F452545

General Info

Members Datasets Scaffolds Average Seq Length
482 238 482 144

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10340210|Ga0070658_103402102
Length 155
Sequence MRREFSAGGVLVRRLNGRWMVAAIRPEGKPPGLWALPKGRIDAGEQGEATALREVAEETGAHGRSLGKLGDVKYTFTWPPKPAEGERIFKIVSFFLVRYVGGRLGDVPEDFRHEVAEVKWLPLDDAPRLLAYGGEKEMARKAAEFLETARLSEDV

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
69 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
70 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
139 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.41
Rhizosphere 88.38
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745517 2209111006 Unclassified 501
2 JGI25407J50210_10008576 3300003373 Bacteria 2579
3 Ga0070658_10340210 3300005327 Bacteria 1283
4 Ga0070683_100346471 3300005329 Unclassified 1415
5 Ga0068869_100206133 3300005334 Bacteria 1552
6 Ga0070680_100001193 3300005336 Bacteria 18731
7 Ga0070680_100100266 3300005336 Bacteria 2403
8 Ga0070682_100183411 3300005337 Bacteria 1464
9 Ga0070682_100372034 3300005337 Bacteria 1072
10 Ga0070682_101773720 3300005337 Bacteria 538
11 Ga0068868_100021961 3300005338 Bacteria 4811
12 Ga0068868_100180321 3300005338 Bacteria 1752
13 Ga0070660_100164287 3300005339 Bacteria 1790
14 Ga0070689_100669022 3300005340 Bacteria 904
15 Ga0070691_10059933 3300005341 Bacteria 1829
16 Ga0070661_100261546 3300005344 Bacteria 1338
17 Ga0070668_100175230 3300005347 Bacteria 1748
18 Ga0070669_100186215 3300005353 Bacteria 1626
19 Ga0070674_100060997 3300005356 Bacteria 2630
20 Ga0070673_100810831 3300005364 Unclassified 865
21 Ga0070667_100776704 3300005367 Bacteria 889
22 Ga0070709_10476702 3300005434 Unclassified 944
23 Ga0070714_100208698 3300005435 Bacteria 1789
24 Ga0070714_101546591 3300005435 Bacteria 648
25 Ga0070714_101918804 3300005435 Unclassified 578
26 Ga0070714_102159126 3300005435 Unclassified 542
27 Ga0070713_100551360 3300005436 Bacteria 1091
28 Ga0070713_102120388 3300005436 Bacteria 545
29 Ga0070701_10078317 3300005438 Bacteria 1783
30 Ga0070701_10366805 3300005438 Bacteria 904
31 Ga0070705_100007129 3300005440 Bacteria 5500
32 Ga0070705_100011715 3300005440 Bacteria 4434
33 Ga0070705_100840479 3300005440 Bacteria 734
34 Ga0070700_100018931 3300005441 Bacteria 3967
35 Ga0070700_100759510 3300005441 Bacteria 777
36 Ga0070694_100013535 3300005444 Bacteria 5096
37 Ga0070708_100740155 3300005445 Bacteria 925
38 Ga0070678_100025142 3300005456 Bacteria 4001
39 Ga0070662_100620225 3300005457 Bacteria 911
40 Ga0070681_10029452 3300005458 Bacteria 5514
41 Ga0068867_100301180 3300005459 Bacteria 1322
42 Ga0070698_100088256 3300005471 Bacteria 3086
43 Ga0070679_100051023 3300005530 Bacteria 4120
44 Ga0070679_100215338 3300005530 Unclassified 1883
45 Ga0070684_100005171 3300005535 Bacteria 9976
46 Ga0070684_100348730 3300005535 Bacteria 1361
47 Ga0068853_100505288 3300005539 Bacteria 1141
48 Ga0070672_100300893 3300005543 Bacteria 1360
49 Ga0070686_100062454 3300005544 Bacteria 2410
50 Ga0070696_100025587 3300005546 Bacteria 4013
51 Ga0070693_100001137 3300005547 Bacteria 11933
52 Ga0070693_100020822 3300005547 Bacteria 3466
53 Ga0070665_100199683 3300005548 Bacteria 2000
54 Ga0070665_101291536 3300005548 Bacteria 740
55 Ga0070704_101466597 3300005549 Unclassified 627
56 Ga0068855_100041122 3300005563 Bacteria 5481
57 Ga0068855_100481408 3300005563 Bacteria 1351
58 Ga0068855_100816154 3300005563 Bacteria 990
59 Ga0068855_101416138 3300005563 Bacteria 716
60 Ga0070664_100010040 3300005564 Bacteria 7673
61 Ga0068854_100212556 3300005578 Bacteria 1526
62 Ga0068856_100014012 3300005614 Bacteria 7753
63 Ga0068856_100229794 3300005614 Bacteria 1870
64 Ga0068856_100668129 3300005614 Bacteria 1059
65 Ga0068852_100228325 3300005616 Bacteria 1773
66 Ga0068866_10008028 3300005718 Bacteria 4434
67 Ga0068861_100030309 3300005719 Bacteria 3963
68 Ga0068861_100094692 3300005719 Bacteria 2363
69 Ga0068860_101375845 3300005843 Bacteria 727
70 Ga0068862_100039248 3300005844 Bacteria 4020
71 Ga0081455_10162100 3300005937 Bacteria 1713
72 Ga0081455_10202870 3300005937 Bacteria 1484
73 Ga0081538_10039698 3300005981 Bacteria 3014
74 Ga0070712_100120167 3300006175 Unclassified 1976
75 Ga0070712_100379364 3300006175 Unclassified 1163
76 Ga0070712_100709342 3300006175 Bacteria 858
77 Ga0097621_101206123 3300006237 Bacteria 713
78 Ga0068871_100379985 3300006358 Bacteria 1255
79 Ga0075430_100187001 3300006846 Bacteria 1722
80 Ga0075433_11069646 3300006852 Bacteria 702
81 Ga0068865_100089232 3300006881 Bacteria 2232
82 Ga0068865_100409759 3300006881 Unclassified 1112
83 Ga0075435_100378680 3300007076 Bacteria 1215
84 Ga0105240_10343715 3300009093 Bacteria 1694
85 Ga0111539_10174047 3300009094 Bacteria 2514
86 Ga0111539_10538607 3300009094 Bacteria 1360
87 Ga0111539_10611346 3300009094 Bacteria 1269
88 Ga0111539_10824248 3300009094 Bacteria 1080
89 Ga0105245_10023162 3300009098 Bacteria 5450
90 Ga0105245_10078657 3300009098 Bacteria 3009
91 Ga0105245_10248891 3300009098 Bacteria 1726
92 Ga0105245_10658402 3300009098 Bacteria 1078
93 Ga0114129_10766049 3300009147 Bacteria 1234
94 Ga0105243_10104011 3300009148 Bacteria 2362
95 Ga0105243_10581598 3300009148 Bacteria 1075
96 Ga0105241_10875430 3300009174 Bacteria 832
97 Ga0105242_10100581 3300009176 Bacteria 2449
98 Ga0105242_10300077 3300009176 Bacteria 1466
99 Ga0105248_10989782 3300009177 Bacteria 950
100 Ga0105249_10020891 3300009553 Bacteria 5855
101 Ga0105249_10172412 3300009553 Bacteria 2099
102 Ga0105249_10805851 3300009553 Bacteria 1003
103 Ga0105239_10077431 3300010375 Bacteria 3659
104 Ga0105239_10251893 3300010375 Bacteria 1983
105 Ga0105239_12161674 3300010375 Bacteria 647
106 Ga0157339_1003925 3300012505 Bacteria 1100
107 Ga0157342_1005414 3300012507 Bacteria 1173
108 Ga0157316_1010685 3300012510 Bacteria 847
109 Ga0157369_10417753 3300013105 Bacteria 1390
110 Ga0157378_11560996 3300013297 Bacteria 705
111 Ga0163162_10080305 3300013306 Bacteria 3329
112 Ga0163162_10112567 3300013306 Bacteria 2820
113 Ga0163162_10312457 3300013306 Bacteria 1704
114 Ga0163162_10323628 3300013306 Bacteria 1674
115 Ga0157372_11295492 3300013307 Bacteria 841
116 Ga0157375_10263084 3300013308 Bacteria 1886
117 Ga0163163_11421991 3300014325 Unclassified 755
118 Ga0182008_10200747 3300014497 Bacteria 1015
119 Ga0157379_11787588 3300014968 Bacteria 604
120 Ga0163161_10095608 3300017792 Bacteria 2204
121 Ga0207653_10019096 3300025885 Bacteria 2161
122 Ga0207642_10162876 3300025899 Bacteria 1199
123 Ga0207642_10444752 3300025899 Unclassified 784
124 Ga0207643_10091361 3300025908 Bacteria 1775
125 Ga0207654_10121950 3300025911 Bacteria 1638
126 Ga0207707_10180852 3300025912 Bacteria 1841
127 Ga0207695_10182950 3300025913 Bacteria 2016
128 Ga0207693_10082992 3300025915 Unclassified 2510
129 Ga0207693_10284563 3300025915 Bacteria 1295
130 Ga0207663_10170265 3300025916 Bacteria 1546
131 Ga0207660_10023223 3300025917 Bacteria 4188
132 Ga0207662_10478037 3300025918 Bacteria 855
133 Ga0207657_10096357 3300025919 Bacteria 2461
134 Ga0207657_10166166 3300025919 Bacteria 1790
135 Ga0207652_10103791 3300025921 Bacteria 2514
136 Ga0207694_10635883 3300025924 Bacteria 899
137 Ga0207687_10019058 3300025927 Bacteria 4541
138 Ga0207687_10087119 3300025927 Bacteria 2269
139 Ga0207687_10633208 3300025927 Bacteria 904
140 Ga0207687_10660611 3300025927 Archaea 885
141 Ga0207700_10353723 3300025928 Bacteria 1280
142 Ga0207700_10618333 3300025928 Bacteria 965
143 Ga0207664_10108951 3300025929 Bacteria 2300
144 Ga0207664_10519489 3300025929 Bacteria 1067
145 Ga0207690_10307212 3300025932 Bacteria 1243
146 Ga0207706_10022265 3300025933 Bacteria 5687
147 Ga0207706_10038436 3300025933 Bacteria 4246
148 Ga0207706_10211384 3300025933 Bacteria 1700
149 Ga0207709_10171096 3300025935 Bacteria 1524
150 Ga0207709_10211875 3300025935 Bacteria 1391
151 Ga0207670_10409044 3300025936 Bacteria 1086
152 Ga0207704_10047025 3300025938 Bacteria 2576
153 Ga0207704_10661875 3300025938 Bacteria 861
154 Ga0207689_10211671 3300025942 Bacteria 1601
155 Ga0207689_10316215 3300025942 Bacteria 1295
156 Ga0207661_10010992 3300025944 Bacteria 6539
157 Ga0207661_10510585 3300025944 Bacteria 1099
158 Ga0207679_10025167 3300025945 Bacteria 4090
159 Ga0207667_10649407 3300025949 Bacteria 1061
160 Ga0207667_11162698 3300025949 Bacteria 753
161 Ga0207651_10763963 3300025960 Unclassified 855
162 Ga0207712_10111369 3300025961 Bacteria 2054
163 Ga0207668_10031110 3300025972 Bacteria 3512
164 Ga0207668_10131812 3300025972 Bacteria 1910
165 Ga0207640_10041900 3300025981 Bacteria 2915
166 Ga0207658_10378835 3300025986 Bacteria 1239
167 Ga0207677_10093464 3300026023 Bacteria 2193
168 Ga0207639_10264557 3300026041 Bacteria 1506
169 Ga0207708_10035365 3300026075 Bacteria 3801
170 Ga0207708_10475171 3300026075 Bacteria 1044
171 Ga0207708_10949169 3300026075 Unclassified 746
172 Ga0207708_11548843 3300026075 Bacteria 582
173 Ga0207702_10015812 3300026078 Bacteria 6247
174 Ga0207702_10928372 3300026078 Bacteria 863
175 Ga0207641_10199050 3300026088 Bacteria 1846
176 Ga0207648_10012419 3300026089 Bacteria 7974
177 Ga0207648_10097443 3300026089 Bacteria 2574
178 Ga0207648_10288344 3300026089 Bacteria 1469
179 Ga0207675_100008454 3300026118 Bacteria 9699
180 Ga0207675_100077258 3300026118 Bacteria 3119
181 Ga0207675_100290946 3300026118 Bacteria 1589
182 Ga0207683_10313071 3300026121 Bacteria 1437
183 Ga0268266_10092472 3300028379 Bacteria 2654
184 Ga0268266_10380132 3300028379 Bacteria 1332
185 Ga0268265_10502262 3300028380 Bacteria 1143
186 Ga0268264_10172284 3300028381 Bacteria 1958
187 Ga0265318_10046874 3300028577 Bacteria 1631
188 Ga0265338_10310165 3300028800 Bacteria 1145
189 Ga0265320_10455199 3300031240 Unclassified 565
190 Ga0307408_101089957 3300031548 Bacteria 740
191 Ga0307409_101334992 3300031995 Bacteria 743
192 Ga0373952_0084182 3300035092 Bacteria 816
193 Ga0373936_0629565 3300035113 Bacteria 505
194 Ga0373955_0765729 3300035172 Unclassified 593
195 Ga0373931_0349544 3300035691 Unclassified 925
196 Ga0373937_0591340 3300036401 Bacteria 1054
197 Ga0373925_0295147 3300037068 Bacteria 1308
198 Ga0373925_0804345 3300037068 Unclassified 775
199 Ga0395899_0008361 3300037312 Bacteria 7966
200 Ga0395899_0008461 3300037312 Bacteria 7927
201 Ga0395899_0263204 3300037312 Bacteria 1179
202 Ga0395900_0005255 3300037418 Bacteria 13580
203 Ga0395900_0093456 3300037418 Bacteria 3089
204 Ga0395900_0223418 3300037418 Bacteria 1897
205 Ga0395900_0282567 3300037418 Bacteria 1651
206 Ga0395900_0948614 3300037418 Bacteria 782
207 Ga0395900_1379392 3300037418 Bacteria 618
208 Ga0395898_0006828 3300037466 Bacteria 12139
209 Ga0395898_0008036 3300037466 Bacteria 11183
210 Ga0395905_0007309 3300037471 Bacteria 11005
211 Ga0395905_0028765 3300037471 Bacteria 5236
212 Ga0395905_0302205 3300037471 Bacteria 1488
213 Ga0395901_0003150 3300038443 Bacteria 16578
214 Ga0395901_0012458 3300038443 Bacteria 8630
215 Ga0395901_0038952 3300038443 Bacteria 4917
216 Ga0395901_0203356 3300038443 Bacteria 2075
217 Ga0395901_0247506 3300038443 Bacteria 1858
218 Ga0395901_0890425 3300038443 Unclassified 873
219 Ga0439466_0075325 3300041411 Bacteria 1070
220 Ga0439466_0100115 3300041411 Bacteria 904
221 Ga0451833_0216220 3300041491 Bacteria 619
222 Ga0450920_010051 3300042122 Bacteria 1751
223 Ga0439434_0264321 3300042435 Bacteria 590
224 Ga0439435_0111653 3300042436 Bacteria 849
225 Ga0466969_0021621 3300044656 Bacteria 3325
226 Ga0466963_0025181 3300044694 Bacteria 3792
227 Ga0466957_0108907 3300044842 Unclassified 1755
228 Ga0466960_0094703 3300044901 Bacteria 1528
229 Ga0466959_0100548 3300045049 Bacteria 2070
230 Ga0451576_0153454 3300045051 Bacteria 2402
231 Ga0466967_0273686 3300045976 Bacteria 1618
232 Ga0495627_221422 3300046453 Unclassified 520
233 Ga0495641_0323007 3300046461 Bacteria 696
234 Ga0495653_0160993 3300046463 Bacteria 1558
235 Ga0495582_0402758 3300046473 Bacteria 789
236 Ga0495584_0253392 3300046491 Bacteria 895
237 Ga0495584_0520621 3300046491 Bacteria 606
238 Ga0495585_0167501 3300046492 Bacteria 1137
239 Ga0495585_0182893 3300046492 Bacteria 1077
240 Ga0495594_0435533 3300046499 Bacteria 745
241 Ga0495596_0038740 3300046500 Bacteria 1884
242 Ga0495596_0096018 3300046500 Bacteria 1151
243 Ga0495618_0699938 3300046514 Bacteria 596
244 Ga0495628_0233322 3300046516 Bacteria 1379
245 Ga0495630_0173216 3300046517 Bacteria 1644
246 Ga0495637_0201702 3300046520 Unclassified 731
247 Ga0495644_0312024 3300046523 Unclassified 616
248 Ga0495663_0042884 3300046525 Bacteria 1380
249 Ga0495663_0048366 3300046525 Bacteria 1311
250 Ga0495642_0135005 3300046528 Bacteria 1064
251 Ga0495586_0071697 3300046535 Bacteria 1893
252 Ga0495586_0233244 3300046535 Bacteria 1048
253 Ga0495587_0493691 3300046536 Bacteria 677
254 Ga0495656_0606014 3300046615 Unclassified 586
255 Ga0495634_0086688 3300046642 Bacteria 2039
256 Ga0495634_0432723 3300046642 Bacteria 778
257 Ga0495635_0040943 3300046663 Unclassified 3201
258 Ga0495659_0170710 3300046664 Bacteria 882
259 Ga0495661_0165852 3300046665 Bacteria 1182
260 Ga0495588_0263748 3300046674 Bacteria 908
261 Ga0495647_0068776 3300046681 Bacteria 1413
262 Ga0495647_0146021 3300046681 Bacteria 1011
263 Ga0495658_0831772 3300046683 Bacteria 591
264 Ga0495671_0106250 3300046692 Bacteria 1371
265 Ga0495671_0462391 3300046692 Unclassified 606
266 Ga0495660_0426337 3300046810 Unclassified 577
267 Ga0495677_0108177 3300047445 Bacteria 1056
268 Ga0495626_0285168 3300048091 Bacteria 655
269 Ga0496100_0221703 3300048903 Bacteria 1388
270 Ga0496100_0253472 3300048903 Bacteria 1302
271 Ga0496100_0383118 3300048903 Unclassified 1068
272 Ga0496101_0032910 3300048904 Bacteria 3653
273 Ga0496101_0034025 3300048904 Bacteria 3598
274 Ga0496101_0453012 3300048904 Unclassified 1012
275 Ga0496102_0107864 3300048905 Bacteria 2593
276 Ga0496102_0452479 3300048905 Bacteria 1204
277 Ga0496102_0712053 3300048905 Bacteria 927
278 Ga0496102_1104059 3300048905 Bacteria 713
279 Ga0496102_1396309 3300048905 Bacteria 619
280 Ga0496103_0408142 3300048906 Bacteria 872
281 Ga0496104_0015511 3300048907 Bacteria 6900
282 Ga0496104_0028939 3300048907 Bacteria 5137
283 Ga0496104_0040518 3300048907 Bacteria 4366
284 Ga0496105_0001193 3300048908 Bacteria 18081
285 Ga0496105_0026330 3300048908 Bacteria 4743
286 Ga0496105_0100236 3300048908 Bacteria 2392
287 Ga0496105_0355510 3300048908 Bacteria 1169
288 Ga0496106_0092617 3300048909 Bacteria 2334
289 Ga0496106_0432799 3300048909 Bacteria 1057
290 Ga0496107_0123867 3300048910 Bacteria 1905
291 Ga0496107_0289837 3300048910 Bacteria 1218
292 Ga0496107_0298714 3300048910 Bacteria 1198
293 Ga0496107_0703840 3300048910 Bacteria 743
294 Ga0496108_0057900 3300048911 Bacteria 3255
295 Ga0496108_0356454 3300048911 Bacteria 1276
296 Ga0496108_0520794 3300048911 Bacteria 1038
297 Ga0496109_0134261 3300048912 Bacteria 2311
298 Ga0496109_0151215 3300048912 Bacteria 2173
299 Ga0496109_0252334 3300048912 Bacteria 1661
300 Ga0496109_0410260 3300048912 Bacteria 1280
301 Ga0496109_1273340 3300048912 Bacteria 671
302 Ga0496110_0015177 3300048913 Bacteria 6407
303 Ga0496110_0016659 3300048913 Bacteria 6139
304 Ga0496110_0135793 3300048913 Bacteria 2222
305 Ga0496110_0272788 3300048913 Unclassified 1540
306 Ga0496110_1336477 3300048913 Unclassified 626
307 Ga0496111_0004004 3300048914 Bacteria 9247
308 Ga0496111_0007179 3300048914 Bacteria 7282
309 Ga0496111_0659044 3300048914 Bacteria 763
310 Ga0496112_0120164 3300048915 Bacteria 2597
311 Ga0496112_0161229 3300048915 Bacteria 2209
312 Ga0496112_0164303 3300048915 Bacteria 2186
313 Ga0496112_0278638 3300048915 Unclassified 1620
314 Ga0496112_0358531 3300048915 Unclassified 1400
315 Ga0496113_0026247 3300048916 Bacteria 4162
316 Ga0496113_0356352 3300048916 Bacteria 1174
317 Ga0496114_0141258 3300048917 Bacteria 2085
318 Ga0496114_0747564 3300048917 Bacteria 855
319 Ga0496115_0306700 3300048918 Bacteria 1300
320 Ga0496115_0314272 3300048918 Bacteria 1282
321 Ga0496115_0387210 3300048918 Bacteria 1136
322 Ga0496115_0459699 3300048918 Bacteria 1027
323 Ga0496115_0713213 3300048918 Bacteria 787
324 Ga0501031_0023299 3300049568 Bacteria 4037
325 Ga0501031_0068851 3300049568 Bacteria 2305
326 Ga0501031_0070969 3300049568 Bacteria 2268
327 Ga0501031_0107286 3300049568 Bacteria 1823
328 Ga0501031_0429326 3300049568 Bacteria 854
329 Ga0501032_0033595 3300049569 Bacteria 3513
330 Ga0501032_0036915 3300049569 Bacteria 3334
331 Ga0501033_0011403 3300049570 Bacteria 6803
332 Ga0501034_0009816 3300049571 Bacteria 10008
333 Ga0501034_0033717 3300049571 Bacteria 5191
334 Ga0501036_0004702 3300049572 Bacteria 11023
335 Ga0501036_0012175 3300049572 Bacteria 7125
336 Ga0501036_0601160 3300049572 Bacteria 912
337 Ga0501036_0774992 3300049572 Bacteria 790
338 Ga0501037_0006954 3300049573 Bacteria 8265
339 Ga0501037_0013845 3300049573 Bacteria 5943
340 Ga0501037_0016483 3300049573 Bacteria 5439
341 Ga0501037_0059822 3300049573 Bacteria 2778
342 Ga0501038_0001345 3300049574 Bacteria 22388
343 Ga0501038_0043430 3300049574 Bacteria 3908
344 Ga0501038_0059652 3300049574 Bacteria 3267
345 Ga0501038_0067116 3300049574 Bacteria 3052
346 Ga0501038_0170013 3300049574 Bacteria 1765
347 Ga0501038_1161860 3300049574 Bacteria 562
348 Ga0501039_0005475 3300049575 Bacteria 9605
349 Ga0501039_0067438 3300049575 Bacteria 2778
350 Ga0501039_0074663 3300049575 Bacteria 2635
351 Ga0501039_0102147 3300049575 Bacteria 2237
352 Ga0501040_0001857 3300049576 Bacteria 13550
353 Ga0501040_0040282 3300049576 Bacteria 3178
354 Ga0501040_0196583 3300049576 Bacteria 1431
355 Ga0501040_0270809 3300049576 Bacteria 1212
356 Ga0501040_0279360 3300049576 Bacteria 1193
357 Ga0501040_0594347 3300049576 Bacteria 799
358 Ga0501041_0001181 3300049577 Bacteria 14214
359 Ga0501041_0003625 3300049577 Bacteria 8878
360 Ga0501041_0032006 3300049577 Bacteria 3178
361 Ga0501041_0064811 3300049577 Bacteria 2237
362 Ga0501041_0347875 3300049577 Bacteria 936
363 Ga0501041_0391296 3300049577 Bacteria 880
364 Ga0501041_0442951 3300049577 Bacteria 824
365 Ga0501042_0001430 3300049578 Bacteria 14053
366 Ga0501042_0041486 3300049578 Bacteria 3272
367 Ga0501042_0338046 3300049578 Bacteria 1088
368 Ga0501042_0539622 3300049578 Bacteria 847
369 Ga0501042_0745464 3300049578 Bacteria 712
370 Ga0501043_0000798 3300049579 Bacteria 27990
371 Ga0501043_0004591 3300049579 Bacteria 11202
372 Ga0501043_0009672 3300049579 Bacteria 7557
373 Ga0501046_0012367 3300049580 Bacteria 7270
374 Ga0501046_0021238 3300049580 Bacteria 5359
375 Ga0501046_0030605 3300049580 Bacteria 4367
376 Ga0501046_0139493 3300049580 Bacteria 1835
377 Ga0501047_0001088 3300049581 Bacteria 27110
378 Ga0501047_0198862 3300049581 Bacteria 1865
379 Ga0501047_0278102 3300049581 Bacteria 1519
380 Ga0501048_0001065 3300049582 Bacteria 20549
381 Ga0501048_0006165 3300049582 Bacteria 9128
382 Ga0501048_0010398 3300049582 Bacteria 6948
383 Ga0501048_0120403 3300049582 Bacteria 1854
384 Ga0501067_0016745 3300049583 Bacteria 4051
385 Ga0501068_0006420 3300049584 Bacteria 6481
386 Ga0501068_0063099 3300049584 Bacteria 2253
387 Ga0501068_0140010 3300049584 Bacteria 1516
388 Ga0501068_0653324 3300049584 Bacteria 686
389 Ga0501069_0000870 3300049585 Bacteria 14363
390 Ga0501069_0006041 3300049585 Bacteria 6321
391 Ga0501069_0010123 3300049585 Bacteria 4987
392 Ga0501070_0002312 3300049586 Bacteria 16724
393 Ga0501070_0071949 3300049586 Bacteria 2862
394 Ga0501070_0078733 3300049586 Bacteria 2727
395 Ga0501071_0000054 3300049587 Bacteria 38443
396 Ga0501071_0094362 3300049587 Bacteria 2200
397 Ga0501071_0125126 3300049587 Bacteria 1907
398 Ga0501071_0410139 3300049587 Bacteria 1035
399 Ga0501072_0026780 3300049588 Bacteria 4497
400 Ga0501072_0037520 3300049588 Bacteria 3800
401 Ga0501072_0058666 3300049588 Bacteria 3033
402 Ga0501072_0279252 3300049588 Bacteria 1328
403 Ga0501073_0018970 3300049589 Bacteria 4970
404 Ga0501073_0044017 3300049589 Bacteria 3146
405 Ga0501073_0095848 3300049589 Bacteria 2060
406 Ga0501073_0387506 3300049589 Bacteria 965
407 Ga0501074_0002914 3300049590 Bacteria 12012
408 Ga0501074_0006494 3300049590 Bacteria 8445
409 Ga0501074_0037147 3300049590 Bacteria 3530
410 Ga0501074_0379737 3300049590 Bacteria 1002
411 Ga0501074_0790823 3300049590 Bacteria 668
412 Ga0501075_0000096 3300049591 Bacteria 40796
413 Ga0501075_0001970 3300049591 Bacteria 13550
414 Ga0501075_0126666 3300049591 Bacteria 1944
415 Ga0501075_0202897 3300049591 Bacteria 1512
416 Ga0501075_0354768 3300049591 Bacteria 1117
417 Ga0501076_0050802 3300049592 Bacteria 3280
418 Ga0501076_0053510 3300049592 Bacteria 3199
419 Ga0501076_0071447 3300049592 Bacteria 2776
420 Ga0501076_0353340 3300049592 Bacteria 1207
421 Ga0501076_0612072 3300049592 Bacteria 899
422 Ga0501076_0771195 3300049592 Bacteria 793
423 Ga0501077_0000624 3300049593 Bacteria 21474
424 Ga0501077_0006820 3300049593 Bacteria 7026
425 Ga0501077_0033279 3300049593 Bacteria 3280
426 Ga0501077_0063977 3300049593 Bacteria 2333
427 Ga0501079_0000001 3300049741 Bacteria 121247
428 Ga0501079_0022079 3300049741 Bacteria 4876
429 Ga0501079_0079049 3300049741 Bacteria 2543
430 Ga0501079_0120689 3300049741 Bacteria 2038
431 Ga0501079_0176850 3300049741 Bacteria 1664
432 Ga0501080_0002158 3300049742 Bacteria 17095
433 Ga0501080_0042363 3300049742 Bacteria 4239
434 Ga0501080_0060548 3300049742 Bacteria 3524
435 Ga0501080_0094364 3300049742 Bacteria 2778
436 Ga0501080_0213277 3300049742 Bacteria 1769
437 Ga0501081_0001766 3300049743 Bacteria 13416
438 Ga0501081_0048445 3300049743 Bacteria 2924
439 Ga0501081_0085017 3300049743 Bacteria 2219
440 Ga0501081_0098811 3300049743 Bacteria 2061
441 Ga0501083_0010021 3300049744 Bacteria 6686
442 Ga0501083_0032509 3300049744 Bacteria 3577
443 Ga0501083_0312763 3300049744 Bacteria 1021
444 Ga0501035_0028824 3300049822 Bacteria 5065
445 Ga0501035_0037804 3300049822 Bacteria 4369
446 Ga0501035_0146120 3300049822 Bacteria 2053
447 Ga0501035_0913793 3300049822 Bacteria 694
448 Ga0501044_0165132 3300049823 Bacteria 2188
449 Ga0501044_0167127 3300049823 Bacteria 2173
450 Ga0501044_0622128 3300049823 Bacteria 971
451 Ga0501045_0000708 3300049824 Bacteria 21218
452 Ga0501045_0022550 3300049824 Bacteria 4509
453 Ga0501045_0045380 3300049824 Bacteria 3199
454 Ga0501045_0059018 3300049824 Bacteria 2810
455 Ga0501045_0132050 3300049824 Bacteria 1856
456 Ga0501045_0904060 3300049824 Bacteria 649
457 nmdc:mga0qj67_911364_c1 3300050509 Unclassified 692
458 nmdc:mga06r32_1596571_c1 3300050510 Unclassified 591
459 nmdc:mga08y16_1617762_c1 3300050511 Bacteria 605
460 nmdc:mga08y16_178202_c1 3300050511 Bacteria 2207
461 nmdc:mga08y16_232741_c1 3300050511 Bacteria 1906
462 nmdc:mga08y16_240035_c1 3300050511 Bacteria 1873
463 nmdc:mga0n895_1471929_c1 3300050512 Bacteria 648
464 nmdc:mga0n895_257657_c1 3300050512 Bacteria 1770
465 nmdc:mga0n895_68093_c1 3300050512 Unclassified 3527
466 nmdc:mga0rr50_372244_c1 3300050513 Bacteria 1204
467 nmdc:mga0a205_1068030_c1 3300050515 Bacteria 655
468 nmdc:mga0a205_281279_c1 3300050515 Bacteria 1539
469 Ga0495601_0066033 3300053077 Bacteria 2303
470 Ga0495595_0724415 3300053084 Unclassified 510
471 Ga0495619_0290613 3300053085 Bacteria 1132
472 Ga0501084_0000283 3300054114 Bacteria 38382
473 Ga0501084_0062245 3300054114 Bacteria 3123
474 Ga0501084_0403530 3300054114 Bacteria 1155
475 Ga0501084_0814136 3300054114 Bacteria 786
476 Ga0501082_0002904 3300060353 Bacteria 14943
477 Ga0501082_0031029 3300060353 Bacteria 4606
478 Ga0501082_0449298 3300060353 Bacteria 1126
479 Ga0530510_0001060 3300061734 Bacteria 18252
480 Ga0530510_0024226 3300061734 Bacteria 4329
481 Ga0530510_0461916 3300061734 Unclassified 960
482 Ga0530510_0919538 3300061734 Bacteria 669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10611346 Ga0111539_106113461 120
2 3300009094 Ga0111539_10824248 Ga0111539_108242482 120
3 3300046517 Ga0495630_0173216 Ga0495630_0173216_26_403 120
4 3300050510 nmdc:mga06r32_1596571_c1 nmdc:mga06r32_1596571_c1_198_581 120
5 3300050511 nmdc:mga08y16_1617762_c1 nmdc:mga08y16_1617762_c1_120_503 120
6 3300045976 Ga0466967_0273686 Ga0466967_0273686_953_1333 121
7 3300046473 Ga0495582_0402758 Ga0495582_0402758_276_656 121
8 3300046535 Ga0495586_0233244 Ga0495586_0233244_587_967 121
9 3300046681 Ga0495647_0068776 Ga0495647_0068776_560_940 121
10 3300006175 Ga0070712_100120167 Ga0070712_1001201674 122
11 3300025915 Ga0207693_10082992 Ga0207693_100829925 122
12 3300025928 Ga0207700_10618333 Ga0207700_106183331 122
13 3300028800 Ga0265338_10310165 Ga0265338_103101653 122
14 3300046536 Ga0495587_0493691 Ga0495587_0493691_265_663 122
15 3300046663 Ga0495635_0040943 Ga0495635_0040943_34_432 122
16 3300046664 Ga0495659_0170710 Ga0495659_0170710_202_600 127
17 3300005981 Ga0081538_10039698 Ga0081538_100396982 129
18 3300006846 Ga0075430_100187001 Ga0075430_1001870013 129
19 3300003373 JGI25407J50210_10008576 JGI25407J50210_100085762 130
20 3300005440 Ga0070705_100011715 Ga0070705_1000117156 130
21 3300005471 Ga0070698_100088256 Ga0070698_1000882563 130
22 3300050509 nmdc:mga0qj67_911364_c1 nmdc:mga0qj67_911364_c1_82_495 130
23 3300005336 Ga0070680_100001193 Ga0070680_10000119318 131
24 3300005337 Ga0070682_100372034 Ga0070682_1003720343 131
25 3300005338 Ga0068868_100021961 Ga0068868_1000219611 131
26 3300005339 Ga0070660_100164287 Ga0070660_1001642872 131
27 3300005344 Ga0070661_100261546 Ga0070661_1002615463 131
28 3300005456 Ga0070678_100025142 Ga0070678_1000251425 131
29 3300005458 Ga0070681_10029452 Ga0070681_100294523 131
30 3300005530 Ga0070679_100051023 Ga0070679_1000510233 131
31 3300005535 Ga0070684_100005171 Ga0070684_1000051713 131
32 3300005547 Ga0070693_100001137 Ga0070693_1000011373 131
33 3300005548 Ga0070665_101291536 Ga0070665_1012915362 131
34 3300005564 Ga0070664_100010040 Ga0070664_1000100407 131
35 3300005614 Ga0068856_100014012 Ga0068856_1000140123 131
36 3300013297 Ga0157378_11560996 Ga0157378_115609961 131
37 3300025899 Ga0207642_10162876 Ga0207642_101628762 131
38 3300025908 Ga0207643_10091361 Ga0207643_100913612 131
39 3300025911 Ga0207654_10121950 Ga0207654_101219502 131
40 3300025912 Ga0207707_10180852 Ga0207707_101808523 131
41 3300025917 Ga0207660_10023223 Ga0207660_100232233 131
42 3300025919 Ga0207657_10166166 Ga0207657_101661662 131
43 3300025921 Ga0207652_10103791 Ga0207652_101037913 131
44 3300025924 Ga0207694_10635883 Ga0207694_106358832 131
45 3300025927 Ga0207687_10019058 Ga0207687_100190585 131
46 3300025935 Ga0207709_10171096 Ga0207709_101710962 131
47 3300025944 Ga0207661_10010992 Ga0207661_100109923 131
48 3300025945 Ga0207679_10025167 Ga0207679_100251673 131
49 3300026075 Ga0207708_11548843 Ga0207708_115488431 131
50 3300026078 Ga0207702_10015812 Ga0207702_100158127 131
51 3300026121 Ga0207683_10313071 Ga0207683_103130713 131
52 3300037068 Ga0373925_0804345 Ga0373925_0804345_54_464 131
53 3300046499 Ga0495594_0435533 Ga0495594_0435533_145_555 131
54 3300046514 Ga0495618_0699938 Ga0495618_0699938_163_573 131
55 3300046535 Ga0495586_0071697 Ga0495586_0071697_1372_1782 131
56 3300046642 Ga0495634_0086688 Ga0495634_0086688_973_1383 131
57 3300046681 Ga0495647_0146021 Ga0495647_0146021_203_613 131
58 3300048918 Ga0496115_0306700 Ga0496115_0306700_108_539 131
59 3300042436 Ga0439435_0111653 Ga0439435_0111653_437_838 132
60 3300005435 Ga0070714_102159126 Ga0070714_1021591261 139
61 3300005563 Ga0068855_100481408 Ga0068855_1004814083 139
62 3300006175 Ga0070712_100379364 Ga0070712_1003793641 139
63 3300025915 Ga0207693_10284563 Ga0207693_102845633 139
64 3300025916 Ga0207663_10170265 Ga0207663_101702653 139
65 3300025929 Ga0207664_10519489 Ga0207664_105194892 139
66 3300025949 Ga0207667_11162698 Ga0207667_111626982 139
67 3300028379 Ga0268266_10380132 Ga0268266_103801321 139
68 3300035092 Ga0373952_0084182 Ga0373952_0084182_186_620 139
69 3300035691 Ga0373931_0349544 Ga0373931_0349544_323_757 139
70 3300048911 Ga0496108_0520794 Ga0496108_0520794_143_577 139
71 3300048913 Ga0496110_0015177 Ga0496110_0015177_830_1264 139
72 3300048914 Ga0496111_0007179 Ga0496111_0007179_4872_5306 139
73 3300048918 Ga0496115_0314272 Ga0496115_0314272_569_1003 139
74 3300048918 Ga0496115_0459699 Ga0496115_0459699_489_923 139
75 3300049568 Ga0501031_0068851 Ga0501031_0068851_1715_2158 139
76 3300049568 Ga0501031_0070969 Ga0501031_0070969_1720_2154 139
77 3300049568 Ga0501031_0107286 Ga0501031_0107286_1278_1712 139
78 3300049569 Ga0501032_0033595 Ga0501032_0033595_1025_1468 139
79 3300049571 Ga0501034_0009816 Ga0501034_0009816_9263_9706 139
80 3300049571 Ga0501034_0033717 Ga0501034_0033717_1259_1693 139
81 3300049572 Ga0501036_0774992 Ga0501036_0774992_225_668 139
82 3300049573 Ga0501037_0013845 Ga0501037_0013845_1720_2154 139
83 3300049573 Ga0501037_0059822 Ga0501037_0059822_225_668 139
84 3300049574 Ga0501038_0001345 Ga0501038_0001345_1720_2154 139
85 3300049574 Ga0501038_0059652 Ga0501038_0059652_2272_2715 139
86 3300049574 Ga0501038_0170013 Ga0501038_0170013_1039_1473 139
87 3300049575 Ga0501039_0067438 Ga0501039_0067438_2111_2554 139
88 3300049575 Ga0501039_0074663 Ga0501039_0074663_1488_1922 139
89 3300049575 Ga0501039_0102147 Ga0501039_0102147_84_518 139
90 3300049576 Ga0501040_0001857 Ga0501040_0001857_12683_13126 139
91 3300049576 Ga0501040_0040282 Ga0501040_0040282_1025_1459 139
92 3300049576 Ga0501040_0196583 Ga0501040_0196583_714_1148 139
93 3300049577 Ga0501041_0001181 Ga0501041_0001181_8349_8792 139
94 3300049577 Ga0501041_0032006 Ga0501041_0032006_1720_2154 139
95 3300049577 Ga0501041_0064811 Ga0501041_0064811_1090_1524 139
96 3300049577 Ga0501041_0442951 Ga0501041_0442951_189_623 139
97 3300049578 Ga0501042_0001430 Ga0501042_0001430_11255_11698 139
98 3300049578 Ga0501042_0041486 Ga0501042_0041486_103_537 139
99 3300049578 Ga0501042_0338046 Ga0501042_0338046_275_709 139
100 3300049579 Ga0501043_0000798 Ga0501043_0000798_2254_2697 139
101 3300049580 Ga0501046_0021238 Ga0501046_0021238_123_566 139
102 3300049580 Ga0501046_0139493 Ga0501046_0139493_538_972 139
103 3300049581 Ga0501047_0001088 Ga0501047_0001088_1384_1818 139
104 3300049581 Ga0501047_0198862 Ga0501047_0198862_553_996 139
105 3300049582 Ga0501048_0010398 Ga0501048_0010398_4395_4838 139
106 3300049582 Ga0501048_0120403 Ga0501048_0120403_161_595 139
107 3300049583 Ga0501067_0016745 Ga0501067_0016745_862_1305 139
108 3300049584 Ga0501068_0063099 Ga0501068_0063099_115_549 139
109 3300049584 Ga0501068_0653324 Ga0501068_0653324_129_572 139
110 3300049585 Ga0501069_0000870 Ga0501069_0000870_1720_2154 139
111 3300049585 Ga0501069_0010123 Ga0501069_0010123_4044_4487 139
112 3300049586 Ga0501070_0071949 Ga0501070_0071949_709_1143 139
113 3300049587 Ga0501071_0000054 Ga0501071_0000054_36290_36724 139
114 3300049587 Ga0501071_0094362 Ga0501071_0094362_129_572 139
115 3300049588 Ga0501072_0037520 Ga0501072_0037520_123_566 139
116 3300049588 Ga0501072_0279252 Ga0501072_0279252_713_1147 139
117 3300049589 Ga0501073_0044017 Ga0501073_0044017_449_892 139
118 3300049589 Ga0501073_0095848 Ga0501073_0095848_1321_1755 139
119 3300049590 Ga0501074_0037147 Ga0501074_0037147_736_1170 139
120 3300049590 Ga0501074_0379737 Ga0501074_0379737_303_746 139
121 3300049590 Ga0501074_0790823 Ga0501074_0790823_211_645 139
122 3300049591 Ga0501075_0000096 Ga0501075_0000096_39014_39448 139
123 3300049591 Ga0501075_0126666 Ga0501075_0126666_647_1081 139
124 3300049591 Ga0501075_0354768 Ga0501075_0354768_450_893 139
125 3300049592 Ga0501076_0053510 Ga0501076_0053510_1720_2154 139
126 3300049592 Ga0501076_0071447 Ga0501076_0071447_610_1044 139
127 3300049592 Ga0501076_0771195 Ga0501076_0771195_310_744 139
128 3300049593 Ga0501077_0000624 Ga0501077_0000624_12683_13126 139
129 3300049593 Ga0501077_0063977 Ga0501077_0063977_854_1288 139
130 3300049741 Ga0501079_0000001 Ga0501079_0000001_119094_119528 139
131 3300049741 Ga0501079_0079049 Ga0501079_0079049_870_1313 139
132 3300049741 Ga0501079_0176850 Ga0501079_0176850_864_1298 139
133 3300049742 Ga0501080_0002158 Ga0501080_0002158_2131_2565 139
134 3300049742 Ga0501080_0094364 Ga0501080_0094364_225_668 139
135 3300049742 Ga0501080_0213277 Ga0501080_0213277_14_448 139
136 3300049743 Ga0501081_0001766 Ga0501081_0001766_1273_1716 139
137 3300049743 Ga0501081_0085017 Ga0501081_0085017_864_1298 139
138 3300049743 Ga0501081_0098811 Ga0501081_0098811_1326_1760 139
139 3300049744 Ga0501083_0312763 Ga0501083_0312763_129_572 139
140 3300049822 Ga0501035_0146120 Ga0501035_0146120_1509_1943 139
141 3300049822 Ga0501035_0913793 Ga0501035_0913793_129_572 139
142 3300049823 Ga0501044_0165132 Ga0501044_0165132_1623_2066 139
143 3300049823 Ga0501044_0167127 Ga0501044_0167127_1697_2131 139
144 3300049824 Ga0501045_0000708 Ga0501045_0000708_9756_10199 139
145 3300049824 Ga0501045_0045380 Ga0501045_0045380_1720_2154 139
146 3300049824 Ga0501045_0132050 Ga0501045_0132050_1350_1784 139
147 3300049824 Ga0501045_0904060 Ga0501045_0904060_188_622 139
148 3300054114 Ga0501084_0000283 Ga0501084_0000283_1720_2154 139
149 3300060353 Ga0501082_0002904 Ga0501082_0002904_13161_13595 139
150 3300060353 Ga0501082_0031029 Ga0501082_0031029_1350_1784 139
151 3300061734 Ga0530510_0001060 Ga0530510_0001060_16095_16538 139
152 3300061734 Ga0530510_0024226 Ga0530510_0024226_1720_2154 139
153 3300061734 Ga0530510_0461916 Ga0530510_0461916_160_594 139
154 3300009174 Ga0105241_10875430 Ga0105241_108754301 140
155 3300048912 Ga0496109_1273340 Ga0496109_1273340_52_489 140
156 3300049591 Ga0501075_0202897 Ga0501075_0202897_55_528 140
157 2209111006 2214745517 2213755426 141
158 3300005327 Ga0070658_10340210 Ga0070658_103402102 141
159 3300005329 Ga0070683_100346471 Ga0070683_1003464711 141
160 3300005334 Ga0068869_100206133 Ga0068869_1002061333 141
161 3300005336 Ga0070680_100100266 Ga0070680_1001002663 141
162 3300005337 Ga0070682_100183411 Ga0070682_1001834113 141
163 3300005337 Ga0070682_101773720 Ga0070682_1017737201 141
164 3300005338 Ga0068868_100180321 Ga0068868_1001803212 141
165 3300005340 Ga0070689_100669022 Ga0070689_1006690221 141
166 3300005341 Ga0070691_10059933 Ga0070691_100599333 141
167 3300005347 Ga0070668_100175230 Ga0070668_1001752301 141
168 3300005353 Ga0070669_100186215 Ga0070669_1001862153 141
169 3300005356 Ga0070674_100060997 Ga0070674_1000609973 141
170 3300005364 Ga0070673_100810831 Ga0070673_1008108312 141
171 3300005367 Ga0070667_100776704 Ga0070667_1007767042 141
172 3300005434 Ga0070709_10476702 Ga0070709_104767022 141
173 3300005435 Ga0070714_100208698 Ga0070714_1002086983 141
174 3300005435 Ga0070714_101546591 Ga0070714_1015465911 141
175 3300005435 Ga0070714_101918804 Ga0070714_1019188041 141
176 3300005436 Ga0070713_100551360 Ga0070713_1005513603 141
177 3300005436 Ga0070713_102120388 Ga0070713_1021203881 141
178 3300005438 Ga0070701_10078317 Ga0070701_100783174 141
179 3300005438 Ga0070701_10366805 Ga0070701_103668052 141
180 3300005440 Ga0070705_100007129 Ga0070705_1000071294 141
181 3300005440 Ga0070705_100840479 Ga0070705_1008404791 141
182 3300005441 Ga0070700_100018931 Ga0070700_1000189315 141
183 3300005441 Ga0070700_100759510 Ga0070700_1007595102 141
184 3300005444 Ga0070694_100013535 Ga0070694_1000135354 141
185 3300005445 Ga0070708_100740155 Ga0070708_1007401552 141
186 3300005457 Ga0070662_100620225 Ga0070662_1006202252 141
187 3300005459 Ga0068867_100301180 Ga0068867_1003011803 141
188 3300005530 Ga0070679_100215338 Ga0070679_1002153384 141
189 3300005535 Ga0070684_100348730 Ga0070684_1003487302 141
190 3300005539 Ga0068853_100505288 Ga0068853_1005052883 141
191 3300005543 Ga0070672_100300893 Ga0070672_1003008933 141
192 3300005544 Ga0070686_100062454 Ga0070686_1000624541 141
193 3300005546 Ga0070696_100025587 Ga0070696_1000255873 141
194 3300005547 Ga0070693_100020822 Ga0070693_1000208223 141
195 3300005548 Ga0070665_100199683 Ga0070665_1001996833 141
196 3300005549 Ga0070704_101466597 Ga0070704_1014665971 141
197 3300005563 Ga0068855_100041122 Ga0068855_1000411224 141
198 3300005563 Ga0068855_100816154 Ga0068855_1008161542 141
199 3300005563 Ga0068855_101416138 Ga0068855_1014161382 141
200 3300005578 Ga0068854_100212556 Ga0068854_1002125563 141
201 3300005614 Ga0068856_100229794 Ga0068856_1002297943 141
202 3300005614 Ga0068856_100668129 Ga0068856_1006681292 141
203 3300005616 Ga0068852_100228325 Ga0068852_1002283253 141
204 3300005718 Ga0068866_10008028 Ga0068866_100080285 141
205 3300005719 Ga0068861_100030309 Ga0068861_1000303096 141
206 3300005719 Ga0068861_100094692 Ga0068861_1000946923 141
207 3300005843 Ga0068860_101375845 Ga0068860_1013758452 141
208 3300005844 Ga0068862_100039248 Ga0068862_1000392485 141
209 3300005937 Ga0081455_10162100 Ga0081455_101621002 141
210 3300005937 Ga0081455_10202870 Ga0081455_102028703 141
211 3300006175 Ga0070712_100709342 Ga0070712_1007093422 141
212 3300006237 Ga0097621_101206123 Ga0097621_1012061232 141
213 3300006358 Ga0068871_100379985 Ga0068871_1003799852 141
214 3300006852 Ga0075433_11069646 Ga0075433_110696462 141
215 3300006881 Ga0068865_100089232 Ga0068865_1000892324 141
216 3300006881 Ga0068865_100409759 Ga0068865_1004097593 141
217 3300007076 Ga0075435_100378680 Ga0075435_1003786803 141
218 3300009093 Ga0105240_10343715 Ga0105240_103437153 141
219 3300009094 Ga0111539_10174047 Ga0111539_101740473 141
220 3300009094 Ga0111539_10538607 Ga0111539_105386072 141
221 3300009098 Ga0105245_10023162 Ga0105245_100231626 141
222 3300009098 Ga0105245_10078657 Ga0105245_100786573 141
223 3300009098 Ga0105245_10248891 Ga0105245_102488912 141
224 3300009098 Ga0105245_10658402 Ga0105245_106584022 141
225 3300009147 Ga0114129_10766049 Ga0114129_107660493 141
226 3300009148 Ga0105243_10104011 Ga0105243_101040114 141
227 3300009148 Ga0105243_10581598 Ga0105243_105815982 141
228 3300009176 Ga0105242_10100581 Ga0105242_101005814 141
229 3300009176 Ga0105242_10300077 Ga0105242_103000772 141
230 3300009177 Ga0105248_10989782 Ga0105248_109897821 141
231 3300009553 Ga0105249_10020891 Ga0105249_100208916 141
232 3300009553 Ga0105249_10172412 Ga0105249_101724124 141
233 3300009553 Ga0105249_10805851 Ga0105249_108058512 141
234 3300010375 Ga0105239_10077431 Ga0105239_100774312 141
235 3300010375 Ga0105239_10251893 Ga0105239_102518934 141
236 3300010375 Ga0105239_12161674 Ga0105239_121616741 141
237 3300012505 Ga0157339_1003925 Ga0157339_10039252 141
238 3300012507 Ga0157342_1005414 Ga0157342_10054143 141
239 3300012510 Ga0157316_1010685 Ga0157316_10106852 141
240 3300013105 Ga0157369_10417753 Ga0157369_104177532 141
241 3300013306 Ga0163162_10080305 Ga0163162_100803053 141
242 3300013306 Ga0163162_10112567 Ga0163162_101125673 141
243 3300013306 Ga0163162_10312457 Ga0163162_103124573 141
244 3300013306 Ga0163162_10323628 Ga0163162_103236283 141
245 3300013307 Ga0157372_11295492 Ga0157372_112954922 141
246 3300013308 Ga0157375_10263084 Ga0157375_102630843 141
247 3300014325 Ga0163163_11421991 Ga0163163_114219912 141
248 3300014497 Ga0182008_10200747 Ga0182008_102007472 141
249 3300014968 Ga0157379_11787588 Ga0157379_117875882 141
250 3300017792 Ga0163161_10095608 Ga0163161_100956083 141
251 3300025885 Ga0207653_10019096 Ga0207653_100190963 141
252 3300025899 Ga0207642_10444752 Ga0207642_104447522 141
253 3300025913 Ga0207695_10182950 Ga0207695_101829502 141
254 3300025918 Ga0207662_10478037 Ga0207662_104780372 141
255 3300025919 Ga0207657_10096357 Ga0207657_100963574 141
256 3300025927 Ga0207687_10087119 Ga0207687_100871192 141
257 3300025927 Ga0207687_10633208 Ga0207687_106332082 141
258 3300025927 Ga0207687_10660611 Ga0207687_106606112 141
259 3300025928 Ga0207700_10353723 Ga0207700_103537231 141
260 3300025929 Ga0207664_10108951 Ga0207664_101089512 141
261 3300025932 Ga0207690_10307212 Ga0207690_103072123 141
262 3300025933 Ga0207706_10022265 Ga0207706_100222653 141
263 3300025933 Ga0207706_10038436 Ga0207706_100384364 141
264 3300025933 Ga0207706_10211384 Ga0207706_102113842 141
265 3300025935 Ga0207709_10211875 Ga0207709_102118752 141
266 3300025936 Ga0207670_10409044 Ga0207670_104090441 141
267 3300025938 Ga0207704_10047025 Ga0207704_100470254 141
268 3300025938 Ga0207704_10661875 Ga0207704_106618751 141
269 3300025942 Ga0207689_10211671 Ga0207689_102116712 141
270 3300025942 Ga0207689_10316215 Ga0207689_103162153 141
271 3300025944 Ga0207661_10510585 Ga0207661_105105852 141
272 3300025949 Ga0207667_10649407 Ga0207667_106494072 141
273 3300025960 Ga0207651_10763963 Ga0207651_107639632 141
274 3300025961 Ga0207712_10111369 Ga0207712_101113692 141
275 3300025972 Ga0207668_10031110 Ga0207668_100311103 141
276 3300025972 Ga0207668_10131812 Ga0207668_101318122 141
277 3300025981 Ga0207640_10041900 Ga0207640_100419003 141
278 3300025986 Ga0207658_10378835 Ga0207658_103788352 141
279 3300026023 Ga0207677_10093464 Ga0207677_100934643 141
280 3300026041 Ga0207639_10264557 Ga0207639_102645574 141
281 3300026075 Ga0207708_10035365 Ga0207708_100353653 141
282 3300026075 Ga0207708_10475171 Ga0207708_104751712 141
283 3300026075 Ga0207708_10949169 Ga0207708_109491691 141
284 3300026078 Ga0207702_10928372 Ga0207702_109283722 141
285 3300026088 Ga0207641_10199050 Ga0207641_101990503 141
286 3300026089 Ga0207648_10012419 Ga0207648_1001241911 141
287 3300026089 Ga0207648_10097443 Ga0207648_100974433 141
288 3300026089 Ga0207648_10288344 Ga0207648_102883442 141
289 3300026118 Ga0207675_100008454 Ga0207675_10000845411 141
290 3300026118 Ga0207675_100077258 Ga0207675_1000772585 141
291 3300026118 Ga0207675_100290946 Ga0207675_1002909462 141
292 3300028379 Ga0268266_10092472 Ga0268266_100924723 141
293 3300028380 Ga0268265_10502262 Ga0268265_105022621 141
294 3300028381 Ga0268264_10172284 Ga0268264_101722841 141
295 3300028577 Ga0265318_10046874 Ga0265318_100468743 141
296 3300031240 Ga0265320_10455199 Ga0265320_104551991 141
297 3300031548 Ga0307408_101089957 Ga0307408_1010899572 141
298 3300031995 Ga0307409_101334992 Ga0307409_1013349921 141
299 3300035113 Ga0373936_0629565 Ga0373936_0629565_50_493 141
300 3300035172 Ga0373955_0765729 Ga0373955_0765729_62_502 141
301 3300036401 Ga0373937_0591340 Ga0373937_0591340_553_984 141
302 3300037068 Ga0373925_0295147 Ga0373925_0295147_359_793 141
303 3300037312 Ga0395899_0008361 Ga0395899_0008361_1961_2395 141
304 3300037312 Ga0395899_0008461 Ga0395899_0008461_6881_7321 141
305 3300037312 Ga0395899_0263204 Ga0395899_0263204_177_617 141
306 3300037418 Ga0395900_0005255 Ga0395900_0005255_858_1298 141
307 3300037418 Ga0395900_0093456 Ga0395900_0093456_1961_2395 141
308 3300037418 Ga0395900_0223418 Ga0395900_0223418_356_796 141
309 3300037418 Ga0395900_0282567 Ga0395900_0282567_857_1297 141
310 3300037418 Ga0395900_0948614 Ga0395900_0948614_45_503 141
311 3300037418 Ga0395900_1379392 Ga0395900_1379392_56_487 141
312 3300037466 Ga0395898_0006828 Ga0395898_0006828_11177_11611 141
313 3300037466 Ga0395898_0008036 Ga0395898_0008036_10152_10592 141
314 3300037471 Ga0395905_0007309 Ga0395905_0007309_565_1005 141
315 3300037471 Ga0395905_0028765 Ga0395905_0028765_529_963 141
316 3300037471 Ga0395905_0302205 Ga0395905_0302205_905_1336 141
317 3300038443 Ga0395901_0003150 Ga0395901_0003150_12851_13285 141
318 3300038443 Ga0395901_0012458 Ga0395901_0012458_687_1127 141
319 3300038443 Ga0395901_0038952 Ga0395901_0038952_1010_1450 141
320 3300038443 Ga0395901_0203356 Ga0395901_0203356_218_658 141
321 3300038443 Ga0395901_0247506 Ga0395901_0247506_269_730 141
322 3300038443 Ga0395901_0890425 Ga0395901_0890425_217_657 141
323 3300041411 Ga0439466_0075325 Ga0439466_0075325_268_708 141
324 3300041411 Ga0439466_0100115 Ga0439466_0100115_162_602 141
325 3300041491 Ga0451833_0216220 Ga0451833_0216220_154_588 141
326 3300042122 Ga0450920_010051 Ga0450920_010051_547_981 141
327 3300042435 Ga0439434_0264321 Ga0439434_0264321_31_465 141
328 3300044656 Ga0466969_0021621 Ga0466969_0021621_1389_1820 141
329 3300044694 Ga0466963_0025181 Ga0466963_0025181_1849_2286 141
330 3300044842 Ga0466957_0108907 Ga0466957_0108907_143_595 141
331 3300044901 Ga0466960_0094703 Ga0466960_0094703_232_672 141
332 3300045049 Ga0466959_0100548 Ga0466959_0100548_1396_1836 141
333 3300045051 Ga0451576_0153454 Ga0451576_0153454_1728_2222 141
334 3300046453 Ga0495627_221422 Ga0495627_221422_17_457 141
335 3300046461 Ga0495641_0323007 Ga0495641_0323007_165_599 141
336 3300046463 Ga0495653_0160993 Ga0495653_0160993_616_1053 141
337 3300046491 Ga0495584_0253392 Ga0495584_0253392_116_550 141
338 3300046491 Ga0495584_0520621 Ga0495584_0520621_80_520 141
339 3300046492 Ga0495585_0167501 Ga0495585_0167501_92_532 141
340 3300046492 Ga0495585_0182893 Ga0495585_0182893_433_867 141
341 3300046500 Ga0495596_0038740 Ga0495596_0038740_253_678 141
342 3300046500 Ga0495596_0096018 Ga0495596_0096018_112_552 141
343 3300046516 Ga0495628_0233322 Ga0495628_0233322_843_1280 141
344 3300046520 Ga0495637_0201702 Ga0495637_0201702_50_490 141
345 3300046523 Ga0495644_0312024 Ga0495644_0312024_102_527 141
346 3300046525 Ga0495663_0042884 Ga0495663_0042884_642_1082 141
347 3300046525 Ga0495663_0048366 Ga0495663_0048366_800_1237 141
348 3300046528 Ga0495642_0135005 Ga0495642_0135005_10_444 141
349 3300046615 Ga0495656_0606014 Ga0495656_0606014_67_492 141
350 3300046642 Ga0495634_0432723 Ga0495634_0432723_298_741 141
351 3300046665 Ga0495661_0165852 Ga0495661_0165852_539_964 141
352 3300046674 Ga0495588_0263748 Ga0495588_0263748_236_670 141
353 3300046683 Ga0495658_0831772 Ga0495658_0831772_87_521 141
354 3300046692 Ga0495671_0106250 Ga0495671_0106250_872_1306 141
355 3300046692 Ga0495671_0462391 Ga0495671_0462391_162_587 141
356 3300046810 Ga0495660_0426337 Ga0495660_0426337_122_547 141
357 3300047445 Ga0495677_0108177 Ga0495677_0108177_506_931 141
358 3300048091 Ga0495626_0285168 Ga0495626_0285168_25_465 141
359 3300048903 Ga0496100_0221703 Ga0496100_0221703_515_982 141
360 3300048903 Ga0496100_0253472 Ga0496100_0253472_369_803 141
361 3300048903 Ga0496100_0383118 Ga0496100_0383118_377_817 141
362 3300048904 Ga0496101_0032910 Ga0496101_0032910_2188_2619 141
363 3300048904 Ga0496101_0034025 Ga0496101_0034025_2102_2536 141
364 3300048904 Ga0496101_0453012 Ga0496101_0453012_195_635 141
365 3300048905 Ga0496102_0107864 Ga0496102_0107864_1030_1461 141
366 3300048905 Ga0496102_0452479 Ga0496102_0452479_473_907 141
367 3300048905 Ga0496102_0712053 Ga0496102_0712053_427_867 141
368 3300048905 Ga0496102_1104059 Ga0496102_1104059_150_584 141
369 3300048905 Ga0496102_1396309 Ga0496102_1396309_62_496 141
370 3300048906 Ga0496103_0408142 Ga0496103_0408142_395_829 141
371 3300048907 Ga0496104_0015511 Ga0496104_0015511_644_1078 141
372 3300048907 Ga0496104_0028939 Ga0496104_0028939_3716_4156 141
373 3300048907 Ga0496104_0040518 Ga0496104_0040518_555_986 141
374 3300048908 Ga0496105_0001193 Ga0496105_0001193_15223_15663 141
375 3300048908 Ga0496105_0026330 Ga0496105_0026330_2208_2642 141
376 3300048908 Ga0496105_0100236 Ga0496105_0100236_580_1014 141
377 3300048908 Ga0496105_0355510 Ga0496105_0355510_107_574 141
378 3300048909 Ga0496106_0092617 Ga0496106_0092617_584_1018 141
379 3300048909 Ga0496106_0432799 Ga0496106_0432799_539_979 141
380 3300048910 Ga0496107_0123867 Ga0496107_0123867_1213_1653 141
381 3300048910 Ga0496107_0289837 Ga0496107_0289837_55_489 141
382 3300048910 Ga0496107_0298714 Ga0496107_0298714_502_936 141
383 3300048910 Ga0496107_0703840 Ga0496107_0703840_52_492 141
384 3300048911 Ga0496108_0057900 Ga0496108_0057900_1372_1806 141
385 3300048911 Ga0496108_0356454 Ga0496108_0356454_17_448 141
386 3300048912 Ga0496109_0134261 Ga0496109_0134261_695_1129 141
387 3300048912 Ga0496109_0151215 Ga0496109_0151215_642_1076 141
388 3300048912 Ga0496109_0252334 Ga0496109_0252334_984_1415 141
389 3300048912 Ga0496109_0410260 Ga0496109_0410260_585_1022 141
390 3300048913 Ga0496110_0016659 Ga0496110_0016659_4604_5035 141
391 3300048913 Ga0496110_0135793 Ga0496110_0135793_1379_1813 141
392 3300048913 Ga0496110_0272788 Ga0496110_0272788_285_770 141
393 3300048913 Ga0496110_1336477 Ga0496110_1336477_31_471 141
394 3300048914 Ga0496111_0004004 Ga0496111_0004004_1787_2218 141
395 3300048914 Ga0496111_0659044 Ga0496111_0659044_149_634 141
396 3300048915 Ga0496112_0120164 Ga0496112_0120164_799_1233 141
397 3300048915 Ga0496112_0161229 Ga0496112_0161229_1236_1688 141
398 3300048915 Ga0496112_0164303 Ga0496112_0164303_655_1098 141
399 3300048915 Ga0496112_0278638 Ga0496112_0278638_100_531 141
400 3300048915 Ga0496112_0358531 Ga0496112_0358531_48_533 141
401 3300048916 Ga0496113_0026247 Ga0496113_0026247_473_907 141
402 3300048916 Ga0496113_0356352 Ga0496113_0356352_70_555 141
403 3300048917 Ga0496114_0141258 Ga0496114_0141258_796_1236 141
404 3300048917 Ga0496114_0747564 Ga0496114_0747564_326_754 141
405 3300048918 Ga0496115_0387210 Ga0496115_0387210_399_833 141
406 3300048918 Ga0496115_0713213 Ga0496115_0713213_246_713 141
407 3300049568 Ga0501031_0023299 Ga0501031_0023299_2428_2868 141
408 3300049568 Ga0501031_0429326 Ga0501031_0429326_346_795 141
409 3300049569 Ga0501032_0036915 Ga0501032_0036915_1388_1825 141
410 3300049570 Ga0501033_0011403 Ga0501033_0011403_1718_2155 141
411 3300049572 Ga0501036_0004702 Ga0501036_0004702_7289_7726 141
412 3300049572 Ga0501036_0012175 Ga0501036_0012175_2810_3250 141
413 3300049572 Ga0501036_0601160 Ga0501036_0601160_313_747 141
414 3300049573 Ga0501037_0006954 Ga0501037_0006954_2255_2692 141
415 3300049573 Ga0501037_0016483 Ga0501037_0016483_852_1292 141
416 3300049574 Ga0501038_0043430 Ga0501038_0043430_2289_2729 141
417 3300049574 Ga0501038_0067116 Ga0501038_0067116_164_601 141
418 3300049574 Ga0501038_1161860 Ga0501038_1161860_98_532 141
419 3300049575 Ga0501039_0005475 Ga0501039_0005475_3291_3731 141
420 3300049576 Ga0501040_0270809 Ga0501040_0270809_579_1019 141
421 3300049576 Ga0501040_0279360 Ga0501040_0279360_418_846 141
422 3300049576 Ga0501040_0594347 Ga0501040_0594347_74_508 141
423 3300049577 Ga0501041_0003625 Ga0501041_0003625_3272_3709 141
424 3300049577 Ga0501041_0347875 Ga0501041_0347875_303_743 141
425 3300049577 Ga0501041_0391296 Ga0501041_0391296_193_627 141
426 3300049578 Ga0501042_0539622 Ga0501042_0539622_261_698 141
427 3300049578 Ga0501042_0745464 Ga0501042_0745464_250_678 141
428 3300049579 Ga0501043_0004591 Ga0501043_0004591_9027_9464 141
429 3300049579 Ga0501043_0009672 Ga0501043_0009672_5660_6100 141
430 3300049580 Ga0501046_0012367 Ga0501046_0012367_2103_2540 141
431 3300049580 Ga0501046_0030605 Ga0501046_0030605_1244_1684 141
432 3300049581 Ga0501047_0278102 Ga0501047_0278102_1071_1508 141
433 3300049582 Ga0501048_0001065 Ga0501048_0001065_8338_8778 141
434 3300049582 Ga0501048_0006165 Ga0501048_0006165_3715_4152 141
435 3300049584 Ga0501068_0006420 Ga0501068_0006420_2212_2649 141
436 3300049584 Ga0501068_0140010 Ga0501068_0140010_302_742 141
437 3300049585 Ga0501069_0006041 Ga0501069_0006041_1330_1770 141
438 3300049586 Ga0501070_0002312 Ga0501070_0002312_8915_9355 141
439 3300049586 Ga0501070_0078733 Ga0501070_0078733_161_598 141
440 3300049587 Ga0501071_0125126 Ga0501071_0125126_66_506 141
441 3300049587 Ga0501071_0410139 Ga0501071_0410139_376_810 141
442 3300049588 Ga0501072_0026780 Ga0501072_0026780_2528_2968 141
443 3300049588 Ga0501072_0058666 Ga0501072_0058666_2433_2870 141
444 3300049589 Ga0501073_0018970 Ga0501073_0018970_4480_4917 141
445 3300049589 Ga0501073_0387506 Ga0501073_0387506_89_529 141
446 3300049590 Ga0501074_0002914 Ga0501074_0002914_9283_9723 141
447 3300049590 Ga0501074_0006494 Ga0501074_0006494_3268_3705 141
448 3300049591 Ga0501075_0001970 Ga0501075_0001970_3876_4316 141
449 3300049592 Ga0501076_0050802 Ga0501076_0050802_175_615 141
450 3300049592 Ga0501076_0353340 Ga0501076_0353340_139_573 141
451 3300049592 Ga0501076_0612072 Ga0501076_0612072_316_750 141
452 3300049593 Ga0501077_0006820 Ga0501077_0006820_4977_5414 141
453 3300049593 Ga0501077_0033279 Ga0501077_0033279_175_615 141
454 3300049741 Ga0501079_0022079 Ga0501079_0022079_1952_2389 141
455 3300049741 Ga0501079_0120689 Ga0501079_0120689_1020_1460 141
456 3300049742 Ga0501080_0042363 Ga0501080_0042363_3625_4065 141
457 3300049742 Ga0501080_0060548 Ga0501080_0060548_1436_1873 141
458 3300049743 Ga0501081_0048445 Ga0501081_0048445_66_506 141
459 3300049744 Ga0501083_0010021 Ga0501083_0010021_61_498 141
460 3300049744 Ga0501083_0032509 Ga0501083_0032509_848_1288 141
461 3300049822 Ga0501035_0028824 Ga0501035_0028824_150_587 141
462 3300049822 Ga0501035_0037804 Ga0501035_0037804_1223_1663 141
463 3300049823 Ga0501044_0622128 Ga0501044_0622128_276_713 141
464 3300049824 Ga0501045_0022550 Ga0501045_0022550_3270_3710 141
465 3300049824 Ga0501045_0059018 Ga0501045_0059018_839_1276 141
466 3300050511 nmdc:mga08y16_178202_c1 nmdc:mga08y16_178202_c1_867_1298 141
467 3300050511 nmdc:mga08y16_232741_c1 nmdc:mga08y16_232741_c1_149_583 141
468 3300050511 nmdc:mga08y16_240035_c1 nmdc:mga08y16_240035_c1_1104_1544 141
469 3300050512 nmdc:mga0n895_1471929_c1 nmdc:mga0n895_1471929_c1_132_572 141
470 3300050512 nmdc:mga0n895_257657_c1 nmdc:mga0n895_257657_c1_1055_1495 141
471 3300050512 nmdc:mga0n895_68093_c1 nmdc:mga0n895_68093_c1_2879_3313 141
472 3300050513 nmdc:mga0rr50_372244_c1 nmdc:mga0rr50_372244_c1_649_1089 141
473 3300050515 nmdc:mga0a205_1068030_c1 nmdc:mga0a205_1068030_c1_35_469 141
474 3300050515 nmdc:mga0a205_281279_c1 nmdc:mga0a205_281279_c1_490_930 141
475 3300053077 Ga0495601_0066033 Ga0495601_0066033_604_1041 141
476 3300053084 Ga0495595_0724415 Ga0495595_0724415_14_454 141
477 3300053085 Ga0495619_0290613 Ga0495619_0290613_237_671 141
478 3300054114 Ga0501084_0062245 Ga0501084_0062245_1977_2417 141
479 3300054114 Ga0501084_0403530 Ga0501084_0403530_83_517 141
480 3300054114 Ga0501084_0814136 Ga0501084_0814136_68_502 141
481 3300060353 Ga0501082_0449298 Ga0501082_0449298_374_808 141
482 3300061734 Ga0530510_0919538 Ga0530510_0919538_156_590 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

3

145

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.9324 1 140
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.8922 1 140
6m6y-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp 0.8801 3 138
1vcd-assembly1.cif.gz_A crystal structure of a t.thermophilus hb8 ap6a hydrolase ndx1 0.8782 4 141
6m72-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgdp 0.876 3 138
ID Description Score Start End Superfamily
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9271 5 140 3.90.79.10
af_Q54S63_2_208_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9069 70 90 3.40.50.300
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.906 5 140 3.90.79.10
af_P9WIY3_15_154_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8902 3 139 3.90.79.10
af_P9WIX7_56_205_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8831 2 140 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A538J6U8-F1-model_v4 NUDIX domain-containing protein 0.9939 1 140 GO:0016787
AF-A0A6I3BPS9-F1-model_v4 NUDIX domain-containing protein 0.9859 1 140 GO:0016787
AF-A0A538M1J0-F1-model_v4 NUDIX domain-containing protein 0.9835 1 140 GO:0016787
AF-A0A7W0PXB8-F1-model_v4 NUDIX domain-containing protein 0.9813 24 141 GO:0004081
GO:0006167
GO:0006754
AF-A0A538J6U8-F1-model_v4 NUDIX domain-containing protein 0.9799 1 140 GO:0016787

Feature Viewer

pLDDT pTM Quality
97.42 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map