F452525

General Info

Members Datasets Scaffolds Average Seq Length
481 294 962 203

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0000786|Ga0500646_0000786_7053_7775
Length 240
Sequence MGAGELFHESNNHIRSGVFRTTVRSNTFPALHQQTDFRRNIVNILQINSSARADGSQSTLLANDISARLSAANPGAKLTVRDFASTPHPALDEATLQALFTPAGQHTPEQAARVALDDALIAELQAADAVVLGVPMYNFAISTQLKNWIDAVCRVRVTFRYTEKGPEGLLKGKKVYVALARGGIYRDGPADSQVPYLKTVLGFLGMTDVQFFYAEGLSISPENAQKALAQARSEIETALA

Samples

Sample ID Description Type Environment
1 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
197 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
247 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
273 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
274 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
275 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
276 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
279 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
280 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
281 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
284 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
287 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
288 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
289 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
290 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
291 2818991436 Collimonas arenae 515 Isolate Unclassified
292 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
293 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
294 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0.42
Isolates 1.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.23
Nodule 0.42
Rhizoplane 3.74
Rhizosphere 82.95
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500646_0000786 3300053090 Bacteria 8853
2 JGI24752J21851_1012656 3300001976 Bacteria 1103
3 JGI24752J21851_1014174 3300001976 Bacteria 1040
4 JGI24746J21847_1017993 3300001977 Bacteria 1001
5 JGI24743J22301_10013231 3300001991 Bacteria 1510
6 JGI24751J29686_10026323 3300002459 Bacteria 1207
7 JGI25162J39368_1000001 3300002737 Bacteria 740113
8 JGI25165J46597_1000001 3300003214 Bacteria 1111887
9 Ga0055538_1000001 3300003751 Bacteria 1111887
10 Ga0055539_1000001 3300003752 Bacteria 1111887
11 Ga0055533_1000003 3300003756 Bacteria 1111887
12 Ga0055525_1000003 3300003759 Bacteria 962094
13 Ga0055524_1000204 3300003775 Bacteria 64269
14 Ga0055540_1000026 3300003792 Bacteria 189071
15 Ga0055540_1000042 3300003792 Bacteria 156410
16 Ga0055531_10016062 3300003794 Bacteria 3256
17 Ga0055541_1000001 3300003841 Bacteria 1111887
18 Ga0065714_10077050 3300005288 Bacteria 2727
19 Ga0065715_10144015 3300005293 Bacteria 1813
20 Ga0070658_10016023 3300005327 Bacteria 5996
21 Ga0070658_10040557 3300005327 Bacteria 3756
22 Ga0070658_10143152 3300005327 Bacteria 1998
23 Ga0070658_10155173 3300005327 Bacteria 1919
24 Ga0070658_10202552 3300005327 Bacteria 1675
25 Ga0070658_10846206 3300005327 Bacteria 795
26 Ga0070683_100070646 3300005329 Bacteria 3257
27 Ga0070683_100072736 3300005329 Bacteria 3210
28 Ga0070683_100087359 3300005329 Bacteria 2924
29 Ga0070690_100427546 3300005330 Bacteria 978
30 Ga0070670_100054892 3300005331 Bacteria 3420
31 Ga0070670_100355990 3300005331 Bacteria 1286
32 Ga0070677_10047270 3300005333 Bacteria 1724
33 Ga0070677_10253920 3300005333 Bacteria 874
34 Ga0068869_100030153 3300005334 Bacteria 3805
35 Ga0068869_100088949 3300005334 Bacteria 2318
36 Ga0070666_10002655 3300005335 Bacteria 10784
37 Ga0070666_10030372 3300005335 Bacteria 3560
38 Ga0070680_100261742 3300005336 Bacteria 1463
39 Ga0068868_100047421 3300005338 Bacteria 3367
40 Ga0070660_100016897 3300005339 Bacteria 5309
41 Ga0070660_100037279 3300005339 Bacteria 3686
42 Ga0070660_100165594 3300005339 Bacteria 1783
43 Ga0070689_100040722 3300005340 Bacteria 3562
44 Ga0070689_100106678 3300005340 Bacteria 2223
45 Ga0070687_100005371 3300005343 Bacteria 5179
46 Ga0070661_100005014 3300005344 Bacteria 9121
47 Ga0070661_100024349 3300005344 Bacteria 4342
48 Ga0070661_100028042 3300005344 Bacteria 4059
49 Ga0070661_100087086 3300005344 Bacteria 2310
50 Ga0070661_100408038 3300005344 Bacteria 1075
51 Ga0070692_10034412 3300005345 Bacteria 2559
52 Ga0070668_100033744 3300005347 Bacteria 3899
53 Ga0070669_100210635 3300005353 Bacteria 1533
54 Ga0070669_100339172 3300005353 Bacteria 1217
55 Ga0070675_100085960 3300005354 Bacteria 2628
56 Ga0070675_100257053 3300005354 Bacteria 1530
57 Ga0070675_100462983 3300005354 Bacteria 1138
58 Ga0070671_100005440 3300005355 Bacteria 10166
59 Ga0070671_100093555 3300005355 Bacteria 2519
60 Ga0070671_100592758 3300005355 Bacteria 957
61 Ga0070673_100038126 3300005364 Bacteria 3668
62 Ga0070673_100424283 3300005364 Bacteria 1193
63 Ga0070673_100660221 3300005364 Bacteria 958
64 Ga0070688_100093029 3300005365 Bacteria 1973
65 Ga0070659_100003324 3300005366 Bacteria 11445
66 Ga0070659_100084341 3300005366 Bacteria 2541
67 Ga0070659_100242623 3300005366 Bacteria 1492
68 Ga0070659_100266525 3300005366 Bacteria 1422
69 Ga0070667_100009568 3300005367 Bacteria 8034
70 Ga0070667_100016725 3300005367 Bacteria 6071
71 Ga0070667_100874500 3300005367 Bacteria 836
72 Ga0070703_10099580 3300005406 Bacteria 1022
73 Ga0070709_10524820 3300005434 Bacteria 903
74 Ga0070714_100224951 3300005435 Bacteria 1726
75 Ga0070714_100238149 3300005435 Bacteria 1679
76 Ga0070713_100060993 3300005436 Bacteria 3155
77 Ga0070711_100208187 3300005439 Bacteria 1513
78 Ga0070694_100493070 3300005444 Bacteria 974
79 Ga0070708_100028894 3300005445 Bacteria 4775
80 Ga0070663_100055910 3300005455 Bacteria 2826
81 Ga0070663_100058347 3300005455 Bacteria 2771
82 Ga0070678_100042004 3300005456 Bacteria 3247
83 Ga0070678_100357844 3300005456 Bacteria 1257
84 Ga0070678_100610930 3300005456 Bacteria 974
85 Ga0070662_100865631 3300005457 Bacteria 770
86 Ga0068867_100014842 3300005459 Bacteria 5523
87 Ga0068867_100058852 3300005459 Bacteria 2847
88 Ga0068867_100132305 3300005459 Bacteria 1940
89 Ga0068867_100224410 3300005459 Bacteria 1516
90 Ga0070685_10095206 3300005466 Bacteria 1810
91 Ga0070706_100120937 3300005467 Bacteria 2441
92 Ga0070707_100008881 3300005468 Bacteria 9321
93 Ga0070698_100135569 3300005471 Bacteria 2416
94 Ga0070699_100302347 3300005518 Bacteria 1435
95 Ga0070679_100126652 3300005530 Bacteria 2536
96 Ga0070679_100302106 3300005530 Bacteria 1551
97 Ga0070679_101099066 3300005530 Bacteria 740
98 Ga0070684_100006408 3300005535 Bacteria 9104
99 Ga0068853_100050650 3300005539 Bacteria 3573
100 Ga0068853_100652779 3300005539 Bacteria 1001
101 Ga0070672_100055448 3300005543 Bacteria 3105
102 Ga0070672_100063630 3300005543 Bacteria 2913
103 Ga0070686_100003655 3300005544 Bacteria 8442
104 Ga0070686_100738902 3300005544 Bacteria 788
105 Ga0070695_100655418 3300005545 Bacteria 829
106 Ga0070665_100007975 3300005548 Bacteria 10731
107 Ga0070665_100044397 3300005548 Bacteria 4463
108 Ga0070665_100252413 3300005548 Bacteria 1764
109 Ga0070665_100529669 3300005548 Bacteria 1190
110 Ga0068855_100022858 3300005563 Bacteria 7494
111 Ga0068855_100025794 3300005563 Bacteria 7029
112 Ga0068855_100097539 3300005563 Bacteria 3386
113 Ga0070664_100239819 3300005564 Bacteria 1627
114 Ga0070664_100780944 3300005564 Bacteria 892
115 Ga0068857_100087707 3300005577 Bacteria 2783
116 Ga0068857_101456861 3300005577 Bacteria 667
117 Ga0068854_100006558 3300005578 Bacteria 7410
118 Ga0068854_100053820 3300005578 Bacteria 2892
119 Ga0068854_100100193 3300005578 Bacteria 2171
120 Ga0068856_100076010 3300005614 Bacteria 3327
121 Ga0068856_100358119 3300005614 Bacteria 1478
122 Ga0068856_100451087 3300005614 Bacteria 1307
123 Ga0070702_100147426 3300005615 Bacteria 1506
124 Ga0068852_100001878 3300005616 Bacteria 14297
125 Ga0068852_100067037 3300005616 Bacteria 3137
126 Ga0068852_100215729 3300005616 Bacteria 1823
127 Ga0068859_100028494 3300005617 Bacteria 5599
128 Ga0068859_100289329 3300005617 Bacteria 1731
129 Ga0068864_100006715 3300005618 Bacteria 9427
130 Ga0068864_100028485 3300005618 Bacteria 4722
131 Ga0068851_10002022 3300005834 Bacteria 8945
132 Ga0068851_10004293 3300005834 Bacteria 6419
133 Ga0068870_10243452 3300005840 Bacteria 1111
134 Ga0068863_100007463 3300005841 Bacteria 10703
135 Ga0068863_100115056 3300005841 Bacteria 2563
136 Ga0068863_100265460 3300005841 Bacteria 1660
137 Ga0068858_100005763 3300005842 Bacteria 12102
138 Ga0068858_100006723 3300005842 Bacteria 11190
139 Ga0068858_100097454 3300005842 Bacteria 2741
140 Ga0068858_100741713 3300005842 Bacteria 957
141 Ga0068860_100007369 3300005843 Bacteria 11000
142 Ga0068860_100078639 3300005843 Bacteria 3136
143 Ga0068860_101120425 3300005843 Bacteria 806
144 Ga0068862_100100611 3300005844 Bacteria 2528
145 Ga0068862_100241518 3300005844 Bacteria 1642
146 Ga0075365_10006101 3300006038 Bacteria 6588
147 Ga0075368_10010496 3300006042 Bacteria 3348
148 Ga0075363_100009281 3300006048 Bacteria 4620
149 Ga0075364_10079108 3300006051 Bacteria 2172
150 Ga0070712_100121732 3300006175 Bacteria 1964
151 Ga0075362_10370238 3300006177 Bacteria 719
152 Ga0075367_10039428 3300006178 Bacteria 2754
153 Ga0075369_10002108 3300006186 Bacteria 7029
154 Ga0097621_100001231 3300006237 Bacteria 17731
155 Ga0097621_100030668 3300006237 Bacteria 4259
156 Ga0097621_100164529 3300006237 Bacteria 1909
157 Ga0097621_100606167 3300006237 Bacteria 1001
158 Ga0075370_10052436 3300006353 Bacteria 2314
159 Ga0068871_100049763 3300006358 Bacteria 3388
160 Ga0068871_101203877 3300006358 Bacteria 710
161 Ga0075428_100333774 3300006844 Bacteria 1629
162 Ga0075433_10236302 3300006852 Bacteria 1622
163 Ga0075434_100117152 3300006871 Bacteria 2676
164 Ga0075434_100679906 3300006871 Bacteria 1047
165 Ga0097620_100028493 3300006931 Bacteria 5599
166 Ga0097620_100289316 3300006931 Bacteria 1731
167 Ga0079104_1000012 3300006946 Bacteria 355143
168 Ga0075435_100105799 3300007076 Bacteria 2336
169 Ga0105240_10049207 3300009093 Bacteria 5322
170 Ga0105240_10108588 3300009093 Bacteria 3362
171 Ga0111539_10023201 3300009094 Bacteria 7621
172 Ga0114129_10147537 3300009147 Bacteria 3221
173 Ga0105243_10000026 3300009148 Bacteria 191522
174 Ga0105243_10245497 3300009148 Bacteria 1595
175 Ga0105241_10950430 3300009174 Unclassified 801
176 Ga0105248_10349733 3300009177 Bacteria 1664
177 Ga0105248_10499323 3300009177 Bacteria 1372
178 Ga0105237_10012537 3300009545 Bacteria 8929
179 Ga0105237_10189495 3300009545 Bacteria 2057
180 Ga0105237_10659328 3300009545 Bacteria 1053
181 Ga0105238_10165641 3300009551 Bacteria 2186
182 Ga0105238_10180709 3300009551 Bacteria 2086
183 Ga0105249_10267644 3300009553 Bacteria 1701
184 Ga0105249_10283424 3300009553 Bacteria 1656
185 Ga0105239_10027940 3300010375 Bacteria 6207
186 Ga0105246_10000009 3300011119 Bacteria 79055
187 Ga0105246_11118787 3300011119 Bacteria 720
188 Ga0157371_10020162 3300013102 Bacteria 4907
189 Ga0157370_10268602 3300013104 Bacteria 1576
190 Ga0157369_10004002 3300013105 Bacteria 17483
191 Ga0157369_10065883 3300013105 Bacteria 3898
192 Ga0157369_10478663 3300013105 Bacteria 1289
193 Ga0157374_10078308 3300013296 Bacteria 3130
194 Ga0157374_10209630 3300013296 Bacteria 1910
195 Ga0157374_10350122 3300013296 Bacteria 1468
196 Ga0157372_10043081 3300013307 Bacteria 4996
197 Ga0157372_10085616 3300013307 Bacteria 3575
198 Ga0157372_10351789 3300013307 Bacteria 1716
199 Ga0157375_10161514 3300013308 Bacteria 2382
200 Ga0163163_10025578 3300014325 Bacteria 5627
201 Ga0163163_10677623 3300014325 Bacteria 1095
202 Ga0157380_10312290 3300014326 Bacteria 1453
203 Ga0157380_10540109 3300014326 Bacteria 1141
204 Ga0157377_10006645 3300014745 Bacteria 5528
205 Ga0157379_10004094 3300014968 Bacteria 12438
206 Ga0157379_10006148 3300014968 Bacteria 10336
207 Ga0157379_10014978 3300014968 Bacteria 6802
208 Ga0157379_10021303 3300014968 Bacteria 5736
209 Ga0157376_10008653 3300014969 Bacteria 7356
210 Ga0157376_10925065 3300014969 Bacteria 891
211 Ga0182006_1005754 3300015261 Bacteria 5849
212 Ga0182005_1000426 3300015265 Bacteria 22438
213 Ga0163161_10016555 3300017792 Bacteria 5148
214 Ga0163161_10043174 3300017792 Bacteria 3246
215 Ga0163161_10170800 3300017792 Bacteria 1662
216 Ga0209784_100004 3300025224 Bacteria 1378156
217 Ga0209566_100004 3300025225 Bacteria 1531866
218 Ga0209674_100006 3300025226 Bacteria 1531866
219 Ga0209563_100009 3300025230 Bacteria 1378156
220 Ga0207427_101002 3300025231 Bacteria 11854
221 Ga0209437_100004 3300025233 Bacteria 1378156
222 Ga0209677_100005 3300025253 Bacteria 1378156
223 Ga0209233_1000005 3300025261 Bacteria 1531866
224 Ga0209565_1015283 3300025263 Bacteria 1735
225 Ga0209675_1003824 3300025291 Bacteria 6942
226 Ga0209050_1001164 3300025298 Bacteria 31211
227 Ga0209050_1006021 3300025298 Bacteria 7347
228 Ga0209256_1000030 3300025299 Bacteria 414828
229 Ga0209051_1000004 3300025303 Bacteria 1155596
230 Ga0209257_1000063 3300025304 Bacteria 359089
231 Ga0207697_10000327 3300025315 Bacteria 26562
232 Ga0207697_10068153 3300025315 Bacteria 1488
233 Ga0207713_1008074 3300025735 Bacteria 6106
234 Ga0207682_10000401 3300025893 Bacteria 19968
235 Ga0207692_10169314 3300025898 Bacteria 1265
236 Ga0207642_10026405 3300025899 Bacteria 2364
237 Ga0207688_10001039 3300025901 Bacteria 14229
238 Ga0207680_10059029 3300025903 Bacteria 2328
239 Ga0207680_10074922 3300025903 Bacteria 2109
240 Ga0207680_10109779 3300025903 Bacteria 1787
241 Ga0207647_10301081 3300025904 Bacteria 913
242 Ga0207699_10219826 3300025906 Bacteria 1296
243 Ga0207699_10394096 3300025906 Bacteria 985
244 Ga0207645_10001404 3300025907 Bacteria 19722
245 Ga0207645_10005645 3300025907 Bacteria 9041
246 Ga0207645_10059653 3300025907 Bacteria 2437
247 Ga0207643_10001077 3300025908 Bacteria 16138
248 Ga0207643_10263960 3300025908 Bacteria 1064
249 Ga0207705_10088362 3300025909 Bacteria 2267
250 Ga0207705_10090492 3300025909 Bacteria 2240
251 Ga0207684_10178842 3300025910 Bacteria 1829
252 Ga0207684_10182198 3300025910 Bacteria 1811
253 Ga0207654_10167568 3300025911 Bacteria 1424
254 Ga0207707_10040947 3300025912 Bacteria 4045
255 Ga0207695_10039528 3300025913 Bacteria 5070
256 Ga0207695_10190589 3300025913 Bacteria 1968
257 Ga0207671_10350166 3300025914 Unclassified 1171
258 Ga0207663_10631217 3300025916 Bacteria 844
259 Ga0207660_10058257 3300025917 Bacteria 2769
260 Ga0207660_10562267 3300025917 Bacteria 928
261 Ga0207662_10015568 3300025918 Bacteria 4282
262 Ga0207657_10000148 3300025919 Bacteria 71376
263 Ga0207657_10040493 3300025919 Bacteria 4128
264 Ga0207657_10057663 3300025919 Bacteria 3346
265 Ga0207649_10013644 3300025920 Bacteria 4540
266 Ga0207649_10095082 3300025920 Bacteria 1960
267 Ga0207649_10225853 3300025920 Bacteria 1336
268 Ga0207649_10308233 3300025920 Bacteria 1160
269 Ga0207652_10049993 3300025921 Bacteria 3581
270 Ga0207652_10297455 3300025921 Bacteria 1457
271 Ga0207652_10944417 3300025921 Unclassified 760
272 Ga0207681_10012826 3300025923 Bacteria 5181
273 Ga0207681_10195425 3300025923 Bacteria 1550
274 Ga0207694_10034794 3300025924 Bacteria 3863
275 Ga0207694_10172309 3300025924 Bacteria 1753
276 Ga0207650_10005466 3300025925 Bacteria 8670
277 Ga0207650_10011303 3300025925 Bacteria 6143
278 Ga0207650_10125055 3300025925 Bacteria 2006
279 Ga0207659_10010014 3300025926 Bacteria 5937
280 Ga0207664_10077783 3300025929 Bacteria 2689
281 Ga0207664_10093532 3300025929 Bacteria 2469
282 Ga0207644_10066958 3300025931 Bacteria 2616
283 Ga0207644_10144641 3300025931 Bacteria 1834
284 Ga0207644_10337278 3300025931 Bacteria 1222
285 Ga0207644_10561703 3300025931 Bacteria 945
286 Ga0207690_10065525 3300025932 Bacteria 2485
287 Ga0207690_10131881 3300025932 Bacteria 1830
288 Ga0207690_10139516 3300025932 Bacteria 1784
289 Ga0207690_10142205 3300025932 Bacteria 1769
290 Ga0207690_10239018 3300025932 Bacteria 1398
291 Ga0207706_10065640 3300025933 Bacteria 3196
292 Ga0207709_10000004 3300025935 Bacteria 825156
293 Ga0207670_10047310 3300025936 Bacteria 2864
294 Ga0207670_11136065 3300025936 Bacteria 660
295 Ga0207669_10002243 3300025937 Bacteria 8217
296 Ga0207704_10308472 3300025938 Bacteria 1215
297 Ga0207704_10613198 3300025938 Bacteria 892
298 Ga0207691_10001645 3300025940 Bacteria 22169
299 Ga0207691_10039202 3300025940 Bacteria 4382
300 Ga0207711_10038962 3300025941 Bacteria 4041
301 Ga0207711_10199086 3300025941 Bacteria 1827
302 Ga0207689_10004738 3300025942 Bacteria 12265
303 Ga0207661_10061603 3300025944 Bacteria 3032
304 Ga0207661_10118076 3300025944 Bacteria 2254
305 Ga0207661_10158633 3300025944 Bacteria 1961
306 Ga0207679_10030925 3300025945 Bacteria 3743
307 Ga0207679_10077167 3300025945 Bacteria 2533
308 Ga0207679_10332491 3300025945 Bacteria 1319
309 Ga0207679_10364131 3300025945 Bacteria 1263
310 Ga0207667_10002522 3300025949 Bacteria 22797
311 Ga0207667_10038232 3300025949 Bacteria 5127
312 Ga0207667_11217075 3300025949 Bacteria 732
313 Ga0207651_10001670 3300025960 Bacteria 10194
314 Ga0207651_10133517 3300025960 Bacteria 1904
315 Ga0207651_11095671 3300025960 Bacteria 714
316 Ga0207712_10111953 3300025961 Bacteria 2049
317 Ga0207668_10002211 3300025972 Bacteria 11341
318 Ga0207668_10113583 3300025972 Bacteria 2037
319 Ga0207668_10930833 3300025972 Bacteria 774
320 Ga0207640_10042529 3300025981 Bacteria 2898
321 Ga0207640_10055621 3300025981 Bacteria 2593
322 Ga0207640_10104025 3300025981 Bacteria 1998
323 Ga0207658_10016322 3300025986 Bacteria 5107
324 Ga0207658_10240601 3300025986 Bacteria 1533
325 Ga0207658_10432680 3300025986 Bacteria 1162
326 Ga0207658_10903931 3300025986 Bacteria 804
327 Ga0207658_10920117 3300025986 Bacteria 796
328 Ga0207677_10728089 3300026023 Bacteria 882
329 Ga0207703_10007765 3300026035 Bacteria 8491
330 Ga0207703_10160539 3300026035 Bacteria 1968
331 Ga0207703_10791642 3300026035 Bacteria 905
332 Ga0207639_10128041 3300026041 Bacteria 2097
333 Ga0207639_10128749 3300026041 Bacteria 2092
334 Ga0207678_10000214 3300026067 Bacteria 51419
335 Ga0207678_10000936 3300026067 Bacteria 26595
336 Ga0207678_10302560 3300026067 Bacteria 1374
337 Ga0207708_10016844 3300026075 Bacteria 5502
338 Ga0207708_10068289 3300026075 Bacteria 2721
339 Ga0207702_10027810 3300026078 Bacteria 4698
340 Ga0207702_10069608 3300026078 Bacteria 3025
341 Ga0207702_10306814 3300026078 Bacteria 1508
342 Ga0207702_10373329 3300026078 Bacteria 1370
343 Ga0207641_10004511 3300026088 Bacteria 12038
344 Ga0207641_10090080 3300026088 Bacteria 2682
345 Ga0207641_10554957 3300026088 Bacteria 1120
346 Ga0207648_10000251 3300026089 Bacteria 58026
347 Ga0207648_10016512 3300026089 Bacteria 6742
348 Ga0207648_10124977 3300026089 Bacteria 2262
349 Ga0207676_10085638 3300026095 Bacteria 2572
350 Ga0207674_10000312 3300026116 Bacteria 61824
351 Ga0207674_10001327 3300026116 Bacteria 32088
352 Ga0207674_11416016 3300026116 Bacteria 664
353 Ga0207675_100000240 3300026118 Bacteria 52035
354 Ga0207683_10001464 3300026121 Bacteria 21278
355 Ga0207683_10015062 3300026121 Bacteria 6581
356 Ga0207683_10652936 3300026121 Bacteria 974
357 Ga0207698_10000387 3300026142 Bacteria 25394
358 Ga0207698_10072876 3300026142 Bacteria 2732
359 Ga0207698_10081199 3300026142 Bacteria 2616
360 Ga0207698_10201098 3300026142 Bacteria 1784
361 Ga0209281_1000039 3300027111 Bacteria 355150
362 Ga0268266_10058800 3300028379 Bacteria 3310
363 Ga0268266_10076058 3300028379 Bacteria 2917
364 Ga0268266_10336193 3300028379 Bacteria 1417
365 Ga0268265_10198532 3300028380 Bacteria 1738
366 Ga0268265_10520293 3300028380 Bacteria 1124
367 Ga0307517_10004553 3300028786 Bacteria 21271
368 Ga0307517_10157925 3300028786 Bacteria 1532
369 Ga0307511_10002108 3300030521 Bacteria 20827
370 Ga0307512_10214989 3300030522 Bacteria 1015
371 Ga0307509_10128491 3300031507 Bacteria 2495
372 Ga0373939_0074926 3300035114 Bacteria 1111
373 Ga0373945_0016787 3300035116 Bacteria 2474
374 Ga0373945_0061544 3300035116 Bacteria 1402
375 Ga0373957_0053024 3300035120 Bacteria 1555
376 Ga0373935_0168619 3300035692 Bacteria 1496
377 Ga0373935_0197946 3300035692 Bacteria 1387
378 Ga0373927_0010570 3300035695 Bacteria 6152
379 Ga0373947_0103574 3300035725 Bacteria 1791
380 Ga0373937_0062385 3300036401 Bacteria 3427
381 Ga0373937_0161929 3300036401 Bacteria 2098
382 Ga0373937_0313924 3300036401 Bacteria 1483
383 Ga0373925_0194032 3300037068 Bacteria 1612
384 Ga0373925_0251460 3300037068 Bacteria 1418
385 Ga0395900_0229589 3300037418 Bacteria 1867
386 Ga0395905_0228029 3300037471 Bacteria 1742
387 Ga0395901_0364597 3300038443 Bacteria 1489
388 Ga0237819_00427 3300038705 Bacteria 14476
389 Ga0451577_0000288 3300042876 Bacteria 97988
390 Ga0453683_0722176 3300044673 Bacteria 653
391 Ga0466961_0261373 3300044693 Bacteria 1061
392 Ga0453684_0001971 3300044712 Bacteria 52708
393 Ga0466959_0172704 3300045049 Bacteria 1515
394 Ga0495592_0028815 3300046454 Bacteria 4202
395 Ga0495590_0125658 3300046457 Bacteria 920
396 Ga0495629_0255188 3300046459 Bacteria 1206
397 Ga0495651_0003178 3300046462 Bacteria 12620
398 Ga0495651_0087041 3300046462 Bacteria 2349
399 Ga0495651_0122783 3300046462 Bacteria 1905
400 Ga0495653_0001379 3300046463 Bacteria 18872
401 Ga0495580_0280443 3300046472 Bacteria 1137
402 Ga0495639_0100557 3300046475 Bacteria 1365
403 Ga0495594_0243144 3300046499 Bacteria 1026
404 Ga0495608_0015364 3300046511 Bacteria 5310
405 Ga0495608_0542279 3300046511 Bacteria 701
406 Ga0495618_0107453 3300046514 Bacteria 1787
407 Ga0495628_0000835 3300046516 Bacteria 28571
408 Ga0495628_0106315 3300046516 Bacteria 2161
409 Ga0495648_0241049 3300046524 Bacteria 879
410 Ga0495642_0031355 3300046528 Bacteria 2131
411 Ga0495652_0007889 3300046529 Bacteria 9776
412 Ga0495652_0243190 3300046529 Bacteria 1337
413 Ga0495586_0079721 3300046535 Bacteria 1798
414 Ga0495598_0047173 3300046537 Bacteria 1283
415 Ga0495621_0007222 3300046539 Bacteria 3281
416 Ga0495625_0078461 3300046660 Bacteria 2305
417 Ga0495635_0116222 3300046663 Bacteria 1826
418 Ga0495623_0110417 3300046679 Bacteria 1667
419 Ga0495646_0102786 3300046680 Bacteria 1636
420 Ga0495613_0250151 3300046689 Bacteria 1237
421 Ga0495600_0008733 3300046809 Bacteria 6233
422 Ga0495660_0033876 3300046810 Bacteria 2861
423 Ga0495604_0015311 3300047317 Bacteria 6121
424 Ga0495636_0003615 3300047318 Bacteria 5997
425 Ga0495672_0000022 3300047320 Bacteria 420632
426 Ga0495676_0038136 3300047321 Bacteria 3994
427 Ga0495687_049396 3300047443 Bacteria 1798
428 Ga0495685_017197 3300047447 Bacteria 2475
429 Ga0495673_0176363 3300047469 Bacteria 812
430 Ga0495602_0165513 3300048088 Bacteria 1721
431 Ga0495602_0366389 3300048088 Bacteria 1036
432 Ga0496100_0053750 3300048903 Bacteria 2624
433 Ga0496101_0046391 3300048904 Bacteria 3116
434 Ga0496102_0326542 3300048905 Bacteria 1445
435 Ga0496103_0135465 3300048906 Bacteria 1574
436 Ga0496104_0009523 3300048907 Bacteria 8647
437 Ga0496105_0039566 3300048908 Bacteria 3887
438 Ga0496106_0010089 3300048909 Bacteria 6976
439 Ga0496107_0174958 3300048910 Bacteria 1593
440 Ga0496108_0033008 3300048911 Bacteria 4300
441 Ga0496109_0023114 3300048912 Bacteria 5515
442 Ga0496111_0143554 3300048914 Bacteria 1769
443 Ga0496114_0009447 3300048917 Bacteria 7742
444 Ga0496114_0030958 3300048917 Bacteria 4401
445 Ga0496114_0802381 3300048917 Bacteria 820
446 Ga0496115_0306108 3300048918 Bacteria 1302
447 Ga0501308_038018 3300049128 Bacteria 669
448 Ga0501320_027345 3300049536 Bacteria 693
449 nmdc:mga0yw44_13601_c1 3300050492 Bacteria 4290
450 nmdc:mga0yw44_537880_c1 3300050492 Bacteria 793
451 nmdc:mga0k408_293311_c1 3300050493 Bacteria 971
452 nmdc:mga07m45_2935_c1 3300050496 Bacteria 8096
453 nmdc:mga05p37_171071_c1 3300050507 Bacteria 2649
454 nmdc:mga0n895_1399622_c1 3300050512 Bacteria 668
455 nmdc:mga0sz30_306989_c1 3300050516 Bacteria 708
456 Ga0495601_0002871 3300053077 Bacteria 9800
457 Ga0495601_0264635 3300053077 Bacteria 1122
458 Ga0495595_0145352 3300053084 Bacteria 1165
459 Ga0500644_0112041 3300053088 Bacteria 1052
460 Ga0500583_0055371 3300053092 Bacteria 1854
461 Ga0500650_0004587 3300053098 Bacteria 5017
462 Ga0500555_047096 3300053103 Bacteria 1187
463 Ga0500593_000624 3300053117 Bacteria 13611
464 Ga0500595_002293 3300053119 Bacteria 9600
465 Ga0500655_001002 3300053133 Bacteria 5456
466 Ga0500568_0026321 3300053139 Bacteria 2443
467 Ga0500574_018796 3300053141 Bacteria 1710
468 Ga0500604_0000537 3300053151 Bacteria 10439
469 Ga0500616_0234772 3300053153 Bacteria 792
470 Ga0500619_000493 3300053154 Bacteria 6893
471 Ga0500622_0182403 3300053156 Unclassified 969
472 Ga0500645_053977 3300053730 Bacteria 1169
473 2601799630 2600255318 Bacteria 6383414
474 2606078136 2603880185 Bacteria 6379190
475 2606130244 2603880199 Bacteria 6377649
476 2624480657 2623620443 Bacteria 6427864
477 2715756616 2713897149 Bacteria 6506249
478 2819540593 2818991436 Bacteria 5376622
479 2878032532 2878029506 Bacteria 6418441
480 2919065090 2919063839 Bacteria 6302690
481 3007719169 3007718800 Bacteria 5971527
482 Ga0500646_0000786
483 JGI24752J21851_1012656
484 JGI24752J21851_1014174
485 JGI24746J21847_1017993
486 JGI24743J22301_10013231
487 JGI24751J29686_10026323
488 JGI25162J39368_1000001
489 JGI25165J46597_1000001
490 Ga0055538_1000001
491 Ga0055539_1000001
492 Ga0055533_1000003
493 Ga0055525_1000003
494 Ga0055524_1000204
495 Ga0055540_1000026
496 Ga0055540_1000042
497 Ga0055531_10016062
498 Ga0055541_1000001
499 Ga0065714_10077050
500 Ga0065715_10144015
501 Ga0070658_10016023
502 Ga0070658_10040557
503 Ga0070658_10143152
504 Ga0070658_10155173
505 Ga0070658_10202552
506 Ga0070658_10846206
507 Ga0070683_100070646
508 Ga0070683_100072736
509 Ga0070683_100087359
510 Ga0070690_100427546
511 Ga0070670_100054892
512 Ga0070670_100355990
513 Ga0070677_10047270
514 Ga0070677_10253920
515 Ga0068869_100030153
516 Ga0068869_100088949
517 Ga0070666_10002655
518 Ga0070666_10030372
519 Ga0070680_100261742
520 Ga0068868_100047421
521 Ga0070660_100016897
522 Ga0070660_100037279
523 Ga0070660_100165594
524 Ga0070689_100040722
525 Ga0070689_100106678
526 Ga0070687_100005371
527 Ga0070661_100005014
528 Ga0070661_100024349
529 Ga0070661_100028042
530 Ga0070661_100087086
531 Ga0070661_100408038
532 Ga0070692_10034412
533 Ga0070668_100033744
534 Ga0070669_100210635
535 Ga0070669_100339172
536 Ga0070675_100085960
537 Ga0070675_100257053
538 Ga0070675_100462983
539 Ga0070671_100005440
540 Ga0070671_100093555
541 Ga0070671_100592758
542 Ga0070673_100038126
543 Ga0070673_100424283
544 Ga0070673_100660221
545 Ga0070688_100093029
546 Ga0070659_100003324
547 Ga0070659_100084341
548 Ga0070659_100242623
549 Ga0070659_100266525
550 Ga0070667_100009568
551 Ga0070667_100016725
552 Ga0070667_100874500
553 Ga0070703_10099580
554 Ga0070709_10524820
555 Ga0070714_100224951
556 Ga0070714_100238149
557 Ga0070713_100060993
558 Ga0070711_100208187
559 Ga0070694_100493070
560 Ga0070708_100028894
561 Ga0070663_100055910
562 Ga0070663_100058347
563 Ga0070678_100042004
564 Ga0070678_100357844
565 Ga0070678_100610930
566 Ga0070662_100865631
567 Ga0068867_100014842
568 Ga0068867_100058852
569 Ga0068867_100132305
570 Ga0068867_100224410
571 Ga0070685_10095206
572 Ga0070706_100120937
573 Ga0070707_100008881
574 Ga0070698_100135569
575 Ga0070699_100302347
576 Ga0070679_100126652
577 Ga0070679_100302106
578 Ga0070679_101099066
579 Ga0070684_100006408
580 Ga0068853_100050650
581 Ga0068853_100652779
582 Ga0070672_100055448
583 Ga0070672_100063630
584 Ga0070686_100003655
585 Ga0070686_100738902
586 Ga0070695_100655418
587 Ga0070665_100007975
588 Ga0070665_100044397
589 Ga0070665_100252413
590 Ga0070665_100529669
591 Ga0068855_100022858
592 Ga0068855_100025794
593 Ga0068855_100097539
594 Ga0070664_100239819
595 Ga0070664_100780944
596 Ga0068857_100087707
597 Ga0068857_101456861
598 Ga0068854_100006558
599 Ga0068854_100053820
600 Ga0068854_100100193
601 Ga0068856_100076010
602 Ga0068856_100358119
603 Ga0068856_100451087
604 Ga0070702_100147426
605 Ga0068852_100001878
606 Ga0068852_100067037
607 Ga0068852_100215729
608 Ga0068859_100028494
609 Ga0068859_100289329
610 Ga0068864_100006715
611 Ga0068864_100028485
612 Ga0068851_10002022
613 Ga0068851_10004293
614 Ga0068870_10243452
615 Ga0068863_100007463
616 Ga0068863_100115056
617 Ga0068863_100265460
618 Ga0068858_100005763
619 Ga0068858_100006723
620 Ga0068858_100097454
621 Ga0068858_100741713
622 Ga0068860_100007369
623 Ga0068860_100078639
624 Ga0068860_101120425
625 Ga0068862_100100611
626 Ga0068862_100241518
627 Ga0075365_10006101
628 Ga0075368_10010496
629 Ga0075363_100009281
630 Ga0075364_10079108
631 Ga0070712_100121732
632 Ga0075362_10370238
633 Ga0075367_10039428
634 Ga0075369_10002108
635 Ga0097621_100001231
636 Ga0097621_100030668
637 Ga0097621_100164529
638 Ga0097621_100606167
639 Ga0075370_10052436
640 Ga0068871_100049763
641 Ga0068871_101203877
642 Ga0075428_100333774
643 Ga0075433_10236302
644 Ga0075434_100117152
645 Ga0075434_100679906
646 Ga0097620_100028493
647 Ga0097620_100289316
648 Ga0079104_1000012
649 Ga0075435_100105799
650 Ga0105240_10049207
651 Ga0105240_10108588
652 Ga0111539_10023201
653 Ga0114129_10147537
654 Ga0105243_10000026
655 Ga0105243_10245497
656 Ga0105241_10950430
657 Ga0105248_10349733
658 Ga0105248_10499323
659 Ga0105237_10012537
660 Ga0105237_10189495
661 Ga0105237_10659328
662 Ga0105238_10165641
663 Ga0105238_10180709
664 Ga0105249_10267644
665 Ga0105249_10283424
666 Ga0105239_10027940
667 Ga0105246_10000009
668 Ga0105246_11118787
669 Ga0157371_10020162
670 Ga0157370_10268602
671 Ga0157369_10004002
672 Ga0157369_10065883
673 Ga0157369_10478663
674 Ga0157374_10078308
675 Ga0157374_10209630
676 Ga0157374_10350122
677 Ga0157372_10043081
678 Ga0157372_10085616
679 Ga0157372_10351789
680 Ga0157375_10161514
681 Ga0163163_10025578
682 Ga0163163_10677623
683 Ga0157380_10312290
684 Ga0157380_10540109
685 Ga0157377_10006645
686 Ga0157379_10004094
687 Ga0157379_10006148
688 Ga0157379_10014978
689 Ga0157379_10021303
690 Ga0157376_10008653
691 Ga0157376_10925065
692 Ga0182006_1005754
693 Ga0182005_1000426
694 Ga0163161_10016555
695 Ga0163161_10043174
696 Ga0163161_10170800
697 Ga0209784_100004
698 Ga0209566_100004
699 Ga0209674_100006
700 Ga0209563_100009
701 Ga0207427_101002
702 Ga0209437_100004
703 Ga0209677_100005
704 Ga0209233_1000005
705 Ga0209565_1015283
706 Ga0209675_1003824
707 Ga0209050_1001164
708 Ga0209050_1006021
709 Ga0209256_1000030
710 Ga0209051_1000004
711 Ga0209257_1000063
712 Ga0207697_10000327
713 Ga0207697_10068153
714 Ga0207713_1008074
715 Ga0207682_10000401
716 Ga0207692_10169314
717 Ga0207642_10026405
718 Ga0207688_10001039
719 Ga0207680_10059029
720 Ga0207680_10074922
721 Ga0207680_10109779
722 Ga0207647_10301081
723 Ga0207699_10219826
724 Ga0207699_10394096
725 Ga0207645_10001404
726 Ga0207645_10005645
727 Ga0207645_10059653
728 Ga0207643_10001077
729 Ga0207643_10263960
730 Ga0207705_10088362
731 Ga0207705_10090492
732 Ga0207684_10178842
733 Ga0207684_10182198
734 Ga0207654_10167568
735 Ga0207707_10040947
736 Ga0207695_10039528
737 Ga0207695_10190589
738 Ga0207671_10350166
739 Ga0207663_10631217
740 Ga0207660_10058257
741 Ga0207660_10562267
742 Ga0207662_10015568
743 Ga0207657_10000148
744 Ga0207657_10040493
745 Ga0207657_10057663
746 Ga0207649_10013644
747 Ga0207649_10095082
748 Ga0207649_10225853
749 Ga0207649_10308233
750 Ga0207652_10049993
751 Ga0207652_10297455
752 Ga0207652_10944417
753 Ga0207681_10012826
754 Ga0207681_10195425
755 Ga0207694_10034794
756 Ga0207694_10172309
757 Ga0207650_10005466
758 Ga0207650_10011303
759 Ga0207650_10125055
760 Ga0207659_10010014
761 Ga0207664_10077783
762 Ga0207664_10093532
763 Ga0207644_10066958
764 Ga0207644_10144641
765 Ga0207644_10337278
766 Ga0207644_10561703
767 Ga0207690_10065525
768 Ga0207690_10131881
769 Ga0207690_10139516
770 Ga0207690_10142205
771 Ga0207690_10239018
772 Ga0207706_10065640
773 Ga0207709_10000004
774 Ga0207670_10047310
775 Ga0207670_11136065
776 Ga0207669_10002243
777 Ga0207704_10308472
778 Ga0207704_10613198
779 Ga0207691_10001645
780 Ga0207691_10039202
781 Ga0207711_10038962
782 Ga0207711_10199086
783 Ga0207689_10004738
784 Ga0207661_10061603
785 Ga0207661_10118076
786 Ga0207661_10158633
787 Ga0207679_10030925
788 Ga0207679_10077167
789 Ga0207679_10332491
790 Ga0207679_10364131
791 Ga0207667_10002522
792 Ga0207667_10038232
793 Ga0207667_11217075
794 Ga0207651_10001670
795 Ga0207651_10133517
796 Ga0207651_11095671
797 Ga0207712_10111953
798 Ga0207668_10002211
799 Ga0207668_10113583
800 Ga0207668_10930833
801 Ga0207640_10042529
802 Ga0207640_10055621
803 Ga0207640_10104025
804 Ga0207658_10016322
805 Ga0207658_10240601
806 Ga0207658_10432680
807 Ga0207658_10903931
808 Ga0207658_10920117
809 Ga0207677_10728089
810 Ga0207703_10007765
811 Ga0207703_10160539
812 Ga0207703_10791642
813 Ga0207639_10128041
814 Ga0207639_10128749
815 Ga0207678_10000214
816 Ga0207678_10000936
817 Ga0207678_10302560
818 Ga0207708_10016844
819 Ga0207708_10068289
820 Ga0207702_10027810
821 Ga0207702_10069608
822 Ga0207702_10306814
823 Ga0207702_10373329
824 Ga0207641_10004511
825 Ga0207641_10090080
826 Ga0207641_10554957
827 Ga0207648_10000251
828 Ga0207648_10016512
829 Ga0207648_10124977
830 Ga0207676_10085638
831 Ga0207674_10000312
832 Ga0207674_10001327
833 Ga0207674_11416016
834 Ga0207675_100000240
835 Ga0207683_10001464
836 Ga0207683_10015062
837 Ga0207683_10652936
838 Ga0207698_10000387
839 Ga0207698_10072876
840 Ga0207698_10081199
841 Ga0207698_10201098
842 Ga0209281_1000039
843 Ga0268266_10058800
844 Ga0268266_10076058
845 Ga0268266_10336193
846 Ga0268265_10198532
847 Ga0268265_10520293
848 Ga0307517_10004553
849 Ga0307517_10157925
850 Ga0307511_10002108
851 Ga0307512_10214989
852 Ga0307509_10128491
853 Ga0373939_0074926
854 Ga0373945_0016787
855 Ga0373945_0061544
856 Ga0373957_0053024
857 Ga0373935_0168619
858 Ga0373935_0197946
859 Ga0373927_0010570
860 Ga0373947_0103574
861 Ga0373937_0062385
862 Ga0373937_0161929
863 Ga0373937_0313924
864 Ga0373925_0194032
865 Ga0373925_0251460
866 Ga0395900_0229589
867 Ga0395905_0228029
868 Ga0395901_0364597
869 Ga0237819_00427
870 Ga0451577_0000288
871 Ga0453683_0722176
872 Ga0466961_0261373
873 Ga0453684_0001971
874 Ga0466959_0172704
875 Ga0495592_0028815
876 Ga0495590_0125658
877 Ga0495629_0255188
878 Ga0495651_0003178
879 Ga0495651_0087041
880 Ga0495651_0122783
881 Ga0495653_0001379
882 Ga0495580_0280443
883 Ga0495639_0100557
884 Ga0495594_0243144
885 Ga0495608_0015364
886 Ga0495608_0542279
887 Ga0495618_0107453
888 Ga0495628_0000835
889 Ga0495628_0106315
890 Ga0495648_0241049
891 Ga0495642_0031355
892 Ga0495652_0007889
893 Ga0495652_0243190
894 Ga0495586_0079721
895 Ga0495598_0047173
896 Ga0495621_0007222
897 Ga0495625_0078461
898 Ga0495635_0116222
899 Ga0495623_0110417
900 Ga0495646_0102786
901 Ga0495613_0250151
902 Ga0495600_0008733
903 Ga0495660_0033876
904 Ga0495604_0015311
905 Ga0495636_0003615
906 Ga0495672_0000022
907 Ga0495676_0038136
908 Ga0495687_049396
909 Ga0495685_017197
910 Ga0495673_0176363
911 Ga0495602_0165513
912 Ga0495602_0366389
913 Ga0496100_0053750
914 Ga0496101_0046391
915 Ga0496102_0326542
916 Ga0496103_0135465
917 Ga0496104_0009523
918 Ga0496105_0039566
919 Ga0496106_0010089
920 Ga0496107_0174958
921 Ga0496108_0033008
922 Ga0496109_0023114
923 Ga0496111_0143554
924 Ga0496114_0009447
925 Ga0496114_0030958
926 Ga0496114_0802381
927 Ga0496115_0306108
928 Ga0501308_038018
929 Ga0501320_027345
930 nmdc:mga0yw44_13601_c1
931 nmdc:mga0yw44_537880_c1
932 nmdc:mga0k408_293311_c1
933 nmdc:mga07m45_2935_c1
934 nmdc:mga05p37_171071_c1
935 nmdc:mga0n895_1399622_c1
936 nmdc:mga0sz30_306989_c1
937 Ga0495601_0002871
938 Ga0495601_0264635
939 Ga0495595_0145352
940 Ga0500644_0112041
941 Ga0500583_0055371
942 Ga0500650_0004587
943 Ga0500555_047096
944 Ga0500593_000624
945 Ga0500595_002293
946 Ga0500655_001002
947 Ga0500568_0026321
948 Ga0500574_018796
949 Ga0500604_0000537
950 Ga0500616_0234772
951 Ga0500619_000493
952 Ga0500622_0182403
953 Ga0500645_053977
954 2601799630
955 2606078136
956 2606130244
957 2624480657
958 2715756616
959 2819540593
960 2878032532
961 2919065090
962 3007719169

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02525

Flavodoxin_2

Flavodoxin-like fold

42

239

0.93

PF03358

FMN_red

NADPH-dependent FMN reductase

42

216

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z98-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) 0.9709 1 200
2z9b-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals 0.9696 1 200
2z98-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) 0.966 1 200
2z9b-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals 0.9647 1 200
1t5b-assembly1.cif.gz_B structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase 0.9622 2 200
ID Description Score Start End Superfamily
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9557 2 199 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9555 1 195 3.40.50.360
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9327 2 199 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9278 1 195 3.40.50.360
6dxpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9198 2 198 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A519ZS40-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9976 1 198 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-A0A2N2SJD0-F1-model_v4 FMN-dependent NADH-azoreductase (EC 1.7.1.17) 0.9961 1 168 GO:0010181
GO:0016655
AF-A0A239LNP3-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9957 1 200 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-A0A845BPX1-F1-model_v4 FMN-dependent NADH-azoreductase 0.9915 1 138
AF-A0A239LNP3-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9908 1 200 GO:0009055
GO:0010181
GO:0016652
GO:0016655

Map