855_100472067 3300005563 Bacteria 1366
23 Ga0070664_100043891 3300005564 Bacteria 3774
24 Ga0068854_100195178 3300005578 Bacteria 1588
25 Ga0068856_100134458 3300005614 Bacteria 2478
26 Ga0070702_100090590 3300005615 Bacteria 1854
27 Ga0068852_100139426 3300005616 Bacteria 2242
28 Ga0068859_100221069 3300005617 Bacteria 1982
29 Ga0068858_100300735 3300005842 Bacteria 1531
30 Ga0081455_10001773 3300005937 Bacteria 26059
31 Ga0081455_10069814 3300005937 Bacteria 2919
32 Ga0081540_1141417 3300005983 Bacteria 965
33 Ga0081539_10003622 3300005985 Bacteria 18632
34 Ga0081539_10097533 3300005985 Bacteria 1505
35 Ga0070715_10003095 3300006163 Bacteria 5218
36 Ga0075366_10016086 3300006195 Bacteria 4295
37 Ga0075366_10063053 3300006195 Bacteria 2203
38 Ga0075428_100156077 3300006844 Bacteria 2479
39 Ga0075428_100519845 3300006844 Bacteria 1273
40 Ga0075430_100420565 3300006846 Bacteria 1103
41 Ga0075431_100036864 3300006847 Bacteria 5038
42 Ga0075429_100002535 3300006880 Bacteria 15386
43 Ga0097620_100221056 3300006931 Bacteria 1982
44 Ga0079104_1000006 3300006946 Bacteria 396255
45 Ga0099826_10011653 3300006948 Bacteria 6619
46 Ga0099794_10103555 3300007265 Bacteria 1422
47 Ga0099795_10002802 3300007788 Bacteria 4197
48 Ga0099795_10067918 3300007788 Bacteria 1339
49 Ga0105251_10003897 3300009011 Bacteria 10607
50 Ga0105240_10183175 3300009093 Bacteria 2470
51 Ga0111539_10005590 3300009094 Bacteria 16260
52 Ga0111539_10009177 3300009094 Bacteria 12508
53 Ga0111539_10276299 3300009094 Bacteria 1955
54 Ga0114129_10105288 3300009147 Bacteria 3899
55 Ga0105242_10092683 3300009176 Bacteria 2545
56 Ga0105238_10524152 3300009551 Bacteria 1188
57 Ga0099796_10001734 3300010159 Bacteria 4532
58 Ga0105239_10109848 3300010375 Bacteria 3057
59 Ga0105246_10370255 3300011119 Bacteria 1180
60 Ga0157373_10002058 3300013100 Bacteria 15239
61 Ga0157370_10262128 3300013104 Bacteria 1597
62 Ga0157374_10425226 3300013296 Bacteria 1327
63 Ga0157372_10011882 3300013307 Bacteria 9277
64 Ga0157375_10221342 3300013308 Bacteria 2051
65 Ga0157380_10316870 3300014326 Bacteria 1444
66 Ga0182008_10057566 3300014497 Bacteria 1919
67 Ga0182006_1008564 3300015261 Bacteria 4636
68 Ga0182005_1001215 3300015265 Bacteria 10653
69 Ga0213872_10037407 3300021361 Bacteria 2215
70 Ga0209677_100210 3300025253 Bacteria 44738
71 Ga0209676_1004694 3300025292 Bacteria 7496
72 Ga0209758_1000217 3300025297 Bacteria 124619
73 Ga0209758_1002194 3300025297 Bacteria 20448
74 Ga0209050_1000009 3300025298 Bacteria 1047265
75 Ga0207426_1009111 3300025302 Bacteria 3948
76 Ga0207426_1012124 3300025302 Bacteria 3252
77 Ga0207426_1015727 3300025302 Bacteria 2739
78 Ga0209051_1000008 3300025303 Bacteria 706935
79 Ga0209257_1003428 3300025304 Bacteria 13622
80 Ga0207688_10022962 3300025901 Bacteria 3414
81 Ga0207643_10036719 3300025908 Bacteria 2748
82 Ga0207695_10382987 3300025913 Bacteria 1292
83 Ga0207657_10158833 3300025919 Bacteria 1837
84 Ga0207649_10111732 3300025920 Bacteria 1827
85 Ga0207694_10222973 3300025924 Bacteria 1538
86 Ga0207659_10740916 3300025926 Bacteria 843
87 Ga0207664_10045068 3300025929 Bacteria 3457
88 Ga0207644_10716350 3300025931 Bacteria 835
89 Ga0207690_10528246 3300025932 Bacteria 957
90 Ga0207686_10110364 3300025934 Bacteria 1854
91 Ga0207661_10136882 3300025944 Bacteria 2104
92 Ga0207679_10144389 3300025945 Bacteria 1928
93 Ga0207668_10206863 3300025972 Bacteria 1567
94 Ga0207677_10310994 3300026023 Bacteria 1305
95 Ga0207703_10266981 3300026035 Bacteria 1549
96 Ga0207639_10215611 3300026041 Bacteria 1655
97 Ga0207648_10391297 3300026089 Bacteria 1258
98 Ga0207676_10234974 3300026095 Bacteria 1641
99 Ga0207698_10263118 3300026142 Bacteria 1586
100 Ga0209281_1000011 3300027111 Bacteria 695292
101 Ga0209179_1004115 3300027512 Bacteria 2167
102 Ga0207428_10022351 3300027907 Bacteria 5339
103 Ga0207428_10037628 3300027907 Bacteria 3936
104 Ga0268266_10009201 3300028379 Bacteria 8716
105 Ga0268266_10057831 3300028379 Bacteria 3337
106 Ga0268266_10098970 3300028379 Bacteria 2567
107 Ga0268266_10581460 3300028379 Bacteria 1075
108 Ga0314311_1055894 3300030733 Bacteria 1288
109 Ga0307408_100002858 3300031548 Bacteria 11962
110 Ga0307408_100022193 3300031548 Bacteria 4309
111 Ga0307408_100046409 3300031548 Bacteria 3107
112 Ga0307408_100157462 3300031548 Bacteria 1800
113 Ga0307516_10018008 3300031730 Bacteria 7349
114 Ga0307405_10000826 3300031731 Bacteria 12179
115 Ga0307405_10013119 3300031731 Bacteria 4412
116 Ga0307406_10002853 3300031901 Bacteria 9414
117 Ga0307406_10017199 3300031901 Bacteria 4209
118 Ga0307407_10145337 3300031903 Bacteria 1534
119 Ga0307412_10000128 3300031911 Bacteria 55850
120 Ga0307412_10000371 3300031911 Bacteria 28024
121 Ga0307412_10042036 3300031911 Bacteria 2966
122 Ga0307409_100018187 3300031995 Bacteria 4713
123 Ga0307416_100426212 3300032002 Bacteria 1372
124 Ga0307414_10014547 3300032004 Bacteria 4723
125 Ga0307411_10015076 3300032005 Bacteria 4326
126 Ga0307411_10091969 3300032005 Bacteria 2120
127 Ga0307411_10139271 3300032005 Bacteria 1787
128 Ga0307510_10144818 3300033180 Bacteria 2011
129 Ga0373941_0074356 3300035115 Bacteria 1135
130 Ga0373925_0001249 3300037068 Bacteria 22424
131 Ga0373925_0338350 3300037068 Bacteria 1220
132 Ga0395899_0002863 3300037312 Bacteria 13877
133 Ga0395899_0447402 3300037312 Bacteria 847
134 Ga0395900_0004062 3300037418 Bacteria 15603
135 Ga0395900_0005170 3300037418 Bacteria 13703
136 Ga0395900_0234914 3300037418 Bacteria 1842
137 Ga0395898_0003863 3300037466 Bacteria 16564
138 Ga0395898_0026822 3300037466 Bacteria 5790
139 Ga0395898_0580602 3300037466 Bacteria 1063
140 Ga0395901_0001707 3300038443 Bacteria 22683
141 Ga0395901_0089025 3300038443 Bacteria 3229
142 Ga0436361_0566628 3300039447 Bacteria 12867
143 Ga0439438_000589 3300041405 Bacteria 16439
144 Ga0439438_001651 3300041405 Bacteria 9791
145 Ga0439438_001834 3300041405 Bacteria 9299
146 Ga0439438_006927 3300041405 Bacteria 3938
147 Ga0439447_017362 3300041407 Bacteria 1959
148 Ga0439466_0012160 3300041411 Bacteria 3176
149 Ga0439466_0049212 3300041411 Bacteria 1384
150 Ga0439431_0002951 3300041997 Bacteria 3735
151 Ga0439442_046849 3300042002 Bacteria 911
152 Ga0439445_0045244 3300042004 Bacteria 1177
153 Ga0439432_000656 3300042006 Bacteria 12954
154 Ga0439452_011442 3300042010 Bacteria 2548
155 Ga0439452_023023 3300042010 Bacteria 1607
156 Ga0439463_003441 3300042016 Bacteria 4006
157 Ga0450910_004749 3300042147 Bacteria 1843
158 Ga0439446_0016756 3300042156 Bacteria 2043
159 Ga0450909_000416 3300042185 Bacteria 5472
160 Ga0450893_0045389 3300042532 Bacteria 813
161 Ga0439440_0009566 3300042993 Bacteria 2010
162 Ga0466972_0007772 3300044658 Bacteria 5383
163 Ga0466972_0009741 3300044658 Bacteria 4823
164 Ga0466966_0049773 3300044684 Bacteria 2668
165 Ga0466966_0256170 3300044684 Bacteria 1054
166 Ga0466961_0041048 3300044693 Bacteria 2966
167 Ga0466971_0154190 3300044719 Bacteria 1073
168 Ga0466970_0186977 3300044765 Bacteria 1150
169 Ga0466960_0047637 3300044901 Bacteria 2056
170 Ga0466958_0164724 3300045836 Bacteria 1402
171 Ga0466958_0188214 3300045836 Bacteria 1311
172 Ga0466967_0010362 3300045976 Bacteria 6988
173 Ga0466967_0175901 3300045976 Bacteria 2016
174 Ga0495617_006879 3300046452 Bacteria 3969
175 Ga0495590_0000486 3300046457 Bacteria 19590
176 Ga0495591_000002 3300046458 Bacteria 455013
177 Ga0495591_000121 3300046458 Bacteria 84919
178 Ga0495591_000552 3300046458 Bacteria 28749
179 Ga0495591_003717 3300046458 Bacteria 7733
180 Ga0495638_0001203 3300046460 Bacteria 24737
181 Ga0495638_0008210 3300046460 Bacteria 7421
182 Ga0495638_0014457 3300046460 Bacteria 5333
183 Ga0495638_0194394 3300046460 Bacteria 1149
184 Ga0495650_0000872 3300046471 Bacteria 35863
185 Ga0495650_0006061 3300046471 Bacteria 7635
186 Ga0495605_0000566 3300046474 Bacteria 30114
187 Ga0495605_0003244 3300046474 Bacteria 9767
188 Ga0495605_0022573 3300046474 Bacteria 3321
189 Ga0495605_0035083 3300046474 Bacteria 2536
190 Ga0495605_0070395 3300046474 Bacteria 1654
191 Ga0495605_0072205 3300046474 Bacteria 1628
192 Ga0495605_0119479 3300046474 Bacteria 1195
193 Ga0495584_0010082 3300046491 Bacteria 4852
194 Ga0495585_0102600 3300046492 Bacteria 1528
195 Ga0495596_0000056 3300046500 Bacteria 81755
196 Ga0495596_0012353 3300046500 Bacteria 3657
197 Ga0495607_0000118 3300046501 Bacteria 83429
198 Ga0495607_0000258 3300046501 Bacteria 56810
199 Ga0495607_0000303 3300046501 Bacteria 51474
200 Ga0495607_0000594 3300046501 Bacteria 35287
201 Ga0495607_0000863 3300046501 Bacteria 28384
202 Ga0495607_0009747 3300046501 Bacteria 6483
203 Ga0495607_0011351 3300046501 Bacteria 5936
204 Ga0495607_0061802 3300046501 Bacteria 2127
205 Ga0495607_0090662 3300046501 Bacteria 1656
206 Ga0495583_0000206 3300046506 Bacteria 99380
207 Ga0495583_0001557 3300046506 Bacteria 22698
208 Ga0495583_0009670 3300046506 Bacteria 5730
209 Ga0495606_0000028 3300046507 Bacteria 251032
210 Ga0495606_0001857 3300046507 Bacteria 26561
211 Ga0495606_0016369 3300046507 Bacteria 5657
212 Ga0495606_0046530 3300046507 Bacteria 2867
213 Ga0495606_0296213 3300046507 Bacteria 878
214 Ga0495610_0015135 3300046512 Bacteria 4497
215 Ga0495610_0038308 3300046512 Bacteria 2434
216 Ga0495610_0127495 3300046512 Bacteria 1108
217 Ga0495616_0009788 3300046513 Bacteria 5585
218 Ga0495616_0038562 3300046513 Bacteria 2452
219 Ga0495616_0063340 3300046513 Bacteria 1808
220 Ga0495620_0000159 3300046515 Bacteria 54696
221 Ga0495620_0002001 3300046515 Bacteria 11910
222 Ga0495620_0002384 3300046515 Bacteria 10891
223 Ga0495620_0017366 3300046515 Bacteria 3588
224 Ga0495631_0020726 3300046518 Bacteria 3068
225 Ga0495632_0002121 3300046519 Bacteria 15472
226 Ga0495632_0021936 3300046519 Bacteria 3431
227 Ga0495632_0045781 3300046519 Bacteria 2177
228 Ga0495637_0000015 3300046520 Bacteria 228949
229 Ga0495637_0000134 3300046520 Bacteria 55462
230 Ga0495637_0000416 3300046520 Bacteria 31316
231 Ga0495637_0004024 3300046520 Bacteria 7674
232 Ga0495637_0024949 3300046520 Bacteria 2700
233 Ga0495637_0078239 3300046520 Bacteria 1322
234 Ga0495643_0007097 3300046522 Bacteria 7270
235 Ga0495643_0009983 3300046522 Bacteria 5863
236 Ga0495643_0018989 3300046522 Bacteria 3981
237 Ga0495643_0062506 3300046522 Bacteria 1971
238 Ga0495644_0003452 3300046523 Bacteria 6254
239 Ga0495644_0012324 3300046523 Bacteria 3288
240 Ga0495648_0004475 3300046524 Bacteria 11934
241 Ga0495648_0006605 3300046524 Bacteria 9413
242 Ga0495654_0001508 3300046530 Bacteria 15905
243 Ga0495654_0002180 3300046530 Bacteria 12724
244 Ga0495654_0007754 3300046530 Bacteria 5974
245 Ga0495609_0000107 3300046538 Bacteria 97734
246 Ga0495597_0000011 3300046542 Bacteria 221377
247 Ga0495597_0004986 3300046542 Bacteria 7125
248 Ga0495597_0011331 3300046542 Bacteria 4326
249 Ga0495633_0008876 3300046558 Bacteria 5608
250 Ga0495656_0029253 3300046615 Bacteria 2217
251 Ga0495668_0001799 3300046616 Bacteria 19553
252 Ga0495668_0020380 3300046616 Bacteria 3814
253 Ga0495668_0027838 3300046616 Bacteria 3201
254 Ga0495611_0000556 3300046648 Bacteria 21722
255 Ga0495625_0000004 3300046660 Bacteria 611314
256 Ga0495625_0005806 3300046660 Bacteria 11147
257 Ga0495625_0027009 3300046660 Bacteria 4329
258 Ga0495661_0000006 3300046665 Bacteria 427288
259 Ga0495661_0005014 3300046665 Bacteria 9453
260 Ga0495670_0044278 3300046691 Bacteria 2222
261 Ga0495671_0023796 3300046692 Bacteria 3197
262 Ga0495671_0131834 3300046692 Bacteria 1218
263 Ga0495649_0007812 3300046694 Bacteria 6482
264 Ga0495649_0011441 3300046694 Bacteria 5202
265 Ga0495649_0019792 3300046694 Bacteria 3780
266 Ga0495649_0075524 3300046694 Bacteria 1804
267 Ga0495649_0113681 3300046694 Bacteria 1434
268 Ga0495589_0007435 3300046794 Bacteria 5739
269 Ga0495589_0011129 3300046794 Bacteria 4669
270 Ga0495589_0082654 3300046794 Bacteria 1561
271 Ga0495660_0001290 3300046810 Bacteria 17358
272 Ga0495660_0016234 3300046810 Bacteria 4295
273 Ga0495660_0026062 3300046810 Bacteria 3316
274 Ga0495660_0048767 3300046810 Bacteria 2314
275 Ga0495660_0089662 3300046810 Bacteria 1601
276 Ga0495604_0007022 3300047317 Bacteria 8927
277 Ga0495672_0000548 3300047320 Bacteria 42693
278 Ga0495672_0006423 3300047320 Bacteria 9108
279 Ga0495672_0019488 3300047320 Bacteria 4472
280 Ga0495672_0075730 3300047320 Bacteria 1892
281 Ga0495676_0000004 3300047321 Bacteria 313696
282 Ga0495683_0000640 3300047323 Bacteria 26040
283 Ga0495679_000400 3300047446 Bacteria 32581
284 Ga0495673_0003985 3300047469 Bacteria 9433
285 Ga0495673_0014148 3300047469 Bacteria 4158
286 Ga0495673_0016970 3300047469 Bacteria 3708
287 Ga0495673_0021747 3300047469 Bacteria 3159
288 Ga0495681_0000576 3300047470 Bacteria 28018
289 Ga0495681_0000695 3300047470 Bacteria 25705
290 Ga0495686_0022024 3300047472 Bacteria 4220
291 Ga0495686_0042013 3300047472 Bacteria 2909
292 Ga0495686_0120698 3300047472 Bacteria 1562
293 Ga0495626_0000012 3300048091 Bacteria 258483
294 Ga0495626_0000606 3300048091 Bacteria 35033
295 Ga0495626_0156184 3300048091 Bacteria 959
296 Ga0496102_0292800 3300048905 Bacteria 1534
297 Ga0496102_0334236 3300048905 Bacteria 1427
298 Ga0496110_0415114 3300048913 Bacteria 1227
299 Ga0496112_0122506 3300048915 Bacteria 2571
300 Ga0496121_0014618 3300048924 Bacteria 8305
301 Ga0496124_0002425 3300048927 Bacteria 24458
302 Ga0496124_0020534 3300048927 Bacteria 6100
303 Ga0496126_0031880 3300048929 Bacteria 4973
304 Ga0495678_006632 3300049459 Bacteria 6131
305 Ga0495678_010722 3300049459 Bacteria 4432
306 Ga0495678_071001 3300049459 Bacteria 1276
307 Ga0495682_0000023 3300049460 Bacteria 158998
308 Ga0501031_0020425 3300049568 Bacteria 4317
309 Ga0501032_0034972 3300049569 Bacteria 3436
310 Ga0501032_0114016 3300049569 Bacteria 1788
311 Ga0501032_0258194 3300049569 Bacteria 1130
312 Ga0501033_0003338 3300049570 Bacteria 13252
313 Ga0501033_0017702 3300049570 Bacteria 5381
314 Ga0501033_0069663 3300049570 Bacteria 2585
315 Ga0501033_0294179 3300049570 Bacteria 1144
316 Ga0501034_0001799 3300049571 Bacteria 27362
317 Ga0501034_0014024 3300049571 Bacteria 8252
318 Ga0501034_0071062 3300049571 Bacteria 3491
319 Ga0501034_0086451 3300049571 Bacteria 3136
320 Ga0501034_0215008 3300049571 Bacteria 1876
321 Ga0501034_0564809 3300049571 Bacteria 1046
322 Ga0501034_0949235 3300049571 Bacteria 746
323 Ga0501036_0002121 3300049572 Bacteria 15482
324 Ga0501036_0012732 3300049572 Bacteria 6977
325 Ga0501036_0169709 3300049572 Bacteria 1838
326 Ga0501036_0649382 3300049572 Bacteria 873
327 Ga0501037_0035336 3300049573 Bacteria 3685
328 Ga0501037_0346117 3300049573 Bacteria 1026
329 Ga0501038_0015882 3300049574 Bacteria 6840
330 Ga0501038_0025670 3300049574 Bacteria 5249
331 Ga0501038_0032758 3300049574 Bacteria 4582
332 Ga0501038_0157642 3300049574 Bacteria 1847
333 Ga0501039_0004568 3300049575 Bacteria 10460
334 Ga0501039_0139994 3300049575 Bacteria 1901
335 Ga0501040_0033358 3300049576 Bacteria 3487
336 Ga0501041_0016467 3300049577 Bacteria 4395
337 Ga0501042_0122492 3300049578 Bacteria 1873
338 Ga0501043_0022977 3300049579 Bacteria 4890
339 Ga0501043_0052949 3300049579 Bacteria 3187
340 Ga0501043_0062135 3300049579 Bacteria 2933
341 Ga0501043_0161090 3300049579 Bacteria 1753
342 Ga0501043_0252374 3300049579 Bacteria 1358
343 Ga0501046_0006380 3300049580 Bacteria 10455
344 Ga0501046_0028483 3300049580 Bacteria 4547
345 Ga0501047_0032373 3300049581 Bacteria 5047
346 Ga0501047_0515112 3300049581 Bacteria 1022
347 Ga0501047_0706396 3300049581 Bacteria 825
348 Ga0501048_0006577 3300049582 Bacteria 8834
349 Ga0501069_0179403 3300049585 Bacteria 1224
350 Ga0501070_0011751 3300049586 Bacteria 7396
351 Ga0501071_0021711 3300049587 Bacteria 4474
352 Ga0501072_0010501 3300049588 Bacteria 7051
353 Ga0501073_0351873 3300049589 Bacteria 1017
354 Ga0501074_0002440 3300049590 Bacteria 12974
355 Ga0501075_0008831 3300049591 Bacteria 7025
356 Ga0501076_0128349 3300049592 Bacteria 2055
357 Ga0501077_0070167 3300049593 Bacteria 2220
358 Ga0501077_0143087 3300049593 Bacteria 1517
359 Ga0501222_000912 3300049662 Bacteria 4247
360 Ga0501227_004969 3300049665 Bacteria 2854
361 Ga0501257_012580 3300049686 Bacteria 1936
362 Ga0501079_0141990 3300049741 Bacteria 1870
363 Ga0501080_0289383 3300049742 Bacteria 1488
364 Ga0501080_0298353 3300049742 Bacteria 1462
365 Ga0501080_0396611 3300049742 Bacteria 1242
366 Ga0501035_0024433 3300049822 Bacteria 5541
367 Ga0501035_0058943 3300049822 Bacteria 3419
368 Ga0501035_0495315 3300049822 Bacteria 1006
369 Ga0501035_0582361 3300049822 Bacteria 914
370 Ga0501044_0008352 3300049823 Bacteria 11351
371 Ga0501044_0056624 3300049823 Bacteria 4025
372 Ga0501044_0312173 3300049823 Bacteria 1498
373 Ga0501045_0027900 3300049824 Bacteria 4071
374 Ga0501045_0229594 3300049824 Bacteria 1382
375 Ga0501045_0323181 3300049824 Bacteria 1148
376 Ga0501226_000627 3300049853 Bacteria 4839
377 nmdc:mga03683_15136_c1 3300050489 Bacteria 2873
378 nmdc:mga03683_3807_c1 3300050489 Bacteria 4925
379 nmdc:mga03n38_95403_c1 3300050490 Bacteria 1425
380 nmdc:mga0k408_140794_c1 3300050493 Bacteria 1435
381 nmdc:mga0k408_87439_c1 3300050493 Bacteria 1830
382 nmdc:mga06z11_68698_c1 3300050494 Bacteria 1868
383 nmdc:mga07m45_13942_c1 3300050496 Bacteria 2328
384 nmdc:mga07m45_152264_c1 3300050496 Bacteria 1341
385 nmdc:mga05p37_418653_c1 3300050507 Bacteria 1560
386 nmdc:mga09592_33835_c1 3300050508 Bacteria 4270
387 nmdc:mga0qj67_6457_c1 3300050509 Bacteria 8619
388 nmdc:mga06r32_367243_c1 3300050510 Bacteria 1423
389 nmdc:mga08y16_14200_c1 3300050511 Bacteria 8381
390 nmdc:mga08y16_237455_c1 3300050511 Bacteria 1885
391 nmdc:mga0a205_372353_c1 3300050515 Bacteria 1294
392 nmdc:mga0sz30_31220_c1 3300050516 Bacteria 2204
393 Ga0500562_015579 3300053108 Bacteria 1951
394 Ga0500573_0049046 3300053140 Bacteria 2430
395 Ga0500616_0003398 3300053153 Bacteria 12214
396 Ga0500616_0040263 3300053153 Bacteria 2514
397 Ga0500620_007943 3300053155 Bacteria 2651
398 Ga0500636_0032095 3300053177 Bacteria 3108
399 Ga0500609_016085 3300053731 Bacteria 1015
400 Ga0500552_000030 3300053733 Bacteria 13069
401 Ga0501084_0268134 3300054114 Bacteria 1441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0017366 Ga0495620_0017366_2917_3573 218
2 3300048913 Ga0496110_0415114 Ga0496110_0415114_561_1217 218
3 3300049571 Ga0501034_0949235 Ga0501034_0949235_13_678 218
4 3300046512 Ga0495610_0038308 Ga0495610_0038308_33_707 219
5 3300037312 Ga0395899_0447402 Ga0395899_0447402_17_703 222
6 3300049824 Ga0501045_0229594 Ga0501045_0229594_646_1344 222
7 3300026089 Ga0207648_10391297 Ga0207648_103912972 224
8 3300006195 Ga0075366_10016086 Ga0075366_100160864 227
9 3300046513 Ga0495616_0063340 Ga0495616_0063340_26_766 232
10 3300030733 Ga0314311_1055894 Ga0314311_10558942 235
11 3300031548 Ga0307408_100022193 Ga0307408_1000221932 235
12 3300031731 Ga0307405_10000826 Ga0307405_100008268 235
13 3300031901 Ga0307406_10017199 Ga0307406_100171995 235
14 3300031903 Ga0307407_10145337 Ga0307407_101453372 235
15 3300031911 Ga0307412_10000128 Ga0307412_1000012845 235
16 3300031995 Ga0307409_100018187 Ga0307409_1000181874 235
17 3300032002 Ga0307416_100426212 Ga0307416_1004262122 235
18 3300032004 Ga0307414_10014547 Ga0307414_100145474 235
19 3300032005 Ga0307411_10091969 Ga0307411_100919692 235
20 3300046474 Ga0495605_0072205 Ga0495605_0072205_859_1599 235
21 3300049569 Ga0501032_0258194 Ga0501032_0258194_378_1118 235
22 3300049662 Ga0501222_000912 Ga0501222_000912_3020_3775 235
23 3300049665 Ga0501227_004969 Ga0501227_004969_88_828 235
24 3300049686 Ga0501257_012580 Ga0501257_012580_515_1270 235
25 3300049853 Ga0501226_000627 Ga0501226_000627_416_1156 235
26 3300031548 Ga0307408_100157462 Ga0307408_1001574622 239
27 3300032005 Ga0307411_10139271 Ga0307411_101392712 239
28 3300049575 Ga0501039_0139994 Ga0501039_0139994_410_1138 239
29 3300005985 Ga0081539_10097533 Ga0081539_100975333 240
30 3300031548 Ga0307408_100002858 Ga0307408_1000028587 240
31 3300031911 Ga0307412_10000371 Ga0307412_100003719 240
32 3300047317 Ga0495604_0007022 Ga0495604_0007022_3934_4656 240
33 3300031731 Ga0307405_10013119 Ga0307405_100131192 241
34 3300031901 Ga0307406_10002853 Ga0307406_100028532 241
35 3300031911 Ga0307412_10042036 Ga0307412_100420365 241
36 3300032005 Ga0307411_10015076 Ga0307411_100150766 241
37 iso_pu_bacteria 2547132111 2547412316 242
38 iso_pu_bacteria 2784132148 2784591979 242
39 iso_pu_bacteria 2808606448 2809235617 242
40 3300005435 Ga0070714_100097408 Ga0070714_1000974082 243
41 3300006163 Ga0070715_10003095 Ga0070715_100030955 243
42 3300025929 Ga0207664_10045068 Ga0207664_100450684 243
43 3300049581 Ga0501047_0032373 Ga0501047_0032373_3932_4681 243
44 3300049593 Ga0501077_0143087 Ga0501077_0143087_601_1350 243
45 3300042532 Ga0450893_0045389 Ga0450893_0045389_14_796 244
46 iso_pu_bacteria 2599185307 2599974126 244
47 3300006846 Ga0075430_100420565 Ga0075430_1004205652 245
48 3300007265 Ga0099794_10103555 Ga0099794_101035551 245
49 3300007788 Ga0099795_10002802 Ga0099795_100028026 245
50 3300010159 Ga0099796_10001734 Ga0099796_100017345 245
51 3300027512 Ga0209179_1004115 Ga0209179_10041152 245
52 3300046460 Ga0495638_0001203 Ga0495638_0001203_2592_3353 245
53 3300046530 Ga0495654_0002180 Ga0495654_0002180_8539_9300 245
54 3300005337 Ga0070682_100049641 Ga0070682_1000496412 246
55 3300005615 Ga0070702_100090590 Ga0070702_1000905902 246
56 3300005617 Ga0068859_100221069 Ga0068859_1002210692 246
57 3300005842 Ga0068858_100300735 Ga0068858_1003007352 246
58 3300006931 Ga0097620_100221056 Ga0097620_1002210562 246
59 3300011119 Ga0105246_10370255 Ga0105246_103702551 246
60 3300013308 Ga0157375_10221342 Ga0157375_102213422 246
61 3300014326 Ga0157380_10316870 Ga0157380_103168702 246
62 3300025901 Ga0207688_10022962 Ga0207688_100229623 246
63 3300025908 Ga0207643_10036719 Ga0207643_100367192 246
64 3300025919 Ga0207657_10158833 Ga0207657_101588332 246
65 3300025926 Ga0207659_10740916 Ga0207659_107409161 246
66 3300025932 Ga0207690_10528246 Ga0207690_105282461 246
67 3300026035 Ga0207703_10266981 Ga0207703_102669812 246
68 3300026095 Ga0207676_10234974 Ga0207676_102349741 246
69 3300026142 Ga0207698_10263118 Ga0207698_102631182 246
70 3300028379 Ga0268266_10098970 Ga0268266_100989702 246
71 iso_pu_bacteria 2643221629 2644165496 246
72 iso_pu_bacteria 2643221662 2644348490 246
73 iso_pu_bacteria 2811994881 2812368912 246
74 iso_pu_bacteria 2923519811 2923522986 246
75 3300013307 Ga0157372_10011882 Ga0157372_100118822 247
76 3300041405 Ga0439438_006927 Ga0439438_006927_713_1459 247
77 3300045836 Ga0466958_0164724 Ga0466958_0164724_73_837 247
78 3300046501 Ga0495607_0000863 Ga0495607_0000863_6979_7734 247
79 iso_pu_bacteria 2599185188 2599503301 247
80 iso_pu_bacteria 2599185248 2599771593 247
81 iso_pu_bacteria 2599185300 2599933816 247
82 iso_pu_bacteria 2599185324 2600069567 247
83 iso_pu_bacteria 2643221678 2644440932 247
84 iso_pu_bacteria 2651869719 2652545351 247
85 iso_pu_bacteria 2791355520 2794596797 247
86 iso_pu_bacteria 2808606359 2808845345 247
87 iso_pu_bacteria 2808606361 2808854262 247
88 iso_pu_bacteria 2808606376 2808923132 247
89 iso_pu_bacteria 2808606378 2808934294 247
90 iso_pu_bacteria 2808606380 2808944994 247
91 iso_pu_bacteria 2808606383 2808962768 247
92 iso_pu_bacteria 2808606389 2808997817 247
93 iso_pu_bacteria 2811994917 2812482842 247
94 iso_pu_bacteria 2842854478 2842857619 247
95 iso_pu_bacteria 2862281513 2862283007 247
96 iso_pu_bacteria 2912723979 2912728933 247
97 iso_pu_bacteria 2912757875 2912764177 247
98 iso_pu_bacteria 2913036834 2913038862 247
99 iso_pu_bacteria 2919468124 2919475153 247
100 iso_pu_bacteria 2919481497 2919484102 247
101 iso_pu_bacteria 2947224130 2947225398 247
102 iso_pu_bacteria 2988728565 2988733851 247
103 iso_pu_bacteria 2995463766 2995464146 247
104 iso_pu_bacteria 3006393351 3006396249 247
105 iso_pu_bacteria 3006493962 3006494584 247
106 iso_pu_bacteria 3007861166 3007862632 247
107 iso_pu_bacteria 3007866637 3007869991 247
108 iso_pu_bacteria 8023623736 8023624164 247
109 iso_pu_bacteria 8056143049 8056145280 247
110 3300003215 JGI25153J46596_10002397 JGI25153J46596_100023973 248
111 3300006195 Ga0075366_10063053 Ga0075366_100630533 248
112 3300025297 Ga0209758_1000217 Ga0209758_100021781 248
113 3300025302 Ga0207426_1015727 Ga0207426_10157273 248
114 3300025931 Ga0207644_10716350 Ga0207644_107163501 248
115 3300046458 Ga0495591_000002 Ga0495591_000002_383145_383903 248
116 3300046458 Ga0495591_000552 Ga0495591_000552_23469_24230 248
117 3300046474 Ga0495605_0000566 Ga0495605_0000566_24082_24843 248
118 3300046474 Ga0495605_0003244 Ga0495605_0003244_5826_6584 248
119 3300046474 Ga0495605_0119479 Ga0495605_0119479_68_829 248
120 3300046501 Ga0495607_0000118 Ga0495607_0000118_18866_19624 248
121 3300046501 Ga0495607_0000258 Ga0495607_0000258_33392_34153 248
122 3300046506 Ga0495583_0001557 Ga0495583_0001557_2632_3393 248
123 3300046507 Ga0495606_0000028 Ga0495606_0000028_119574_120335 248
124 3300046507 Ga0495606_0296213 Ga0495606_0296213_16_777 248
125 3300046515 Ga0495620_0000159 Ga0495620_0000159_21041_21802 248
126 3300046520 Ga0495637_0078239 Ga0495637_0078239_113_871 248
127 3300046542 Ga0495597_0000011 Ga0495597_0000011_17633_18391 248
128 3300046616 Ga0495668_0020380 Ga0495668_0020380_2361_3122 248
129 3300046660 Ga0495625_0027009 Ga0495625_0027009_1689_2462 248
130 3300046810 Ga0495660_0001290 Ga0495660_0001290_5112_5870 248
131 3300047320 Ga0495672_0075730 Ga0495672_0075730_207_965 248
132 3300047469 Ga0495673_0003985 Ga0495673_0003985_6773_7534 248
133 3300047469 Ga0495673_0021747 Ga0495673_0021747_775_1536 248
134 3300048905 Ga0496102_0292800 Ga0496102_0292800_84_845 248
135 3300048915 Ga0496112_0122506 Ga0496112_0122506_594_1355 248
136 3300048924 Ga0496121_0014618 Ga0496121_0014618_6373_7134 248
137 3300048927 Ga0496124_0002425 Ga0496124_0002425_19725_20486 248
138 3300048927 Ga0496124_0020534 Ga0496124_0020534_1964_2725 248
139 3300049460 Ga0495682_0000023 Ga0495682_0000023_61410_62171 248
140 3300050493 nmdc:mga0k408_87439_c1 nmdc:mga0k408_87439_c1_178_924 248
141 3300053140 Ga0500573_0049046 Ga0500573_0049046_305_1162 248
142 iso_pu_bacteria 2511231027 2511392426 248
143 iso_pu_bacteria 2511231156 2511825851 248
144 iso_pu_bacteria 2599185212 2599611309 248
145 iso_pu_bacteria 2599185289 2599884129 248
146 iso_pu_bacteria 2599185291 2599899134 248
147 iso_pu_bacteria 2599185305 2599958728 248
148 iso_pu_bacteria 2599185306 2599968000 248
149 iso_pu_bacteria 2599185308 2599976790 248
150 iso_pu_bacteria 2599185311 2599993238 248
151 iso_pu_bacteria 2599185313 2600003406 248
152 iso_pu_bacteria 2599185314 2600010959 248
153 iso_pu_bacteria 2599185315 2600017983 248
154 iso_pu_bacteria 2599185316 2600022298 248
155 iso_pu_bacteria 2599185317 2600029076 248
156 iso_pu_bacteria 2599185318 2600037506 248
157 iso_pu_bacteria 2599185319 2600039560 248
158 iso_pu_bacteria 2599185321 2600052502 248
159 iso_pu_bacteria 2599185322 2600057257 248
160 iso_pu_bacteria 2599185323 2600068093 248
161 iso_pu_bacteria 2599185325 2600075573 248
162 iso_pu_bacteria 2600254930 2600358450 248
163 iso_pu_bacteria 2643221650 2644280732 248
164 iso_pu_bacteria 2667528170 2671091436 248
165 iso_pu_bacteria 2667528176 2671124544 248
166 iso_pu_bacteria 2675903515 2678262889 248
167 iso_pu_bacteria 2744054620 2745009226 248
168 iso_pu_bacteria 2773857925 2774871300 248
169 iso_pu_bacteria 2808606375 2808915081 248
170 iso_pu_bacteria 2825651385 2825652687 248
171 iso_pu_bacteria 2842871566 2842874791 248
172 iso_pu_bacteria 2882456835 2882463818 248
173 iso_pu_bacteria 2923586266 2923586945 248
174 iso_pu_bacteria 2928521798 2928523058 248
175 iso_pu_bacteria 2929144301 2929148089 248
176 iso_pu_bacteria 2931369376 2931370308 248
177 iso_pu_bacteria 2954011201 2954013576 248
178 iso_pu_bacteria 8002285264 8002291028 248
179 3300005329 Ga0070683_100150862 Ga0070683_1001508622 249
180 3300005355 Ga0070671_100335004 Ga0070671_1003350042 249
181 3300005355 Ga0070671_100382148 Ga0070671_1003821482 249
182 3300005535 Ga0070684_100242068 Ga0070684_1002420682 249
183 3300005548 Ga0070665_100004963 Ga0070665_1000049632 249
184 3300005548 Ga0070665_100098795 Ga0070665_1000987952 249
185 3300005563 Ga0068855_100472067 Ga0068855_1004720672 249
186 3300005564 Ga0070664_100043891 Ga0070664_1000438914 249
187 3300005614 Ga0068856_100134458 Ga0068856_1001344582 249
188 3300005616 Ga0068852_100139426 Ga0068852_1001394262 249
189 3300005983 Ga0081540_1141417 Ga0081540_11414172 249
190 3300009093 Ga0105240_10183175 Ga0105240_101831751 249
191 3300009094 Ga0111539_10276299 Ga0111539_102762993 249
192 3300009551 Ga0105238_10524152 Ga0105238_105241522 249
193 3300013296 Ga0157374_10425226 Ga0157374_104252262 249
194 3300025302 Ga0207426_1012124 Ga0207426_10121243 249
195 3300025913 Ga0207695_10382987 Ga0207695_103829872 249
196 3300025920 Ga0207649_10111732 Ga0207649_101117322 249
197 3300025924 Ga0207694_10222973 Ga0207694_102229732 249
198 3300025944 Ga0207661_10136882 Ga0207661_101368822 249
199 3300025945 Ga0207679_10144389 Ga0207679_101443892 249
200 3300026041 Ga0207639_10215611 Ga0207639_102156112 249
201 3300028379 Ga0268266_10009201 Ga0268266_100092014 249
202 3300028379 Ga0268266_10057831 Ga0268266_100578312 249
203 3300037312 Ga0395899_0002863 Ga0395899_0002863_8577_9326 249
204 3300037418 Ga0395900_0004062 Ga0395900_0004062_2303_3052 249
205 3300037418 Ga0395900_0005170 Ga0395900_0005170_1731_2480 249
206 3300037466 Ga0395898_0026822 Ga0395898_0026822_2714_3463 249
207 3300038443 Ga0395901_0001707 Ga0395901_0001707_11621_12370 249
208 3300038443 Ga0395901_0089025 Ga0395901_0089025_11_760 249
209 3300049571 Ga0501034_0086451 Ga0501034_0086451_1792_2541 249
210 3300049579 Ga0501043_0062135 Ga0501043_0062135_147_899 249
211 3300049742 Ga0501080_0289383 Ga0501080_0289383_374_1123 249
212 3300049742 Ga0501080_0396611 Ga0501080_0396611_251_1000 249
213 3300049822 Ga0501035_0582361 Ga0501035_0582361_76_828 249
214 3300053731 Ga0500609_016085 Ga0500609_016085_138_887 249
215 3300003320 rootH2_10067181 rootH2_100671812 250
216 3300005467 Ga0070706_100167594 Ga0070706_1001675943 250
217 3300005471 Ga0070698_100000237 Ga0070698_10000023743 250
218 3300005536 Ga0070697_100070215 Ga0070697_1000702152 250
219 3300006844 Ga0075428_100519845 Ga0075428_1005198451 250
220 3300009094 Ga0111539_10009177 Ga0111539_100091775 250
221 3300013104 Ga0157370_10262128 Ga0157370_102621282 250
222 3300015265 Ga0182005_1001215 Ga0182005_10012158 250
223 3300026023 Ga0207677_10310994 Ga0207677_103109942 250
224 3300027907 Ga0207428_10022351 Ga0207428_100223512 250
225 3300042002 Ga0439442_046849 Ga0439442_046849_120_881 250
226 3300044684 Ga0466966_0049773 Ga0466966_0049773_1086_1862 250
227 3300044693 Ga0466961_0041048 Ga0466961_0041048_1695_2471 250
228 3300045836 Ga0466958_0188214 Ga0466958_0188214_367_1143 250
229 3300049571 Ga0501034_0014024 Ga0501034_0014024_3914_4675 250
230 3300049573 Ga0501037_0346117 Ga0501037_0346117_71_832 250
231 3300049574 Ga0501038_0025670 Ga0501038_0025670_969_1739 250
232 3300050511 nmdc:mga08y16_14200_c1 nmdc:mga08y16_14200_c1_3268_4020 250
233 3300053108 Ga0500562_015579 Ga0500562_015579_235_996 250
234 3300053153 Ga0500616_0040263 Ga0500616_0040263_668_1429 250
235 iso_pu_bacteria 3002141150 3002145401 250
236 3300003578 Ga0006562J51391_1040981 Ga0006562J51391_10409811 251
237 3300005328 Ga0070676_10110144 Ga0070676_101101442 251
238 3300005578 Ga0068854_100195178 Ga0068854_1001951782 251
239 3300005985 Ga0081539_10003622 Ga0081539_1000362217 251
240 3300006946 Ga0079104_1000006 Ga0079104_100000649 251
241 3300006948 Ga0099826_10011653 Ga0099826_100116537 251
242 3300009176 Ga0105242_10092683 Ga0105242_100926832 251
243 3300010375 Ga0105239_10109848 Ga0105239_101098482 251
244 3300013100 Ga0157373_10002058 Ga0157373_1000205817 251
245 3300015261 Ga0182006_1008564 Ga0182006_10085643 251
246 3300021361 Ga0213872_10037407 Ga0213872_100374072 251
247 3300025253 Ga0209677_100210 Ga0209677_10021037 251
248 3300025297 Ga0209758_1002194 Ga0209758_100219413 251
249 3300025302 Ga0207426_1009111 Ga0207426_10091114 251
250 3300025934 Ga0207686_10110364 Ga0207686_101103643 251
251 3300025972 Ga0207668_10206863 Ga0207668_102068631 251
252 3300027111 Ga0209281_1000011 Ga0209281_1000011237 251
253 3300028379 Ga0268266_10581460 Ga0268266_105814602 251
254 3300031730 Ga0307516_10018008 Ga0307516_100180085 251
255 3300037068 Ga0373925_0001249 Ga0373925_0001249_17838_18602 251
256 3300037418 Ga0395900_0234914 Ga0395900_0234914_796_1587 251
257 3300037466 Ga0395898_0003863 Ga0395898_0003863_6005_6796 251
258 3300037466 Ga0395898_0580602 Ga0395898_0580602_280_1053 251
259 3300039447 Ga0436361_0566628 Ga0436361_0566628_4962_5735 251
260 3300041405 Ga0439438_000589 Ga0439438_000589_2125_2880 251
261 3300041405 Ga0439438_001651 Ga0439438_001651_6437_7192 251
262 3300041405 Ga0439438_001834 Ga0439438_001834_2125_2880 251
263 3300041407 Ga0439447_017362 Ga0439447_017362_629_1384 251
264 3300041411 Ga0439466_0012160 Ga0439466_0012160_130_885 251
265 3300041411 Ga0439466_0049212 Ga0439466_0049212_102_857 251
266 3300041997 Ga0439431_0002951 Ga0439431_0002951_2099_2854 251
267 3300042004 Ga0439445_0045244 Ga0439445_0045244_249_1004 251
268 3300042006 Ga0439432_000656 Ga0439432_000656_3583_4338 251
269 3300042010 Ga0439452_011442 Ga0439452_011442_1124_1879 251
270 3300042010 Ga0439452_023023 Ga0439452_023023_796_1551 251
271 3300042016 Ga0439463_003441 Ga0439463_003441_1080_1841 251
272 3300042147 Ga0450910_004749 Ga0450910_004749_410_1165 251
273 3300042156 Ga0439446_0016756 Ga0439446_0016756_193_948 251
274 3300042185 Ga0450909_000416 Ga0450909_000416_3628_4383 251
275 3300042993 Ga0439440_0009566 Ga0439440_0009566_242_1003 251
276 3300044658 Ga0466972_0007772 Ga0466972_0007772_3297_4070 251
277 3300044658 Ga0466972_0009741 Ga0466972_0009741_413_1186 251
278 3300044684 Ga0466966_0256170 Ga0466966_0256170_63_833 251
279 3300044719 Ga0466971_0154190 Ga0466971_0154190_192_965 251
280 3300044765 Ga0466970_0186977 Ga0466970_0186977_183_956 251
281 3300044901 Ga0466960_0047637 Ga0466960_0047637_846_1619 251
282 3300045976 Ga0466967_0010362 Ga0466967_0010362_4320_5078 251
283 3300045976 Ga0466967_0175901 Ga0466967_0175901_272_1045 251
284 3300046452 Ga0495617_006879 Ga0495617_006879_2127_2882 251
285 3300046457 Ga0495590_0000486 Ga0495590_0000486_9416_10171 251
286 3300046458 Ga0495591_000121 Ga0495591_000121_39349_40104 251
287 3300046460 Ga0495638_0008210 Ga0495638_0008210_2224_2979 251
288 3300046460 Ga0495638_0014457 Ga0495638_0014457_2557_3312 251
289 3300046460 Ga0495638_0194394 Ga0495638_0194394_352_1107 251
290 3300046471 Ga0495650_0006061 Ga0495650_0006061_3542_4297 251
291 3300046474 Ga0495605_0035083 Ga0495605_0035083_1271_2026 251
292 3300046474 Ga0495605_0070395 Ga0495605_0070395_805_1575 251
293 3300046500 Ga0495596_0000056 Ga0495596_0000056_42986_43741 251
294 3300046501 Ga0495607_0009747 Ga0495607_0009747_3237_3992 251
295 3300046501 Ga0495607_0011351 Ga0495607_0011351_5093_5848 251
296 3300046501 Ga0495607_0090662 Ga0495607_0090662_677_1432 251
297 3300046507 Ga0495606_0016369 Ga0495606_0016369_4154_4909 251
298 3300046507 Ga0495606_0046530 Ga0495606_0046530_709_1464 251
299 3300046512 Ga0495610_0015135 Ga0495610_0015135_1723_2478 251
300 3300046513 Ga0495616_0009788 Ga0495616_0009788_1499_2254 251
301 3300046515 Ga0495620_0002001 Ga0495620_0002001_8867_9622 251
302 3300046515 Ga0495620_0002384 Ga0495620_0002384_6566_7336 251
303 3300046518 Ga0495631_0020726 Ga0495631_0020726_1014_1769 251
304 3300046519 Ga0495632_0002121 Ga0495632_0002121_10212_10967 251
305 3300046519 Ga0495632_0045781 Ga0495632_0045781_142_897 251
306 3300046520 Ga0495637_0000134 Ga0495637_0000134_25492_26247 251
307 3300046520 Ga0495637_0004024 Ga0495637_0004024_1855_2610 251
308 3300046520 Ga0495637_0024949 Ga0495637_0024949_85_840 251
309 3300046522 Ga0495643_0007097 Ga0495643_0007097_2175_2930 251
310 3300046522 Ga0495643_0009983 Ga0495643_0009983_1627_2382 251
311 3300046522 Ga0495643_0018989 Ga0495643_0018989_1290_2060 251
312 3300046522 Ga0495643_0062506 Ga0495643_0062506_839_1645 251
313 3300046523 Ga0495644_0012324 Ga0495644_0012324_1049_1804 251
314 3300046524 Ga0495648_0006605 Ga0495648_0006605_5895_6650 251
315 3300046530 Ga0495654_0001508 Ga0495654_0001508_4127_4882 251
316 3300046542 Ga0495597_0004986 Ga0495597_0004986_2152_2907 251
317 3300046542 Ga0495597_0011331 Ga0495597_0011331_1139_1894 251
318 3300046558 Ga0495633_0008876 Ga0495633_0008876_1096_1851 251
319 3300046616 Ga0495668_0001799 Ga0495668_0001799_2707_3462 251
320 3300046660 Ga0495625_0005806 Ga0495625_0005806_4305_5060 251
321 3300046665 Ga0495661_0005014 Ga0495661_0005014_6502_7257 251
322 3300046691 Ga0495670_0044278 Ga0495670_0044278_489_1295 251
323 3300046692 Ga0495671_0023796 Ga0495671_0023796_1499_2254 251
324 3300046694 Ga0495649_0011441 Ga0495649_0011441_2425_3180 251
325 3300046694 Ga0495649_0019792 Ga0495649_0019792_2098_2853 251
326 3300046694 Ga0495649_0075524 Ga0495649_0075524_565_1320 251
327 3300046694 Ga0495649_0113681 Ga0495649_0113681_538_1293 251
328 3300046794 Ga0495589_0007435 Ga0495589_0007435_3474_4229 251
329 3300046794 Ga0495589_0011129 Ga0495589_0011129_3823_4578 251
330 3300046794 Ga0495589_0082654 Ga0495589_0082654_549_1319 251
331 3300046810 Ga0495660_0016234 Ga0495660_0016234_1995_2750 251
332 3300046810 Ga0495660_0048767 Ga0495660_0048767_1049_1804 251
333 3300047320 Ga0495672_0000548 Ga0495672_0000548_18840_19595 251
334 3300047320 Ga0495672_0019488 Ga0495672_0019488_3579_4334 251
335 3300047323 Ga0495683_0000640 Ga0495683_0000640_19170_19925 251
336 3300047469 Ga0495673_0016970 Ga0495673_0016970_1499_2254 251
337 3300047470 Ga0495681_0000576 Ga0495681_0000576_4052_4807 251
338 3300047472 Ga0495686_0022024 Ga0495686_0022024_3234_3989 251
339 3300047472 Ga0495686_0042013 Ga0495686_0042013_1953_2765 251
340 3300048091 Ga0495626_0000606 Ga0495626_0000606_6413_7168 251
341 3300048905 Ga0496102_0334236 Ga0496102_0334236_122_880 251
342 3300049459 Ga0495678_006632 Ga0495678_006632_2157_2912 251
343 3300049459 Ga0495678_010722 Ga0495678_010722_2188_2943 251
344 3300049568 Ga0501031_0020425 Ga0501031_0020425_197_970 251
345 3300049569 Ga0501032_0034972 Ga0501032_0034972_2319_3092 251
346 3300049569 Ga0501032_0114016 Ga0501032_0114016_567_1340 251
347 3300049570 Ga0501033_0003338 Ga0501033_0003338_2019_2792 251
348 3300049570 Ga0501033_0017702 Ga0501033_0017702_3893_4666 251
349 3300049570 Ga0501033_0069663 Ga0501033_0069663_1222_1998 251
350 3300049571 Ga0501034_0001799 Ga0501034_0001799_25583_26356 251
351 3300049571 Ga0501034_0071062 Ga0501034_0071062_2227_3003 251
352 3300049571 Ga0501034_0215008 Ga0501034_0215008_832_1605 251
353 3300049571 Ga0501034_0564809 Ga0501034_0564809_208_996 251
354 3300049572 Ga0501036_0002121 Ga0501036_0002121_13933_14706 251
355 3300049572 Ga0501036_0012732 Ga0501036_0012732_5179_5949 251
356 3300049572 Ga0501036_0169709 Ga0501036_0169709_927_1715 251
357 3300049572 Ga0501036_0649382 Ga0501036_0649382_26_799 251
358 3300049573 Ga0501037_0035336 Ga0501037_0035336_33_806 251
359 3300049574 Ga0501038_0015882 Ga0501038_0015882_5997_6770 251
360 3300049574 Ga0501038_0032758 Ga0501038_0032758_3025_3798 251
361 3300049574 Ga0501038_0157642 Ga0501038_0157642_787_1557 251
362 3300049575 Ga0501039_0004568 Ga0501039_0004568_979_1752 251
363 3300049576 Ga0501040_0033358 Ga0501040_0033358_399_1187 251
364 3300049577 Ga0501041_0016467 Ga0501041_0016467_2564_3352 251
365 3300049578 Ga0501042_0122492 Ga0501042_0122492_503_1276 251
366 3300049579 Ga0501043_0022977 Ga0501043_0022977_3869_4642 251
367 3300049579 Ga0501043_0052949 Ga0501043_0052949_641_1414 251
368 3300049579 Ga0501043_0161090 Ga0501043_0161090_74_862 251
369 3300049579 Ga0501043_0252374 Ga0501043_0252374_160_945 251
370 3300049580 Ga0501046_0006380 Ga0501046_0006380_8587_9375 251
371 3300049580 Ga0501046_0028483 Ga0501046_0028483_224_997 251
372 3300049581 Ga0501047_0706396 Ga0501047_0706396_30_803 251
373 3300049582 Ga0501048_0006577 Ga0501048_0006577_5298_6071 251
374 3300049585 Ga0501069_0179403 Ga0501069_0179403_394_1179 251
375 3300049586 Ga0501070_0011751 Ga0501070_0011751_2841_3614 251
376 3300049587 Ga0501071_0021711 Ga0501071_0021711_2194_2982 251
377 3300049588 Ga0501072_0010501 Ga0501072_0010501_3866_4654 251
378 3300049589 Ga0501073_0351873 Ga0501073_0351873_223_999 251
379 3300049590 Ga0501074_0002440 Ga0501074_0002440_785_1558 251
380 3300049591 Ga0501075_0008831 Ga0501075_0008831_4525_5313 251
381 3300049592 Ga0501076_0128349 Ga0501076_0128349_523_1311 251
382 3300049593 Ga0501077_0070167 Ga0501077_0070167_878_1666 251
383 3300049741 Ga0501079_0141990 Ga0501079_0141990_593_1381 251
384 3300049742 Ga0501080_0298353 Ga0501080_0298353_133_921 251
385 3300049822 Ga0501035_0024433 Ga0501035_0024433_986_1759 251
386 3300049822 Ga0501035_0058943 Ga0501035_0058943_229_1002 251
387 3300049822 Ga0501035_0495315 Ga0501035_0495315_50_835 251
388 3300049823 Ga0501044_0056624 Ga0501044_0056624_2802_3575 251
389 3300049823 Ga0501044_0312173 Ga0501044_0312173_703_1476 251
390 3300049824 Ga0501045_0027900 Ga0501045_0027900_2318_3106 251
391 3300049824 Ga0501045_0323181 Ga0501045_0323181_175_948 251
392 3300050490 nmdc:mga03n38_95403_c1 nmdc:mga03n38_95403_c1_214_987 251
393 3300050496 nmdc:mga07m45_152264_c1 nmdc:mga07m45_152264_c1_436_1209 251
394 3300053177 Ga0500636_0032095 Ga0500636_0032095_2247_3008 251
395 3300054114 Ga0501084_0268134 Ga0501084_0268134_561_1349 251
396 iso_pu_bacteria 8008574985 8008575848 251
397 iso_pu_bacteria 8025530807 8025531530 251
398 iso_pu_bacteria 8056829672 8056836136 251
399 2162886007 SwRhRL2b_contig_851299 SwRhRL2b_0013.00004720 252
400 3300003791 Ga0055530_10000002 Ga0055530_1000000252 252
401 3300003792 Ga0055540_1000009 Ga0055540_100000952 252
402 3300005288 Ga0065714_10002605 Ga0065714_100026058 252
403 3300005289 Ga0065704_10070398 Ga0065704_100703984 252
404 3300005535 Ga0070684_100171897 Ga0070684_1001718971 252
405 3300005937 Ga0081455_10001773 Ga0081455_1000177312 252
406 3300005937 Ga0081455_10069814 Ga0081455_100698142 252
407 3300006844 Ga0075428_100156077 Ga0075428_1001560772 252
408 3300006847 Ga0075431_100036864 Ga0075431_1000368644 252
409 3300006880 Ga0075429_100002535 Ga0075429_10000253510 252
410 3300007788 Ga0099795_10067918 Ga0099795_100679182 252
411 3300009011 Ga0105251_10003897 Ga0105251_100038972 252
412 3300009094 Ga0111539_10005590 Ga0111539_100055903 252
413 3300009147 Ga0114129_10105288 Ga0114129_101052884 252
414 3300014497 Ga0182008_10057566 Ga0182008_100575662 252
415 3300025292 Ga0209676_1004694 Ga0209676_10046942 252
416 3300025298 Ga0209050_1000009 Ga0209050_1000009662 252
417 3300025303 Ga0209051_1000008 Ga0209051_1000008419 252
418 3300025304 Ga0209257_1003428 Ga0209257_10034282 252
419 3300027907 Ga0207428_10037628 Ga0207428_100376284 252
420 3300031548 Ga0307408_100046409 Ga0307408_1000464094 252
421 3300033180 Ga0307510_10144818 Ga0307510_101448182 252
422 3300035115 Ga0373941_0074356 Ga0373941_0074356_330_1094 252
423 3300037068 Ga0373925_0338350 Ga0373925_0338350_190_1005 252
424 3300046458 Ga0495591_003717 Ga0495591_003717_3666_4439 252
425 3300046471 Ga0495650_0000872 Ga0495650_0000872_24299_25072 252
426 3300046474 Ga0495605_0022573 Ga0495605_0022573_787_1560 252
427 3300046491 Ga0495584_0010082 Ga0495584_0010082_421_1194 252
428 3300046492 Ga0495585_0102600 Ga0495585_0102600_96_869 252
429 3300046500 Ga0495596_0012353 Ga0495596_0012353_1260_2033 252
430 3300046501 Ga0495607_0000303 Ga0495607_0000303_23023_23784 252
431 3300046501 Ga0495607_0000594 Ga0495607_0000594_13185_13967 252
432 3300046501 Ga0495607_0061802 Ga0495607_0061802_284_1045 252
433 3300046506 Ga0495583_0000206 Ga0495583_0000206_92655_93428 252
434 3300046506 Ga0495583_0009670 Ga0495583_0009670_557_1333 252
435 3300046507 Ga0495606_0001857 Ga0495606_0001857_11580_12353 252
436 3300046512 Ga0495610_0127495 Ga0495610_0127495_200_973 252
437 3300046513 Ga0495616_0038562 Ga0495616_0038562_1112_1885 252
438 3300046519 Ga0495632_0021936 Ga0495632_0021936_2563_3336 252
439 3300046520 Ga0495637_0000015 Ga0495637_0000015_91683_92456 252
440 3300046520 Ga0495637_0000416 Ga0495637_0000416_11865_12641 252
441 3300046523 Ga0495644_0003452 Ga0495644_0003452_5385_6158 252
442 3300046524 Ga0495648_0004475 Ga0495648_0004475_7941_8714 252
443 3300046530 Ga0495654_0007754 Ga0495654_0007754_2627_3400 252
444 3300046538 Ga0495609_0000107 Ga0495609_0000107_24164_24937 252
445 3300046615 Ga0495656_0029253 Ga0495656_0029253_318_1115 252
446 3300046616 Ga0495668_0027838 Ga0495668_0027838_35_808 252
447 3300046648 Ga0495611_0000556 Ga0495611_0000556_16054_16827 252
448 3300046660 Ga0495625_0000004 Ga0495625_0000004_366885_367658 252
449 3300046665 Ga0495661_0000006 Ga0495661_0000006_138507_139280 252
450 3300046692 Ga0495671_0131834 Ga0495671_0131834_143_916 252
451 3300046694 Ga0495649_0007812 Ga0495649_0007812_3820_4593 252
452 3300046810 Ga0495660_0026062 Ga0495660_0026062_91_864 252
453 3300046810 Ga0495660_0089662 Ga0495660_0089662_549_1310 252
454 3300047320 Ga0495672_0006423 Ga0495672_0006423_3244_4017 252
455 3300047321 Ga0495676_0000004 Ga0495676_0000004_157874_158647 252
456 3300047446 Ga0495679_000400 Ga0495679_000400_12936_13709 252
457 3300047469 Ga0495673_0014148 Ga0495673_0014148_153_926 252
458 3300047470 Ga0495681_0000695 Ga0495681_0000695_20444_21217 252
459 3300047472 Ga0495686_0120698 Ga0495686_0120698_755_1528 252
460 3300048091 Ga0495626_0000012 Ga0495626_0000012_60291_61064 252
461 3300048091 Ga0495626_0156184 Ga0495626_0156184_128_901 252
462 3300048929 Ga0496126_0031880 Ga0496126_0031880_1232_2134 252
463 3300049459 Ga0495678_071001 Ga0495678_071001_483_1256 252
464 3300049570 Ga0501033_0294179 Ga0501033_0294179_74_868 252
465 3300049581 Ga0501047_0515112 Ga0501047_0515112_25_804 252
466 3300049823 Ga0501044_0008352 Ga0501044_0008352_7916_8710 252
467 3300050489 nmdc:mga03683_15136_c1 nmdc:mga03683_15136_c1_1018_1782 252
468 3300050489 nmdc:mga03683_3807_c1 nmdc:mga03683_3807_c1_354_1229 252
469 3300050493 nmdc:mga0k408_140794_c1 nmdc:mga0k408_140794_c1_21_785 252
470 3300050494 nmdc:mga06z11_68698_c1 nmdc:mga06z11_68698_c1_436_1200 252
471 3300050496 nmdc:mga07m45_13942_c1 nmdc:mga07m45_13942_c1_1449_2213 252
472 3300050507 nmdc:mga05p37_418653_c1 nmdc:mga05p37_418653_c1_717_1478 252
473 3300050508 nmdc:mga09592_33835_c1 nmdc:mga09592_33835_c1_107_868 252
474 3300050509 nmdc:mga0qj67_6457_c1 nmdc:mga0qj67_6457_c1_114_875 252
475 3300050510 nmdc:mga06r32_367243_c1 nmdc:mga06r32_367243_c1_580_1341 252
476 3300050511 nmdc:mga08y16_237455_c1 nmdc:mga08y16_237455_c1_1079_1840 252
477 3300050515 nmdc:mga0a205_372353_c1 nmdc:mga0a205_372353_c1_67_840 252
478 3300050516 nmdc:mga0sz30_31220_c1 nmdc:mga0sz30_31220_c1_794_1558 252
479 3300053153 Ga0500616_0003398 Ga0500616_0003398_2655_3419 252
480 3300053155 Ga0500620_007943 Ga0500620_007943_420_1184 252
481 3300053733 Ga0500552_000030 Ga0500552_000030_5681_6454 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

43

269

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nd1-assembly1.cif.gz_A crystal structure of precorrin-6a synthase from rhodobacter capsulatus 0.9194 1 252
3nd1-assembly1.cif.gz_A crystal structure of precorrin-6a synthase from rhodobacter capsulatus 0.9122 1 252
3nd1-assembly1.cif.gz_B crystal structure of precorrin-6a synthase from rhodobacter capsulatus 0.9072 1 252
3nd1-assembly1.cif.gz_B crystal structure of precorrin-6a synthase from rhodobacter capsulatus 0.9003 1 252
2npn-assembly1.cif.gz_A crystal structure of putative cobalamin synthesis related protein (cobf) from corynebacterium diphtheriae 0.8876 1 252
ID Description Score Start End Superfamily
3nd1B02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9607 144 252 3.30.950.10
3nd1B02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9438 144 252 3.30.950.10
2npnA02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9416 144 252 3.30.950.10
2npnA02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9331 144 252 3.30.950.10
3nd1A01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8795 1 143 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A528C664-F1-model_v4 Precorrin-6A synthase (Deacetylating) 1.003 203 251 GO:0008168
AF-A0A529Y3U9-F1-model_v4 Precorrin-6A synthase (Deacetylating) 0.9987 194 251 GO:0008168
AF-A0A4R6YU78-F1-model_v4 deleted 0.9892 1 251
AF-A0A172Z2B1-F1-model_v4 Precorrin 6A synthase 0.9889 1 251 GO:0009236
GO:0032259
GO:0043819
AF-A0A0G3GNZ3-F1-model_v4 Precorrin 6A synthase 0.9874 1 251 GO:0009236
GO:0032259
GO:0043819

Feature Viewer

pLDDT pTM Quality
91.5 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map