metagRoot

F452565

General Info

Members	Datasets	Scaffolds	Average Seq Length
482	205	482	136

Family's Representative Sequence

Representative Sequence	3300005468\|Ga0070707_100118928\|Ga0070707_1001189284
Length	158
Sequence	VGYFESRSLAKSGVGETSPQGGEAMKIQRLLIALTVVNLGLLMFLLAQIRPPEAHSAAAVLRGSALEIVDDQGRVRASIKVYPAGTANGKPYHETVLLRLITERGRPSVKIAASEQSAGMALAGPTGTKETYVQLGANGTVSSLKLKNEDGREQLIQP

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
3	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
4	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
5	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
6	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
7	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
8	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
9	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
10	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
11	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
12	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
13	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
14	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
15	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
16	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
17	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
18	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
19	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
20	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
21	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
22	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
23	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
24	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
25	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
26	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
29	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
30	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
31	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
32	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
33	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
34	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
35	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
36	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
37	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
38	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
39	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
40	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
41	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
42	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
43	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
44	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
45	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
46	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
47	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
48	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
49	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
50	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
51	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
52	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
53	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
54	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
55	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
56	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
57	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
58	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
59	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
60	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
61	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
62	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
63	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
64	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
65	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
66	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
67	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
68	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
69	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
70	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
71	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
73	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
74	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
75	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
76	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
77	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
78	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
79	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
80	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
81	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
83	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
84	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
85	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
87	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
88	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
89	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
90	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
91	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
92	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
93	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
94	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
95	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
96	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
97	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
98	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
99	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
100	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
101	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
102	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
103	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
104	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
105	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
106	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
107	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
108	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
151	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
155	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
156	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
157	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
158	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
159	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
160	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
161	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
162	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
163	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
164	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
165	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
166	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
167	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
168	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
169	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
170	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
171	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
172	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
173	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
174	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
175	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
176	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
177	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
178	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
179	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
180	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
181	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
182	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
183	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
184	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
185	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
186	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
187	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
188	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
189	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
190	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
191	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
192	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
193	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
194	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
195	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
196	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
197	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
198	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
199	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
200	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
201	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
202	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
203	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
204	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
205	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.9
Nodule	0
Rhizoplane	2.07
Rhizosphere	94.81
Stem	0
Stem Tuber	0
Unclassified	0.21

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_4975126	2162886012	Bacteria	839
2	MBSR1b_contig_8389571	2162886012	Bacteria	835
3	JGI25406J46586_10073926	3300003203	Unclassified	1062
4	JGI25404J52841_10014769	3300003659	Bacteria	1695
5	JGI25404J52841_10022844	3300003659	Bacteria	1350
6	Ga0055530_10000269	3300003791	Bacteria	47045
7	Ga0055531_10000318	3300003794	Bacteria	47203
8	Ga0065712_10000283	3300005290	Bacteria	21301
9	Ga0065712_10413181	3300005290	Unclassified	719
10	Ga0065715_10001222	3300005293	Bacteria	12023
11	Ga0065715_10005275	3300005293	Bacteria	3885
12	Ga0065707_10188066	3300005295	Unclassified	1377
13	Ga0065707_10465946	3300005295	Unclassified	786
14	Ga0070676_10026458	3300005328	Unclassified	3285
15	Ga0070676_10051466	3300005328	Unclassified	2418
16	Ga0070676_10339018	3300005328	Bacteria	1030
17	Ga0070690_100142665	3300005330	Bacteria	1627
18	Ga0070670_100007490	3300005331	Bacteria	9270
19	Ga0070670_100010528	3300005331	Bacteria	7895
20	Ga0070670_100228835	3300005331	Bacteria	1618
21	Ga0070670_101422416	3300005331	Bacteria	636
22	Ga0070677_10063272	3300005333	Bacteria	1533
23	Ga0070677_10472004	3300005333	Bacteria	675
24	Ga0068869_100032774	3300005334	Bacteria	3663
25	Ga0068869_100213593	3300005334	Bacteria	1526
26	Ga0068869_100419963	3300005334	Unclassified	1103
27	Ga0070666_10002437	3300005335	Bacteria	11245
28	Ga0070666_10970679	3300005335	Bacteria	630
29	Ga0070680_100400275	3300005336	Bacteria	1170
30	Ga0068868_100002248	3300005338	Bacteria	13348
31	Ga0070689_100351419	3300005340	Unclassified	1237
32	Ga0070689_100497931	3300005340	Bacteria	1043
33	Ga0070689_101007719	3300005340	Unclassified	741
34	Ga0070668_100018849	3300005347	Bacteria	5184
35	Ga0070668_100042037	3300005347	Unclassified	3503
36	Ga0070668_100052322	3300005347	Bacteria	3147
37	Ga0070668_100076667	3300005347	Bacteria	2612
38	Ga0070668_100113093	3300005347	Bacteria	2162
39	Ga0070668_100141824	3300005347	Bacteria	1937
40	Ga0070668_100535599	3300005347	Bacteria	1018
41	Ga0070669_100001610	3300005353	Bacteria	16310
42	Ga0070669_100029530	3300005353	Bacteria	3952
43	Ga0070669_100099565	3300005353	Bacteria	2191
44	Ga0070675_100020613	3300005354	Bacteria	5261
45	Ga0070675_100083172	3300005354	Bacteria	2671
46	Ga0070671_100026908	3300005355	Bacteria	4732
47	Ga0070671_100159599	3300005355	Bacteria	1906
48	Ga0070671_100508711	3300005355	Bacteria	1036
49	Ga0070671_100613818	3300005355	Bacteria	940
50	Ga0070674_100003311	3300005356	Bacteria	9020
51	Ga0070674_100011551	3300005356	Bacteria	5381
52	Ga0070674_100063493	3300005356	Bacteria	2585
53	Ga0070674_100148149	3300005356	Bacteria	1768
54	Ga0070674_101266211	3300005356	Bacteria	657
55	Ga0070673_100635161	3300005364	Unclassified	976
56	Ga0070673_101488692	3300005364	Unclassified	638
57	Ga0070688_100004728	3300005365	Bacteria	7114
58	Ga0070688_100007081	3300005365	Bacteria	6034
59	Ga0070688_100845741	3300005365	Unclassified	718
60	Ga0070667_100024929	3300005367	Bacteria	4969
61	Ga0070667_100453255	3300005367	Bacteria	1172
62	Ga0070667_100625112	3300005367	Bacteria	993
63	Ga0070667_100829265	3300005367	Unclassified	859
64	Ga0070713_100038093	3300005436	Bacteria	3893
65	Ga0070705_100055853	3300005440	Bacteria	2322
66	Ga0070694_100220789	3300005444	Bacteria	1421
67	Ga0070694_100920240	3300005444	Bacteria	723
68	Ga0070708_101110094	3300005445	Bacteria	741
69	Ga0070708_101933309	3300005445	Unclassified	547
70	Ga0070663_100089968	3300005455	Bacteria	2272
71	Ga0070663_101123508	3300005455	Bacteria	688
72	Ga0070678_100003143	3300005456	Bacteria	9143
73	Ga0070678_100031098	3300005456	Bacteria	3677
74	Ga0070678_100209785	3300005456	Bacteria	1613
75	Ga0070678_100780618	3300005456	Bacteria	866
76	Ga0070678_100832831	3300005456	Unclassified	840
77	Ga0070678_100927086	3300005456	Unclassified	797
78	Ga0070678_101293666	3300005456	Unclassified	678
79	Ga0070678_102109980	3300005456	Unclassified	534
80	Ga0070662_100382742	3300005457	Bacteria	1158
81	Ga0070681_10008591	3300005458	Bacteria	10009
82	Ga0070681_10199014	3300005458	Bacteria	1922
83	Ga0070681_11258588	3300005458	Bacteria	662
84	Ga0068867_100002816	3300005459	Bacteria	12226
85	Ga0068867_100009095	3300005459	Bacteria	7010
86	Ga0068867_100132492	3300005459	Bacteria	1939
87	Ga0068867_100453234	3300005459	Unclassified	1093
88	Ga0068867_101109747	3300005459	Unclassified	722
89	Ga0070685_10006073	3300005466	Bacteria	6158
90	Ga0070685_10260695	3300005466	Bacteria	1152
91	Ga0070706_100002625	3300005467	Bacteria	18005
92	Ga0070706_100034974	3300005467	Bacteria	4639
93	Ga0070706_100406856	3300005467	Bacteria	1267
94	Ga0070706_101026159	3300005467	Bacteria	760
95	Ga0070707_100007570	3300005468	Bacteria	10083
96	Ga0070707_100118928	3300005468	Bacteria	2565
97	Ga0070707_100606292	3300005468	Bacteria	1057
98	Ga0070698_100552076	3300005471	Bacteria	1091
99	Ga0070699_100359197	3300005518	Unclassified	1313
100	Ga0070699_101034643	3300005518	Bacteria	753
101	Ga0070679_100092039	3300005530	Unclassified	3020
102	Ga0070679_100431042	3300005530	Bacteria	1264
103	Ga0070679_101466581	3300005530	Archaea	629
104	Ga0070684_100990396	3300005535	Unclassified	789
105	Ga0070697_100039089	3300005536	Bacteria	3835
106	Ga0070697_100104520	3300005536	Bacteria	2355
107	Ga0068853_100164135	3300005539	Unclassified	2006
108	Ga0068853_100485147	3300005539	Bacteria	1165
109	Ga0068853_100672446	3300005539	Unclassified	986
110	Ga0070672_100032704	3300005543	Bacteria	3929
111	Ga0070672_100257358	3300005543	Bacteria	1471
112	Ga0070672_102027988	3300005543	Bacteria	518
113	Ga0070686_100078029	3300005544	Bacteria	2186
114	Ga0070686_100625571	3300005544	Unclassified	851
115	Ga0070686_101445835	3300005544	Bacteria	578
116	Ga0070695_100280855	3300005545	Bacteria	1223
117	Ga0070695_100440718	3300005545	Unclassified	996
118	Ga0070696_100144943	3300005546	Bacteria	1739
119	Ga0070693_100561797	3300005547	Unclassified	818
120	Ga0070665_100018030	3300005548	Bacteria	7085
121	Ga0070665_100018354	3300005548	Bacteria	7012
122	Ga0070704_100179224	3300005549	Bacteria	1693
123	Ga0070704_100266902	3300005549	Bacteria	1412
124	Ga0070704_100274475	3300005549	Unclassified	1394
125	Ga0070704_100861818	3300005549	Unclassified	813
126	Ga0068857_100053834	3300005577	Bacteria	3570
127	Ga0068857_100444116	3300005577	Bacteria	1212
128	Ga0070702_100018553	3300005615	Bacteria	3611
129	Ga0070702_100323723	3300005615	Unclassified	1075
130	Ga0068852_100301350	3300005616	Bacteria	1551
131	Ga0068852_100709726	3300005616	Bacteria	1016
132	Ga0068852_101276109	3300005616	Unclassified	756
133	Ga0068859_100013259	3300005617	Bacteria	8270
134	Ga0068859_100098953	3300005617	Bacteria	2971
135	Ga0068859_100177358	3300005617	Bacteria	2213
136	Ga0068859_100873621	3300005617	Bacteria	985
137	Ga0068864_100008516	3300005618	Bacteria	8462
138	Ga0068864_100283313	3300005618	Bacteria	1547
139	Ga0068864_100484927	3300005618	Unclassified	1187
140	Ga0068866_10042128	3300005718	Bacteria	2270
141	Ga0068866_10047415	3300005718	Bacteria	2166
142	Ga0068866_10669891	3300005718	Unclassified	708
143	Ga0068861_100002910	3300005719	Bacteria	11284
144	Ga0068861_100021014	3300005719	Bacteria	4687
145	Ga0068861_100176222	3300005719	Unclassified	1776
146	Ga0068870_11210328	3300005840	Bacteria	547
147	Ga0068863_100020968	3300005841	Bacteria	6242
148	Ga0068863_100391287	3300005841	Bacteria	1358
149	Ga0068863_101476340	3300005841	Bacteria	688
150	Ga0068858_100063160	3300005842	Bacteria	3426
151	Ga0068858_102016489	3300005842	Bacteria	570
152	Ga0068860_100010249	3300005843	Bacteria	9277
153	Ga0068860_100023966	3300005843	Bacteria	5899
154	Ga0068862_100001483	3300005844	Bacteria	21509
155	Ga0068862_100034527	3300005844	Bacteria	4280
156	Ga0068862_100049336	3300005844	Bacteria	3595
157	Ga0068862_100082369	3300005844	Bacteria	2792
158	Ga0068862_100084870	3300005844	Bacteria	2751
159	Ga0068862_100128906	3300005844	Bacteria	2236
160	Ga0068862_101740948	3300005844	Bacteria	632
161	Ga0068862_101845453	3300005844	Unclassified	614
162	Ga0081455_10008277	3300005937	Bacteria	10837
163	Ga0081455_10017249	3300005937	Bacteria	6931
164	Ga0081455_10061039	3300005937	Bacteria	3174
165	Ga0081455_10496852	3300005937	Unclassified	820
166	Ga0081455_10519092	3300005937	Unclassified	795
167	Ga0081455_11042588	3300005937	Bacteria	506
168	Ga0081540_1016618	3300005983	Bacteria	4595
169	Ga0081540_1054182	3300005983	Bacteria	1962
170	Ga0081540_1280329	3300005983	Unclassified	575
171	Ga0081539_10021283	3300005985	Bacteria	4339
172	Ga0081539_10079500	3300005985	Bacteria	1728
173	Ga0070717_10010594	3300006028	Bacteria	6966
174	Ga0075365_10097074	3300006038	Unclassified	2014
175	Ga0070715_10879534	3300006163	Bacteria	550
176	Ga0075367_10386820	3300006178	Bacteria	884
177	Ga0075366_10012425	3300006195	Bacteria	4830
178	Ga0075366_10081712	3300006195	Unclassified	1930
179	Ga0075366_10247521	3300006195	Bacteria	1087
180	Ga0097621_100070614	3300006237	Bacteria	2884
181	Ga0097621_100118239	3300006237	Unclassified	2246
182	Ga0097621_100636892	3300006237	Unclassified	977
183	Ga0068871_100037570	3300006358	Bacteria	3863
184	Ga0068871_100079638	3300006358	Unclassified	2711
185	Ga0068871_100159871	3300006358	Bacteria	1926
186	Ga0068871_100465360	3300006358	Unclassified	1135
187	Ga0068871_101007045	3300006358	Bacteria	776
188	Ga0075428_100007676	3300006844	Bacteria	11959
189	Ga0075428_101303677	3300006844	Bacteria	764
190	Ga0075430_100342015	3300006846	Unclassified	1236
191	Ga0075431_100249240	3300006847	Bacteria	1805
192	Ga0075431_100442059	3300006847	Unclassified	1297
193	Ga0075433_10207148	3300006852	Bacteria	1743
194	Ga0075433_10321679	3300006852	Bacteria	1368
195	Ga0075434_100028050	3300006871	Bacteria	5529
196	Ga0075434_100069458	3300006871	Bacteria	3512
197	Ga0075434_100071390	3300006871	Bacteria	3464
198	Ga0075434_100336897	3300006871	Archaea	1529
199	Ga0075434_100483442	3300006871	Unclassified	1259
200	Ga0075434_101296454	3300006871	Unclassified	739
201	Ga0075434_101400518	3300006871	Bacteria	709
202	Ga0075429_100021750	3300006880	Bacteria	5562
203	Ga0075429_101713321	3300006880	Unclassified	546
204	Ga0068865_100003455	3300006881	Bacteria	9463
205	Ga0068865_100004332	3300006881	Bacteria	8568
206	Ga0068865_100134830	3300006881	Bacteria	1854
207	Ga0068865_100180961	3300006881	Bacteria	1623
208	Ga0068865_100444887	3300006881	Bacteria	1070
209	Ga0068865_100829218	3300006881	Unclassified	800
210	Ga0075436_100112634	3300006914	Unclassified	1900
211	Ga0097620_100013259	3300006931	Bacteria	8270
212	Ga0097620_100098971	3300006931	Bacteria	2971
213	Ga0097620_100177353	3300006931	Bacteria	2213
214	Ga0097620_100873656	3300006931	Bacteria	985
215	Ga0075435_100254992	3300007076	Bacteria	1494
216	Ga0075435_100270227	3300007076	Bacteria	1450
217	Ga0075435_100911345	3300007076	Unclassified	767
218	Ga0099794_10020111	3300007265	Bacteria	3018
219	Ga0099794_10030230	3300007265	Bacteria	2528
220	Ga0099795_10074407	3300007788	Unclassified	1288
221	Ga0111539_10021534	3300009094	Bacteria	7932
222	Ga0111539_10197219	3300009094	Bacteria	2348
223	Ga0111539_10418335	3300009094	Unclassified	1561
224	Ga0111539_10549818	3300009094	Bacteria	1345
225	Ga0111539_10564540	3300009094	Unclassified	1325
226	Ga0111539_11566679	3300009094	Unclassified	764
227	Ga0105245_10616202	3300009098	Unclassified	1113
228	Ga0105245_12635109	3300009098	Unclassified	556
229	Ga0114129_10016686	3300009147	Bacteria	10458
230	Ga0114129_10204794	3300009147	Bacteria	2670
231	Ga0114129_11122622	3300009147	Unclassified	983
232	Ga0105243_10308079	3300009148	Bacteria	1438
233	Ga0105243_10675939	3300009148	Bacteria	1003
234	Ga0105241_10070611	3300009174	Unclassified	2710
235	Ga0105242_10236641	3300009176	Bacteria	1639
236	Ga0105242_10242396	3300009176	Bacteria	1621
237	Ga0105242_10289209	3300009176	Bacteria	1491
238	Ga0105242_10360323	3300009176	Bacteria	1346
239	Ga0105242_10722827	3300009176	Bacteria	977
240	Ga0105248_10010375	3300009177	Bacteria	10258
241	Ga0105248_10069465	3300009177	Bacteria	3955
242	Ga0105248_10311677	3300009177	Bacteria	1772
243	Ga0105248_10460519	3300009177	Bacteria	1433
244	Ga0105238_10331158	3300009551	Bacteria	1510
245	Ga0105238_11322294	3300009551	Unclassified	747
246	Ga0105249_10007914	3300009553	Bacteria	9263
247	Ga0105249_10017269	3300009553	Bacteria	6406
248	Ga0105249_10066816	3300009553	Bacteria	3311
249	Ga0105249_10104541	3300009553	Bacteria	2669
250	Ga0105249_10942024	3300009553	Bacteria	931
251	Ga0099796_10014297	3300010159	Bacteria	2290
252	Ga0105239_10688953	3300010375	Unclassified	1168
253	Ga0105246_10241211	3300011119	Unclassified	1429
254	Ga0105246_11711400	3300011119	Bacteria	598
255	Ga0157373_10261139	3300013100	Bacteria	1225
256	Ga0157370_10284966	3300013104	Bacteria	1526
257	Ga0157374_10335901	3300013296	Bacteria	1499
258	Ga0157378_10058626	3300013297	Bacteria	3434
259	Ga0157378_10077247	3300013297	Bacteria	3001
260	Ga0157378_10462923	3300013297	Bacteria	1260
261	Ga0157378_10733669	3300013297	Unclassified	1009
262	Ga0157378_10828387	3300013297	Bacteria	952
263	Ga0157378_10889051	3300013297	Unclassified	921
264	Ga0163162_10079645	3300013306	Bacteria	3342
265	Ga0163162_10136618	3300013306	Bacteria	2563
266	Ga0163162_10138763	3300013306	Bacteria	2543
267	Ga0163162_10383328	3300013306	Bacteria	1539
268	Ga0163162_10485993	3300013306	Bacteria	1366
269	Ga0163162_10755114	3300013306	Unclassified	1092
270	Ga0163162_10959026	3300013306	Bacteria	966
271	Ga0157375_10011349	3300013308	Bacteria	7865
272	Ga0157375_10059942	3300013308	Unclassified	3772
273	Ga0157375_10095581	3300013308	Bacteria	3043
274	Ga0157375_10258923	3300013308	Bacteria	1901
275	Ga0157375_10938930	3300013308	Bacteria	1007
276	Ga0157375_11291095	3300013308	Bacteria	858
277	Ga0163163_10258100	3300014325	Bacteria	1794
278	Ga0163163_11667917	3300014325	Bacteria	698
279	Ga0157380_10004054	3300014326	Bacteria	10103
280	Ga0157380_10022202	3300014326	Bacteria	4772
281	Ga0157380_10051966	3300014326	Bacteria	3243
282	Ga0157379_10011586	3300014968	Bacteria	7699
283	Ga0157379_10054580	3300014968	Bacteria	3570
284	Ga0157379_12591529	3300014968	Bacteria	508
285	Ga0157376_10008331	3300014969	Bacteria	7477
286	Ga0157376_10423368	3300014969	Bacteria	1293
287	Ga0157376_12465324	3300014969	Unclassified	560
288	Ga0163161_10006306	3300017792	Bacteria	8209
289	Ga0163161_10035259	3300017792	Bacteria	3581
290	Ga0163161_10570978	3300017792	Unclassified	929
291	Ga0209050_1000167	3300025298	Bacteria	151608
292	Ga0209257_1000028	3300025304	Bacteria	699493
293	Ga0207697_10009021	3300025315	Bacteria	4325
294	Ga0207682_10091267	3300025893	Unclassified	1321
295	Ga0207642_10076895	3300025899	Unclassified	1608
296	Ga0207642_10078484	3300025899	Bacteria	1596
297	Ga0207680_10109431	3300025903	Bacteria	1789
298	Ga0207645_10003264	3300025907	Bacteria	12384
299	Ga0207645_10034840	3300025907	Unclassified	3234
300	Ga0207645_10393235	3300025907	Bacteria	932
301	Ga0207645_10472048	3300025907	Unclassified	848
302	Ga0207643_10286385	3300025908	Unclassified	1023
303	Ga0207684_10017423	3300025910	Bacteria	6164
304	Ga0207684_10021090	3300025910	Bacteria	5563
305	Ga0207684_10167907	3300025910	Bacteria	1891
306	Ga0207684_10695832	3300025910	Bacteria	864
307	Ga0207707_10168702	3300025912	Viruses	1913
308	Ga0207707_10428781	3300025912	Bacteria	1133
309	Ga0207663_10990720	3300025916	Unclassified	674
310	Ga0207646_10313203	3300025922	Bacteria	1418
311	Ga0207681_10068221	3300025923	Bacteria	2469
312	Ga0207681_10073563	3300025923	Unclassified	2391
313	Ga0207681_10302740	3300025923	Unclassified	1265
314	Ga0207681_10318176	3300025923	Bacteria	1236
315	Ga0207681_10587562	3300025923	Unclassified	919
316	Ga0207694_11421635	3300025924	Bacteria	586
317	Ga0207650_10017416	3300025925	Bacteria	5031
318	Ga0207650_10050868	3300025925	Bacteria	3065
319	Ga0207650_10104847	3300025925	Unclassified	2182
320	Ga0207650_11674903	3300025925	Bacteria	539
321	Ga0207659_10033396	3300025926	Bacteria	3541
322	Ga0207659_10106170	3300025926	Bacteria	2126
323	Ga0207644_10032806	3300025931	Bacteria	3626
324	Ga0207644_10586437	3300025931	Bacteria	925
325	Ga0207644_10831660	3300025931	Unclassified	773
326	Ga0207644_10950207	3300025931	Unclassified	721
327	Ga0207706_10023418	3300025933	Bacteria	5545
328	Ga0207706_11218227	3300025933	Bacteria	625
329	Ga0207686_10025273	3300025934	Bacteria	3453
330	Ga0207686_10257547	3300025934	Unclassified	1278
331	Ga0207686_10513434	3300025934	Unclassified	932
332	Ga0207686_10611019	3300025934	Unclassified	859
333	Ga0207670_10187882	3300025936	Bacteria	1561
334	Ga0207670_10532814	3300025936	Unclassified	957
335	Ga0207670_10575113	3300025936	Bacteria	923
336	Ga0207669_10032673	3300025937	Bacteria	2926
337	Ga0207669_10032946	3300025937	Bacteria	2917
338	Ga0207669_10042070	3300025937	Bacteria	2664
339	Ga0207669_10077968	3300025937	Bacteria	2109
340	Ga0207704_10009672	3300025938	Bacteria	4665
341	Ga0207704_10027657	3300025938	Bacteria	3133
342	Ga0207704_10478702	3300025938	Unclassified	999
343	Ga0207704_10916200	3300025938	Bacteria	738
344	Ga0207691_10004787	3300025940	Bacteria	13098
345	Ga0207691_10171496	3300025940	Bacteria	1900
346	Ga0207691_10259008	3300025940	Bacteria	1500
347	Ga0207711_10090996	3300025941	Bacteria	2683
348	Ga0207711_10264071	3300025941	Bacteria	1583
349	Ga0207711_10333232	3300025941	Bacteria	1404
350	Ga0207689_10001076	3300025942	Bacteria	26341
351	Ga0207689_10247851	3300025942	Bacteria	1473
352	Ga0207689_10348104	3300025942	Unclassified	1232
353	Ga0207679_10570903	3300025945	Bacteria	1017
354	Ga0207651_10568816	3300025960	Unclassified	987
355	Ga0207651_10993863	3300025960	Unclassified	750
356	Ga0207712_10007597	3300025961	Bacteria	6849
357	Ga0207712_10027013	3300025961	Bacteria	3830
358	Ga0207712_10045927	3300025961	Bacteria	3026
359	Ga0207712_10251416	3300025961	Bacteria	1429
360	Ga0207712_10279388	3300025961	Bacteria	1362
361	Ga0207668_10025102	3300025972	Bacteria	3853
362	Ga0207668_10041302	3300025972	Bacteria	3117
363	Ga0207668_10048168	3300025972	Plasmid	2923
364	Ga0207668_10102552	3300025972	Bacteria	2129
365	Ga0207668_10294243	3300025972	Unclassified	1337
366	Ga0207668_10476740	3300025972	Bacteria	1069
367	Ga0207668_11292464	3300025972	Bacteria	657
368	Ga0207658_10966603	3300025986	Bacteria	776
369	Ga0207658_11493130	3300025986	Unclassified	618
370	Ga0207677_10002898	3300026023	Bacteria	9061
371	Ga0207677_10855201	3300026023	Unclassified	817
372	Ga0207703_10216260	3300026035	Bacteria	1711
373	Ga0207703_10633471	3300026035	Bacteria	1013
374	Ga0207703_11306072	3300026035	Unclassified	698
375	Ga0207703_11910211	3300026035	Bacteria	570
376	Ga0207639_10133612	3300026041	Unclassified	2058
377	Ga0207639_10745080	3300026041	Bacteria	911
378	Ga0207678_10086833	3300026067	Unclassified	2673
379	Ga0207678_10384928	3300026067	Bacteria	1213
380	Ga0207641_10196906	3300026088	Bacteria	1855
381	Ga0207641_10316536	3300026088	Bacteria	1478
382	Ga0207641_10975215	3300026088	Bacteria	844
383	Ga0207648_10005850	3300026089	Bacteria	12309
384	Ga0207648_10008747	3300026089	Bacteria	9757
385	Ga0207648_10173896	3300026089	Bacteria	1904
386	Ga0207648_10878051	3300026089	Unclassified	837
387	Ga0207676_10030521	3300026095	Bacteria	4047
388	Ga0207676_10084240	3300026095	Bacteria	2591
389	Ga0207676_10660420	3300026095	Unclassified	1010
390	Ga0207676_10815952	3300026095	Bacteria	911
391	Ga0207674_10501566	3300026116	Bacteria	1173
392	Ga0207675_100004215	3300026118	Bacteria	13917
393	Ga0207675_100008555	3300026118	Bacteria	9627
394	Ga0207675_100207377	3300026118	Unclassified	1884
395	Ga0207675_101530487	3300026118	Bacteria	688
396	Ga0207683_10003100	3300026121	Bacteria	14523
397	Ga0207683_10003519	3300026121	Bacteria	13657
398	Ga0207683_10525240	3300026121	Bacteria	1094
399	Ga0207683_10801574	3300026121	Unclassified	874
400	Ga0207683_11849018	3300026121	Unclassified	553
401	Ga0207698_10268273	3300026142	Bacteria	1572
402	Ga0209588_1056996	3300027671	Unclassified	1263
403	Ga0209588_1058489	3300027671	Unclassified	1246
404	Ga0207428_10672126	3300027907	Unclassified	742
405	Ga0268266_10011035	3300028379	Bacteria	7865
406	Ga0268265_10002070	3300028380	Bacteria	15663
407	Ga0268265_10040132	3300028380	Bacteria	3455
408	Ga0268265_10170338	3300028380	Unclassified	1860
409	Ga0268265_10307882	3300028380	Bacteria	1429
410	Ga0268265_10633913	3300028380	Bacteria	1025
411	Ga0268265_12270495	3300028380	Unclassified	549
412	Ga0268264_10013841	3300028381	Bacteria	6634
413	Ga0268264_10101106	3300028381	Unclassified	2505
414	Ga0268264_10126592	3300028381	Bacteria	2258
415	Ga0268264_10744165	3300028381	Bacteria	976
416	Ga0307509_10919094	3300031507	Unclassified	540
417	Ga0307408_100012098	3300031548	Bacteria	5714
418	Ga0307405_10024393	3300031731	Bacteria	3454
419	Ga0307413_10009762	3300031824	Bacteria	4612
420	Ga0307410_10003737	3300031852	Bacteria	7710
421	Ga0307406_10099829	3300031901	Bacteria	1974
422	Ga0307407_10021329	3300031903	Bacteria	3338
423	Ga0307412_10178553	3300031911	Bacteria	1594
424	Ga0307409_100058639	3300031995	Unclassified	2991
425	Ga0307416_100003188	3300032002	Bacteria	9606
426	Ga0307411_10054845	3300032005	Unclassified	2619
427	Ga0307415_100016110	3300032126	Bacteria	4446
428	Ga0373930_0101655	3300034816	Bacteria	684
429	Ga0373923_0222302	3300035111	Bacteria	878
430	Ga0373936_0183413	3300035113	Unclassified	919
431	Ga0373945_0199717	3300035116	Unclassified	830
432	Ga0373927_0369351	3300035695	Unclassified	946
433	Ga0373947_0313517	3300035725	Unclassified	1048
434	Ga0373937_1490180	3300036401	Unclassified	624
435	Ga0373925_0218088	3300037068	Unclassified	1522
436	Ga0439433_0070393	3300041999	Unclassified	842
437	Ga0451577_0521621	3300042876	Bacteria	1079
438	Ga0451576_0164833	3300045051	Bacteria	2313
439	Ga0495580_0610354	3300046472	Unclassified	720
440	Ga0495606_0120913	3300046507	Bacteria	1568
441	Ga0495666_0269508	3300046526	Unclassified	773
442	Ga0495640_0473895	3300046533	Unclassified	763
443	Ga0495598_0411684	3300046537	Bacteria	530
444	Ga0495611_0254826	3300046648	Bacteria	813
445	Ga0495625_0062205	3300046660	Bacteria	2639
446	Ga0495670_0383994	3300046691	Bacteria	758
447	Ga0495649_0003558	3300046694	Bacteria	10464
448	Ga0496104_0093874	3300048907	Bacteria	2870
449	Ga0496104_1063882	3300048907	Bacteria	713
450	Ga0496105_0045169	3300048908	Bacteria	3635
451	Ga0496105_0161780	3300048908	Bacteria	1838
452	Ga0496108_0265975	3300048911	Bacteria	1492
453	Ga0496109_0066980	3300048912	Bacteria	3289
454	Ga0496109_1371783	3300048912	Unclassified	642
455	Ga0496110_0026995	3300048913	Bacteria	4919
456	Ga0496112_0063052	3300048915	Bacteria	3656
457	Ga0496113_0022145	3300048916	Bacteria	4490
458	nmdc:mga0k408_169410_c1	3300050493	Unclassified	1302
459	nmdc:mga0k408_439540_c1	3300050493	Bacteria	775
460	nmdc:mga06z11_905492_c1	3300050494	Unclassified	537
461	nmdc:mga05p37_74718_c1	3300050507	Bacteria	4171
462	nmdc:mga09592_1117594_c1	3300050508	Bacteria	654
463	nmdc:mga09592_216364_c1	3300050508	Bacteria	1660
464	nmdc:mga0qj67_372790_c1	3300050509	Unclassified	1153
465	nmdc:mga06r32_158548_c1	3300050510	Bacteria	2245
466	nmdc:mga06r32_493987_c1	3300050510	Unclassified	1201
467	nmdc:mga08y16_221400_c1	3300050511	Bacteria	1959
468	nmdc:mga08y16_274565_c1	3300050511	Bacteria	1739
469	nmdc:mga08y16_412339_c1	3300050511	Bacteria	1381
470	nmdc:mga08y16_474301_c1	3300050511	Unclassified	1274
471	nmdc:mga0n895_1329310_c1	3300050512	Unclassified	689
472	nmdc:mga0n895_174501_c1	3300050512	Unclassified	2181
473	nmdc:mga0n895_350420_c1	3300050512	Bacteria	1495
474	nmdc:mga0n895_558063_c1	3300050512	Bacteria	1150
475	nmdc:mga0rr50_1271619_c1	3300050513	Unclassified	624
476	nmdc:mga0rr50_1277375_c1	3300050513	Unclassified	623
477	nmdc:mga0rr50_1388819_c1	3300050513	Bacteria	595
478	nmdc:mga08x19_124340_c1	3300050514	Unclassified	1731
479	nmdc:mga0a205_272097_c1	3300050515	Bacteria	1571
480	nmdc:mga0a205_706771_c1	3300050515	Bacteria	858
481	Ga0500643_050129	3300053087	Bacteria	1196
482	Ga0500616_0027567	3300053153	Bacteria	3135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300042876	Ga0451577_0521621	Ga0451577_0521621_384_764	114
2	3300025924	Ga0207694_11421635	Ga0207694_114216351	121
3	3300050512	nmdc:mga0n895_174501_c1	nmdc:mga0n895_174501_c1_1779_2144	121
4	3300005445	Ga0070708_101933309	Ga0070708_1019333091	123
5	3300005467	Ga0070706_100002625	Ga0070706_1000026255	123
6	3300005545	Ga0070695_100440718	Ga0070695_1004407182	126
7	3300031548	Ga0307408_100012098	Ga0307408_1000120982	128
8	3300031731	Ga0307405_10024393	Ga0307405_100243933	128
9	3300031824	Ga0307413_10009762	Ga0307413_100097625	128
10	3300031852	Ga0307410_10003737	Ga0307410_100037376	128
11	3300031901	Ga0307406_10099829	Ga0307406_100998292	128
12	3300031903	Ga0307407_10021329	Ga0307407_100213293	128
13	3300031911	Ga0307412_10178553	Ga0307412_101785532	128
14	3300031995	Ga0307409_100058639	Ga0307409_1000586393	128
15	3300032002	Ga0307416_100003188	Ga0307416_1000031883	128
16	3300032005	Ga0307411_10054845	Ga0307411_100548453	128
17	3300032126	Ga0307415_100016110	Ga0307415_1000161104	128
18	3300050494	nmdc:mga06z11_905492_c1	nmdc:mga06z11_905492_c1_80_466	128
19	3300005445	Ga0070708_101110094	Ga0070708_1011100942	129
20	3300005536	Ga0070697_100039089	Ga0070697_1000390893	129
21	3300013100	Ga0157373_10261139	Ga0157373_102611392	129
22	3300025910	Ga0207684_10167907	Ga0207684_101679072	129
23	3300009094	Ga0111539_11566679	Ga0111539_115666792	130
24	3300050511	nmdc:mga08y16_412339_c1	nmdc:mga08y16_412339_c1_339_731	130
25	3300005335	Ga0070666_10970679	Ga0070666_109706791	131
26	3300005356	Ga0070674_100011551	Ga0070674_1000115518	131
27	3300005356	Ga0070674_101266211	Ga0070674_1012662111	131
28	3300005456	Ga0070678_100780618	Ga0070678_1007806181	131
29	3300005456	Ga0070678_100832831	Ga0070678_1008328311	131
30	3300005457	Ga0070662_100382742	Ga0070662_1003827422	131
31	3300005459	Ga0068867_100453234	Ga0068867_1004532343	131
32	3300005544	Ga0070686_101445835	Ga0070686_1014458351	131
33	3300006358	Ga0068871_100465360	Ga0068871_1004653602	131
34	3300006358	Ga0068871_101007045	Ga0068871_1010070452	131
35	3300006871	Ga0075434_100483442	Ga0075434_1004834422	131
36	3300006881	Ga0068865_100829218	Ga0068865_1008292182	131
37	3300009176	Ga0105242_10722827	Ga0105242_107228272	131
38	3300013306	Ga0163162_10755114	Ga0163162_107551143	131
39	3300013308	Ga0157375_10938930	Ga0157375_109389303	131
40	3300014326	Ga0157380_10004054	Ga0157380_1000405411	131
41	3300014968	Ga0157379_12591529	Ga0157379_125915291	131
42	3300017792	Ga0163161_10006306	Ga0163161_100063067	131
43	3300025933	Ga0207706_11218227	Ga0207706_112182271	131
44	3300025934	Ga0207686_10025273	Ga0207686_100252737	131
45	3300025937	Ga0207669_10032946	Ga0207669_100329464	131
46	3300025938	Ga0207704_10478702	Ga0207704_104787022	131
47	3300025972	Ga0207668_10294243	Ga0207668_102942433	131
48	3300026089	Ga0207648_10008747	Ga0207648_1000874715	131
49	3300026121	Ga0207683_10003519	Ga0207683_1000351916	131
50	3300028381	Ga0268264_10126592	Ga0268264_101265924	131
51	3300046537	Ga0495598_0411684	Ga0495598_0411684_116_511	131
52	3300007265	Ga0099794_10020111	Ga0099794_100201112	132
53	3300027671	Ga0209588_1056996	Ga0209588_10569961	132
54	3300046472	Ga0495580_0610354	Ga0495580_0610354_110_508	132
55	3300006914	Ga0075436_100112634	Ga0075436_1001126342	133
56	3300007076	Ga0075435_100911345	Ga0075435_1009113452	133
57	3300035111	Ga0373923_0222302	Ga0373923_0222302_370_771	133
58	3300050513	nmdc:mga0rr50_1277375_c1	nmdc:mga0rr50_1277375_c1_180_581	133
59	3300050514	nmdc:mga08x19_124340_c1	nmdc:mga08x19_124340_c1_836_1237	133
60	3300003659	JGI25404J52841_10014769	JGI25404J52841_100147692	134
61	3300003659	JGI25404J52841_10022844	JGI25404J52841_100228442	134
62	3300003791	Ga0055530_10000269	Ga0055530_1000026932	134
63	3300003794	Ga0055531_10000318	Ga0055531_1000031832	134
64	3300005347	Ga0070668_100042037	Ga0070668_1000420372	134
65	3300005353	Ga0070669_100099565	Ga0070669_1000995652	134
66	3300005367	Ga0070667_100453255	Ga0070667_1004532552	134
67	3300005436	Ga0070713_100038093	Ga0070713_1000380931	134
68	3300005455	Ga0070663_101123508	Ga0070663_1011235081	134
69	3300005467	Ga0070706_100406856	Ga0070706_1004068562	134
70	3300005468	Ga0070707_100118928	Ga0070707_1001189284	134
71	3300005615	Ga0070702_100018553	Ga0070702_1000185532	134
72	3300005841	Ga0068863_101476340	Ga0068863_1014763402	134
73	3300005842	Ga0068858_102016489	Ga0068858_1020164891	134
74	3300005937	Ga0081455_10008277	Ga0081455_100082774	134
75	3300005937	Ga0081455_10017249	Ga0081455_100172498	134
76	3300005937	Ga0081455_11042588	Ga0081455_110425881	134
77	3300005983	Ga0081540_1016618	Ga0081540_10166183	134
78	3300005983	Ga0081540_1054182	Ga0081540_10541822	134
79	3300005983	Ga0081540_1280329	Ga0081540_12803292	134
80	3300005985	Ga0081539_10079500	Ga0081539_100795002	134
81	3300006028	Ga0070717_10010594	Ga0070717_100105946	134
82	3300006163	Ga0070715_10879534	Ga0070715_108795342	134
83	3300006871	Ga0075434_101400518	Ga0075434_1014005182	134
84	3300009176	Ga0105242_10236641	Ga0105242_102366412	134
85	3300013297	Ga0157378_10828387	Ga0157378_108283872	134
86	3300014325	Ga0163163_11667917	Ga0163163_116679172	134
87	3300025298	Ga0209050_1000167	Ga0209050_1000167148	134
88	3300025304	Ga0209257_1000028	Ga0209257_1000028588	134
89	3300025910	Ga0207684_10695832	Ga0207684_106958322	134
90	3300025922	Ga0207646_10313203	Ga0207646_103132032	134
91	3300025923	Ga0207681_10068221	Ga0207681_100682212	134
92	3300025972	Ga0207668_10102552	Ga0207668_101025522	134
93	3300026035	Ga0207703_11910211	Ga0207703_119102111	134
94	3300026088	Ga0207641_10975215	Ga0207641_109752152	134
95	3300046507	Ga0495606_0120913	Ga0495606_0120913_1125_1535	134
96	3300046648	Ga0495611_0254826	Ga0495611_0254826_396_800	134
97	3300048908	Ga0496105_0161780	Ga0496105_0161780_1386_1790	134
98	3300050512	nmdc:mga0n895_350420_c1	nmdc:mga0n895_350420_c1_434_844	134
99	3300005290	Ga0065712_10000283	Ga0065712_1000028318	135
100	3300005293	Ga0065715_10001222	Ga0065715_100012227	135
101	3300005295	Ga0065707_10465946	Ga0065707_104659462	135
102	3300005330	Ga0070690_100142665	Ga0070690_1001426652	135
103	3300005331	Ga0070670_100007490	Ga0070670_1000074906	135
104	3300005340	Ga0070689_100351419	Ga0070689_1003514191	135
105	3300005340	Ga0070689_100497931	Ga0070689_1004979312	135
106	3300005347	Ga0070668_100076667	Ga0070668_1000766674	135
107	3300005347	Ga0070668_100141824	Ga0070668_1001418241	135
108	3300005354	Ga0070675_100083172	Ga0070675_1000831723	135
109	3300005355	Ga0070671_100508711	Ga0070671_1005087112	135
110	3300005355	Ga0070671_100613818	Ga0070671_1006138181	135
111	3300005365	Ga0070688_100004728	Ga0070688_1000047281	135
112	3300005440	Ga0070705_100055853	Ga0070705_1000558531	135
113	3300005456	Ga0070678_100031098	Ga0070678_1000310983	135
114	3300005466	Ga0070685_10006073	Ga0070685_100060734	135
115	3300005471	Ga0070698_100552076	Ga0070698_1005520761	135
116	3300005535	Ga0070684_100990396	Ga0070684_1009903961	135
117	3300005543	Ga0070672_102027988	Ga0070672_1020279881	135
118	3300005544	Ga0070686_100078029	Ga0070686_1000780292	135
119	3300005548	Ga0070665_100018030	Ga0070665_1000180307	135
120	3300005549	Ga0070704_100179224	Ga0070704_1001792242	135
121	3300005549	Ga0070704_100861818	Ga0070704_1008618181	135
122	3300005577	Ga0068857_100053834	Ga0068857_1000538343	135
123	3300005615	Ga0070702_100323723	Ga0070702_1003237232	135
124	3300005616	Ga0068852_100301350	Ga0068852_1003013502	135
125	3300005617	Ga0068859_100013259	Ga0068859_1000132594	135
126	3300005617	Ga0068859_100873621	Ga0068859_1008736211	135
127	3300005618	Ga0068864_100008516	Ga0068864_1000085165	135
128	3300005618	Ga0068864_100283313	Ga0068864_1002833132	135
129	3300005718	Ga0068866_10042128	Ga0068866_100421283	135
130	3300005840	Ga0068870_11210328	Ga0068870_112103281	135
131	3300005841	Ga0068863_100020968	Ga0068863_1000209686	135
132	3300005844	Ga0068862_100034527	Ga0068862_1000345272	135
133	3300006195	Ga0075366_10012425	Ga0075366_100124257	135
134	3300006195	Ga0075366_10081712	Ga0075366_100817122	135
135	3300006844	Ga0075428_100007676	Ga0075428_1000076762	135
136	3300006846	Ga0075430_100342015	Ga0075430_1003420152	135
137	3300006847	Ga0075431_100442059	Ga0075431_1004420592	135
138	3300006852	Ga0075433_10207148	Ga0075433_102071484	135
139	3300006852	Ga0075433_10321679	Ga0075433_103216792	135
140	3300006871	Ga0075434_100028050	Ga0075434_1000280507	135
141	3300006871	Ga0075434_101296454	Ga0075434_1012964541	135
142	3300006880	Ga0075429_100021750	Ga0075429_1000217505	135
143	3300006881	Ga0068865_100134830	Ga0068865_1001348303	135
144	3300006931	Ga0097620_100013259	Ga0097620_1000132594	135
145	3300006931	Ga0097620_100873656	Ga0097620_1008736561	135
146	3300007265	Ga0099794_10030230	Ga0099794_100302304	135
147	3300009094	Ga0111539_10564540	Ga0111539_105645402	135
148	3300009098	Ga0105245_10616202	Ga0105245_106162022	135
149	3300009098	Ga0105245_12635109	Ga0105245_126351091	135
150	3300009147	Ga0114129_10016686	Ga0114129_1001668610	135
151	3300009176	Ga0105242_10242396	Ga0105242_102423962	135
152	3300009177	Ga0105248_10311677	Ga0105248_103116772	135
153	3300009177	Ga0105248_10460519	Ga0105248_104605192	135
154	3300009553	Ga0105249_10066816	Ga0105249_100668164	135
155	3300009553	Ga0105249_10942024	Ga0105249_109420242	135
156	3300010375	Ga0105239_10688953	Ga0105239_106889533	135
157	3300011119	Ga0105246_10241211	Ga0105246_102412112	135
158	3300013296	Ga0157374_10335901	Ga0157374_103359013	135
159	3300013297	Ga0157378_10889051	Ga0157378_108890512	135
160	3300013306	Ga0163162_10136618	Ga0163162_101366182	135
161	3300014325	Ga0163163_10258100	Ga0163163_102581003	135
162	3300025899	Ga0207642_10078484	Ga0207642_100784842	135
163	3300025907	Ga0207645_10393235	Ga0207645_103932352	135
164	3300025908	Ga0207643_10286385	Ga0207643_102863851	135
165	3300025925	Ga0207650_10017416	Ga0207650_100174161	135
166	3300025926	Ga0207659_10106170	Ga0207659_101061701	135
167	3300025931	Ga0207644_10586437	Ga0207644_105864371	135
168	3300025931	Ga0207644_10950207	Ga0207644_109502071	135
169	3300025934	Ga0207686_10257547	Ga0207686_102575472	135
170	3300025936	Ga0207670_10187882	Ga0207670_101878822	135
171	3300025936	Ga0207670_10575113	Ga0207670_105751132	135
172	3300025940	Ga0207691_10259008	Ga0207691_102590082	135
173	3300025941	Ga0207711_10333232	Ga0207711_103332322	135
174	3300025945	Ga0207679_10570903	Ga0207679_105709032	135
175	3300025961	Ga0207712_10045927	Ga0207712_100459272	135
176	3300025972	Ga0207668_10041302	Ga0207668_100413025	135
177	3300026023	Ga0207677_10855201	Ga0207677_108552012	135
178	3300026035	Ga0207703_10633471	Ga0207703_106334712	135
179	3300026088	Ga0207641_10196906	Ga0207641_101969062	135
180	3300026089	Ga0207648_10878051	Ga0207648_108780512	135
181	3300026095	Ga0207676_10030521	Ga0207676_100305212	135
182	3300026095	Ga0207676_10815952	Ga0207676_108159522	135
183	3300026142	Ga0207698_10268273	Ga0207698_102682732	135
184	3300027671	Ga0209588_1058489	Ga0209588_10584892	135
185	3300027907	Ga0207428_10672126	Ga0207428_106721261	135
186	3300028380	Ga0268265_12270495	Ga0268265_122704951	135
187	3300036401	Ga0373937_1490180	Ga0373937_1490180_150_557	135
188	3300046533	Ga0495640_0473895	Ga0495640_0473895_58_465	135
189	3300048907	Ga0496104_0093874	Ga0496104_0093874_2415_2822	135
190	3300048908	Ga0496105_0045169	Ga0496105_0045169_2432_2839	135
191	3300048911	Ga0496108_0265975	Ga0496108_0265975_235_642	135
192	3300048912	Ga0496109_1371783	Ga0496109_1371783_34_441	135
193	3300048913	Ga0496110_0026995	Ga0496110_0026995_4313_4720	135
194	3300048915	Ga0496112_0063052	Ga0496112_0063052_186_593	135
195	3300048916	Ga0496113_0022145	Ga0496113_0022145_2211_2618	135
196	3300050493	nmdc:mga0k408_169410_c1	nmdc:mga0k408_169410_c1_713_1120	135
197	3300050493	nmdc:mga0k408_439540_c1	nmdc:mga0k408_439540_c1_287_694	135
198	3300050507	nmdc:mga05p37_74718_c1	nmdc:mga05p37_74718_c1_2442_2849	135
199	3300050508	nmdc:mga09592_216364_c1	nmdc:mga09592_216364_c1_329_736	135
200	3300050509	nmdc:mga0qj67_372790_c1	nmdc:mga0qj67_372790_c1_171_578	135
201	3300050510	nmdc:mga06r32_493987_c1	nmdc:mga06r32_493987_c1_749_1156	135
202	3300050511	nmdc:mga08y16_474301_c1	nmdc:mga08y16_474301_c1_322_729	135
203	3300050513	nmdc:mga0rr50_1388819_c1	nmdc:mga0rr50_1388819_c1_27_434	135
204	3300050515	nmdc:mga0a205_272097_c1	nmdc:mga0a205_272097_c1_1003_1410	135
205	3300050515	nmdc:mga0a205_706771_c1	nmdc:mga0a205_706771_c1_184_591	135
206	3300005290	Ga0065712_10413181	Ga0065712_104131812	136
207	3300005295	Ga0065707_10188066	Ga0065707_101880662	136
208	3300005328	Ga0070676_10026458	Ga0070676_100264582	136
209	3300005328	Ga0070676_10339018	Ga0070676_103390181	136
210	3300005331	Ga0070670_101422416	Ga0070670_1014224162	136
211	3300005333	Ga0070677_10472004	Ga0070677_104720041	136
212	3300005334	Ga0068869_100213593	Ga0068869_1002135932	136
213	3300005334	Ga0068869_100419963	Ga0068869_1004199632	136
214	3300005336	Ga0070680_100400275	Ga0070680_1004002752	136
215	3300005340	Ga0070689_101007719	Ga0070689_1010077191	136
216	3300005347	Ga0070668_100018849	Ga0070668_10001884910	136
217	3300005347	Ga0070668_100052322	Ga0070668_1000523226	136
218	3300005347	Ga0070668_100535599	Ga0070668_1005355992	136
219	3300005353	Ga0070669_100029530	Ga0070669_1000295306	136
220	3300005356	Ga0070674_100063493	Ga0070674_1000634932	136
221	3300005356	Ga0070674_100148149	Ga0070674_1001481492	136
222	3300005364	Ga0070673_101488692	Ga0070673_1014886921	136
223	3300005365	Ga0070688_100845741	Ga0070688_1008457412	136
224	3300005367	Ga0070667_100625112	Ga0070667_1006251122	136
225	3300005367	Ga0070667_100829265	Ga0070667_1008292651	136
226	3300005444	Ga0070694_100220789	Ga0070694_1002207893	136
227	3300005444	Ga0070694_100920240	Ga0070694_1009202402	136
228	3300005455	Ga0070663_100089968	Ga0070663_1000899683	136
229	3300005456	Ga0070678_100209785	Ga0070678_1002097851	136
230	3300005456	Ga0070678_100927086	Ga0070678_1009270862	136
231	3300005458	Ga0070681_10008591	Ga0070681_100085916	136
232	3300005458	Ga0070681_10199014	Ga0070681_101990141	136
233	3300005458	Ga0070681_11258588	Ga0070681_112585882	136
234	3300005459	Ga0068867_100009095	Ga0068867_1000090953	136
235	3300005459	Ga0068867_100132492	Ga0068867_1001324922	136
236	3300005459	Ga0068867_101109747	Ga0068867_1011097471	136
237	3300005467	Ga0070706_100034974	Ga0070706_1000349743	136
238	3300005467	Ga0070706_101026159	Ga0070706_1010261591	136
239	3300005468	Ga0070707_100007570	Ga0070707_1000075706	136
240	3300005468	Ga0070707_100606292	Ga0070707_1006062921	136
241	3300005518	Ga0070699_100359197	Ga0070699_1003591972	136
242	3300005518	Ga0070699_101034643	Ga0070699_1010346432	136
243	3300005530	Ga0070679_100092039	Ga0070679_1000920394	136
244	3300005530	Ga0070679_100431042	Ga0070679_1004310423	136
245	3300005530	Ga0070679_101466581	Ga0070679_1014665811	136
246	3300005536	Ga0070697_100104520	Ga0070697_1001045204	136
247	3300005539	Ga0068853_100485147	Ga0068853_1004851471	136
248	3300005539	Ga0068853_100672446	Ga0068853_1006724462	136
249	3300005543	Ga0070672_100257358	Ga0070672_1002573582	136
250	3300005544	Ga0070686_100625571	Ga0070686_1006255711	136
251	3300005545	Ga0070695_100280855	Ga0070695_1002808552	136
252	3300005546	Ga0070696_100144943	Ga0070696_1001449432	136
253	3300005547	Ga0070693_100561797	Ga0070693_1005617972	136
254	3300005549	Ga0070704_100266902	Ga0070704_1002669022	136
255	3300005549	Ga0070704_100274475	Ga0070704_1002744751	136
256	3300005577	Ga0068857_100444116	Ga0068857_1004441164	136
257	3300005616	Ga0068852_101276109	Ga0068852_1012761091	136
258	3300005617	Ga0068859_100177358	Ga0068859_1001773582	136
259	3300005718	Ga0068866_10047415	Ga0068866_100474152	136
260	3300005718	Ga0068866_10669891	Ga0068866_106698912	136
261	3300005719	Ga0068861_100002910	Ga0068861_10000291011	136
262	3300005719	Ga0068861_100021014	Ga0068861_1000210147	136
263	3300005843	Ga0068860_100010249	Ga0068860_1000102497	136
264	3300005843	Ga0068860_100023966	Ga0068860_1000239662	136
265	3300005844	Ga0068862_100001483	Ga0068862_10000148316	136
266	3300005844	Ga0068862_100049336	Ga0068862_1000493363	136
267	3300005844	Ga0068862_100082369	Ga0068862_1000823693	136
268	3300005844	Ga0068862_100084870	Ga0068862_1000848704	136
269	3300005844	Ga0068862_100128906	Ga0068862_1001289064	136
270	3300005844	Ga0068862_101845453	Ga0068862_1018454532	136
271	3300005937	Ga0081455_10061039	Ga0081455_100610394	136
272	3300005937	Ga0081455_10496852	Ga0081455_104968522	136
273	3300005937	Ga0081455_10519092	Ga0081455_105190922	136
274	3300006195	Ga0075366_10247521	Ga0075366_102475211	136
275	3300006237	Ga0097621_100070614	Ga0097621_1000706144	136
276	3300006237	Ga0097621_100636892	Ga0097621_1006368922	136
277	3300006358	Ga0068871_100037570	Ga0068871_1000375703	136
278	3300006358	Ga0068871_100159871	Ga0068871_1001598711	136
279	3300006844	Ga0075428_101303677	Ga0075428_1013036771	136
280	3300006847	Ga0075431_100249240	Ga0075431_1002492404	136
281	3300006871	Ga0075434_100069458	Ga0075434_1000694582	136
282	3300006871	Ga0075434_100071390	Ga0075434_1000713905	136
283	3300006871	Ga0075434_100336897	Ga0075434_1003368971	136
284	3300006880	Ga0075429_101713321	Ga0075429_1017133211	136
285	3300006881	Ga0068865_100004332	Ga0068865_10000433214	136
286	3300006881	Ga0068865_100180961	Ga0068865_1001809614	136
287	3300006881	Ga0068865_100444887	Ga0068865_1004448873	136
288	3300006931	Ga0097620_100177353	Ga0097620_1001773532	136
289	3300007076	Ga0075435_100254992	Ga0075435_1002549922	136
290	3300007076	Ga0075435_100270227	Ga0075435_1002702272	136
291	3300007788	Ga0099795_10074407	Ga0099795_100744071	136
292	3300009094	Ga0111539_10021534	Ga0111539_100215348	136
293	3300009094	Ga0111539_10197219	Ga0111539_101972191	136
294	3300009094	Ga0111539_10418335	Ga0111539_104183352	136
295	3300009094	Ga0111539_10549818	Ga0111539_105498182	136
296	3300009147	Ga0114129_10204794	Ga0114129_102047943	136
297	3300009147	Ga0114129_11122622	Ga0114129_111226222	136
298	3300009148	Ga0105243_10675939	Ga0105243_106759391	136
299	3300009174	Ga0105241_10070611	Ga0105241_100706112	136
300	3300009176	Ga0105242_10360323	Ga0105242_103603231	136
301	3300009177	Ga0105248_10069465	Ga0105248_100694656	136
302	3300009551	Ga0105238_11322294	Ga0105238_113222941	136
303	3300009553	Ga0105249_10007914	Ga0105249_100079142	136
304	3300009553	Ga0105249_10017269	Ga0105249_100172692	136
305	3300009553	Ga0105249_10104541	Ga0105249_101045415	136
306	3300010159	Ga0099796_10014297	Ga0099796_100142972	136
307	3300011119	Ga0105246_11711400	Ga0105246_117114001	136
308	3300013104	Ga0157370_10284966	Ga0157370_102849662	136
309	3300013297	Ga0157378_10077247	Ga0157378_100772472	136
310	3300013297	Ga0157378_10462923	Ga0157378_104629232	136
311	3300013306	Ga0163162_10138763	Ga0163162_101387634	136
312	3300013306	Ga0163162_10383328	Ga0163162_103833283	136
313	3300013306	Ga0163162_10485993	Ga0163162_104859934	136
314	3300013306	Ga0163162_10959026	Ga0163162_109590261	136
315	3300013308	Ga0157375_10059942	Ga0157375_100599422	136
316	3300013308	Ga0157375_10095581	Ga0157375_100955814	136
317	3300013308	Ga0157375_10258923	Ga0157375_102589233	136
318	3300013308	Ga0157375_11291095	Ga0157375_112910952	136
319	3300014326	Ga0157380_10022202	Ga0157380_100222022	136
320	3300014326	Ga0157380_10051966	Ga0157380_100519663	136
321	3300014968	Ga0157379_10054580	Ga0157379_100545802	136
322	3300014969	Ga0157376_10423368	Ga0157376_104233682	136
323	3300014969	Ga0157376_12465324	Ga0157376_124653242	136
324	3300017792	Ga0163161_10035259	Ga0163161_100352596	136
325	3300017792	Ga0163161_10570978	Ga0163161_105709781	136
326	3300025899	Ga0207642_10076895	Ga0207642_100768952	136
327	3300025907	Ga0207645_10034840	Ga0207645_100348404	136
328	3300025907	Ga0207645_10472048	Ga0207645_104720481	136
329	3300025910	Ga0207684_10017423	Ga0207684_100174235	136
330	3300025910	Ga0207684_10021090	Ga0207684_100210903	136
331	3300025912	Ga0207707_10168702	Ga0207707_101687024	136
332	3300025912	Ga0207707_10428781	Ga0207707_104287812	136
333	3300025916	Ga0207663_10990720	Ga0207663_109907201	136
334	3300025923	Ga0207681_10073563	Ga0207681_100735632	136
335	3300025923	Ga0207681_10318176	Ga0207681_103181762	136
336	3300025923	Ga0207681_10587562	Ga0207681_105875622	136
337	3300025925	Ga0207650_11674903	Ga0207650_116749031	136
338	3300025933	Ga0207706_10023418	Ga0207706_100234185	136
339	3300025934	Ga0207686_10513434	Ga0207686_105134342	136
340	3300025936	Ga0207670_10532814	Ga0207670_105328141	136
341	3300025937	Ga0207669_10042070	Ga0207669_100420702	136
342	3300025937	Ga0207669_10077968	Ga0207669_100779682	136
343	3300025938	Ga0207704_10027657	Ga0207704_100276572	136
344	3300025938	Ga0207704_10916200	Ga0207704_109162002	136
345	3300025940	Ga0207691_10171496	Ga0207691_101714962	136
346	3300025941	Ga0207711_10264071	Ga0207711_102640712	136
347	3300025942	Ga0207689_10247851	Ga0207689_102478512	136
348	3300025942	Ga0207689_10348104	Ga0207689_103481042	136
349	3300025961	Ga0207712_10007597	Ga0207712_100075973	136
350	3300025961	Ga0207712_10027013	Ga0207712_100270136	136
351	3300025961	Ga0207712_10251416	Ga0207712_102514163	136
352	3300025972	Ga0207668_10025102	Ga0207668_100251028	136
353	3300025972	Ga0207668_10048168	Ga0207668_100481684	136
354	3300025972	Ga0207668_10476740	Ga0207668_104767402	136
355	3300025972	Ga0207668_11292464	Ga0207668_112924642	136
356	3300025986	Ga0207658_11493130	Ga0207658_114931301	136
357	3300026035	Ga0207703_11306072	Ga0207703_113060721	136
358	3300026041	Ga0207639_10745080	Ga0207639_107450801	136
359	3300026067	Ga0207678_10086833	Ga0207678_100868334	136
360	3300026089	Ga0207648_10173896	Ga0207648_101738962	136
361	3300026116	Ga0207674_10501566	Ga0207674_105015661	136
362	3300026118	Ga0207675_100004215	Ga0207675_10000421515	136
363	3300026118	Ga0207675_100008555	Ga0207675_1000085552	136
364	3300026118	Ga0207675_101530487	Ga0207675_1015304871	136
365	3300026121	Ga0207683_10525240	Ga0207683_105252402	136
366	3300026121	Ga0207683_10801574	Ga0207683_108015742	136
367	3300028380	Ga0268265_10002070	Ga0268265_1000207014	136
368	3300028380	Ga0268265_10040132	Ga0268265_100401325	136
369	3300028380	Ga0268265_10170338	Ga0268265_101703382	136
370	3300028380	Ga0268265_10307882	Ga0268265_103078822	136
371	3300028380	Ga0268265_10633913	Ga0268265_106339132	136
372	3300028381	Ga0268264_10013841	Ga0268264_100138419	136
373	3300028381	Ga0268264_10101106	Ga0268264_101011062	136
374	3300031507	Ga0307509_10919094	Ga0307509_109190941	136
375	3300034816	Ga0373930_0101655	Ga0373930_0101655_208_618	136
376	3300041999	Ga0439433_0070393	Ga0439433_0070393_333_746	136
377	3300045051	Ga0451576_0164833	Ga0451576_0164833_474_884	136
378	3300046526	Ga0495666_0269508	Ga0495666_0269508_224_634	136
379	3300046660	Ga0495625_0062205	Ga0495625_0062205_1398_1808	136
380	3300046694	Ga0495649_0003558	Ga0495649_0003558_378_788	136
381	3300050508	nmdc:mga09592_1117594_c1	nmdc:mga09592_1117594_c1_117_527	136
382	3300050510	nmdc:mga06r32_158548_c1	nmdc:mga06r32_158548_c1_1116_1538	136
383	3300050511	nmdc:mga08y16_221400_c1	nmdc:mga08y16_221400_c1_1022_1444	136
384	3300050511	nmdc:mga08y16_274565_c1	nmdc:mga08y16_274565_c1_1277_1687	136
385	3300050512	nmdc:mga0n895_1329310_c1	nmdc:mga0n895_1329310_c1_247_657	136
386	3300050512	nmdc:mga0n895_558063_c1	nmdc:mga0n895_558063_c1_553_963	136
387	3300050513	nmdc:mga0rr50_1271619_c1	nmdc:mga0rr50_1271619_c1_198_608	136
388	3300053087	Ga0500643_050129	Ga0500643_050129_476_889	136
389	3300053153	Ga0500616_0027567	Ga0500616_0027567_1229_1639	136
390	3300005456	Ga0070678_102109980	Ga0070678_1021099801	137
391	3300026121	Ga0207683_11849018	Ga0207683_118490181	137
392	2162886012	MBSR1b_contig_4975126	MBSR1b_0058.00007800	138
393	2162886012	MBSR1b_contig_8389571	MBSR1b_0774.00002670	138
394	3300003203	JGI25406J46586_10073926	JGI25406J46586_100739263	138
395	3300005293	Ga0065715_10005275	Ga0065715_100052752	138
396	3300005328	Ga0070676_10051466	Ga0070676_100514662	138
397	3300005331	Ga0070670_100010528	Ga0070670_1000105287	138
398	3300005331	Ga0070670_100228835	Ga0070670_1002288352	138
399	3300005333	Ga0070677_10063272	Ga0070677_100632723	138
400	3300005334	Ga0068869_100032774	Ga0068869_1000327745	138
401	3300005335	Ga0070666_10002437	Ga0070666_1000243716	138
402	3300005338	Ga0068868_100002248	Ga0068868_10000224818	138
403	3300005347	Ga0070668_100113093	Ga0070668_1001130934	138
404	3300005353	Ga0070669_100001610	Ga0070669_10000161022	138
405	3300005354	Ga0070675_100020613	Ga0070675_1000206133	138
406	3300005355	Ga0070671_100026908	Ga0070671_1000269084	138
407	3300005355	Ga0070671_100159599	Ga0070671_1001595992	138
408	3300005356	Ga0070674_100003311	Ga0070674_1000033114	138
409	3300005364	Ga0070673_100635161	Ga0070673_1006351612	138
410	3300005365	Ga0070688_100007081	Ga0070688_1000070818	138
411	3300005367	Ga0070667_100024929	Ga0070667_1000249297	138
412	3300005456	Ga0070678_100003143	Ga0070678_1000031432	138
413	3300005456	Ga0070678_101293666	Ga0070678_1012936662	138
414	3300005459	Ga0068867_100002816	Ga0068867_10000281618	138
415	3300005466	Ga0070685_10260695	Ga0070685_102606951	138
416	3300005539	Ga0068853_100164135	Ga0068853_1001641354	138
417	3300005543	Ga0070672_100032704	Ga0070672_1000327045	138
418	3300005548	Ga0070665_100018354	Ga0070665_1000183548	138
419	3300005616	Ga0068852_100709726	Ga0068852_1007097262	138
420	3300005617	Ga0068859_100098953	Ga0068859_1000989532	138
421	3300005618	Ga0068864_100484927	Ga0068864_1004849272	138
422	3300005719	Ga0068861_100176222	Ga0068861_1001762223	138
423	3300005841	Ga0068863_100391287	Ga0068863_1003912872	138
424	3300005842	Ga0068858_100063160	Ga0068858_1000631602	138
425	3300005844	Ga0068862_101740948	Ga0068862_1017409482	138
426	3300005985	Ga0081539_10021283	Ga0081539_100212839	138
427	3300006038	Ga0075365_10097074	Ga0075365_100970742	138
428	3300006178	Ga0075367_10386820	Ga0075367_103868201	138
429	3300006237	Ga0097621_100118239	Ga0097621_1001182392	138
430	3300006358	Ga0068871_100079638	Ga0068871_1000796383	138
431	3300006881	Ga0068865_100003455	Ga0068865_10000345517	138
432	3300006931	Ga0097620_100098971	Ga0097620_1000989712	138
433	3300009148	Ga0105243_10308079	Ga0105243_103080791	138
434	3300009176	Ga0105242_10289209	Ga0105242_102892092	138
435	3300009177	Ga0105248_10010375	Ga0105248_100103758	138
436	3300009551	Ga0105238_10331158	Ga0105238_103311581	138
437	3300013297	Ga0157378_10058626	Ga0157378_100586262	138
438	3300013297	Ga0157378_10733669	Ga0157378_107336692	138
439	3300013306	Ga0163162_10079645	Ga0163162_100796452	138
440	3300013308	Ga0157375_10011349	Ga0157375_100113493	138
441	3300014968	Ga0157379_10011586	Ga0157379_1001158612	138
442	3300014969	Ga0157376_10008331	Ga0157376_100083311	138
443	3300025315	Ga0207697_10009021	Ga0207697_100090216	138
444	3300025893	Ga0207682_10091267	Ga0207682_100912671	138
445	3300025903	Ga0207680_10109431	Ga0207680_101094312	138
446	3300025907	Ga0207645_10003264	Ga0207645_100032642	138
447	3300025923	Ga0207681_10302740	Ga0207681_103027401	138
448	3300025925	Ga0207650_10050868	Ga0207650_100508683	138
449	3300025925	Ga0207650_10104847	Ga0207650_101048472	138
450	3300025926	Ga0207659_10033396	Ga0207659_100333962	138
451	3300025931	Ga0207644_10032806	Ga0207644_100328064	138
452	3300025931	Ga0207644_10831660	Ga0207644_108316602	138
453	3300025934	Ga0207686_10611019	Ga0207686_106110191	138
454	3300025937	Ga0207669_10032673	Ga0207669_100326732	138
455	3300025938	Ga0207704_10009672	Ga0207704_100096727	138
456	3300025940	Ga0207691_10004787	Ga0207691_100047873	138
457	3300025941	Ga0207711_10090996	Ga0207711_100909965	138
458	3300025942	Ga0207689_10001076	Ga0207689_1000107619	138
459	3300025960	Ga0207651_10568816	Ga0207651_105688162	138
460	3300025960	Ga0207651_10993863	Ga0207651_109938632	138
461	3300025961	Ga0207712_10279388	Ga0207712_102793883	138
462	3300025986	Ga0207658_10966603	Ga0207658_109666031	138
463	3300026023	Ga0207677_10002898	Ga0207677_1000289817	138
464	3300026035	Ga0207703_10216260	Ga0207703_102162602	138
465	3300026041	Ga0207639_10133612	Ga0207639_101336123	138
466	3300026067	Ga0207678_10384928	Ga0207678_103849282	138
467	3300026088	Ga0207641_10316536	Ga0207641_103165361	138
468	3300026089	Ga0207648_10005850	Ga0207648_100058502	138
469	3300026095	Ga0207676_10084240	Ga0207676_100842401	138
470	3300026095	Ga0207676_10660420	Ga0207676_106604202	138
471	3300026118	Ga0207675_100207377	Ga0207675_1002073774	138
472	3300026121	Ga0207683_10003100	Ga0207683_100031007	138
473	3300028379	Ga0268266_10011035	Ga0268266_1001103512	138
474	3300028381	Ga0268264_10744165	Ga0268264_107441652	138
475	3300035113	Ga0373936_0183413	Ga0373936_0183413_127_543	138
476	3300035116	Ga0373945_0199717	Ga0373945_0199717_244_660	138
477	3300035695	Ga0373927_0369351	Ga0373927_0369351_472_888	138
478	3300035725	Ga0373947_0313517	Ga0373947_0313517_266_682	138
479	3300037068	Ga0373925_0218088	Ga0373925_0218088_1017_1433	138
480	3300046691	Ga0495670_0383994	Ga0495670_0383994_323_739	138
481	3300048907	Ga0496104_1063882	Ga0496104_1063882_234_650	138
482	3300048912	Ga0496109_0066980	Ga0496109_0066980_941_1357	138

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6hxv-assembly1.cif.gz_B	crystal structure of the head and coiled-coil domains of zebrafish ccdc61 (f129e/d130a)	0.6891	72	118
6i60-assembly1.cif.gz_A	structure of alpha-l-rhamnosidase from dictyoglumus thermophilum	0.6734	75	105
1kcm-assembly1.cif.gz_A-2	crystal structure of mouse pitp alpha void of bound phospholipid at 2.0 angstroms resolution	0.6052	58	116
2bhz-assembly1.cif.gz_A	crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with maltose	0.5764	58	97
5hr6-assembly2.cif.gz_B	x-ray crystal structure of c118a rlmn with cross-linked trna purified from escherichia coli	0.5194	58	111

ID	Description	Score	Start	End	Superfamily
af_Q2G0L3_157_320_3.40.50.2000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B;	0.7288	41	88	3.40.50.2000
af_Q2G0L2_152_317_3.40.50.2000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B;	0.6618	38	88	3.40.50.2000
1nu5A01	Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain	0.6522	55	96	3.30.390.10
af_A0JPP8_2_187_2.170.210.20	Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;Spindle assembly abnormal protein 6, N-terminal domain	0.6521	73	120	2.170.210.20
af_Q9Y6R9_1_164_2.170.210.20	Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;Spindle assembly abnormal protein 6, N-terminal domain	0.6452	72	119	2.170.210.20

ID	Description	Score	Start	End	GO Terms
AF-A0A2E6SWT8-F1-model_v4	CBM2 domain-containing protein	0.8068	75	137	GO:0004553 GO:0005975 GO:0030247
AF-A0A534NK88-F1-model_v4	Uncharacterized protein	0.7741	61	138
AF-A0A534NK88-F1-model_v4	Uncharacterized protein	0.7579	61	138
AF-A0A2V7NWM4-F1-model_v4	Uncharacterized protein	0.7284	39	138
AF-A0A557ZZ59-F1-model_v4	Uncharacterized protein	0.7144	58	137

Feature Viewer

pLDDT	pTM	Quality
87.14	0.58	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F452565

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map