F452602

General Info

Members Datasets Scaffolds Average Seq Length
482 237 964 199

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11095742|Ga0114129_110957421
Length 225
Sequence MCYTPGTAFYAEDDHGGHAEPANVEDSIMRKLIVLEHLTLDGVIQAPGGSDEDASDGFAYGGWSAPYSDDVLGTALSEQMNRPFDLLLGRKTFDIWASYWPHHADFWPGVMTATKYVASTTLTSSEWQPSVFLNGDIAEKVANIKQQQGPDVHVWGSGNLLQTLIKHDLVDVFWLMIYPITLGSGKRLFADGTIPAAFKVTESHVSPDGVIIVSYERAGAITTGT

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2124908026 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
148 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
163 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
164 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
184 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
185 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
209 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
210 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
211 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
212 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
213 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
214 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
217 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
218 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
236 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
237 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.41
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.28
Nodule 0
Rhizoplane 0.83
Rhizosphere 96.27
Stem 0
Stem Tuber 0
Unclassified 21.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_11095742 3300009147 Bacteria 997
2 MRS1a_Contig_1954 2124908026 Bacteria 784
3 JGI24034J26672_10000001 3300002239 Bacteria 1118280
4 JGI24751J29686_10000036 3300002459 Bacteria 82067
5 Ga0055531_10001817 3300003794 Bacteria 15134
6 Ga0065714_10064460 3300005288 Bacteria 66400
7 Ga0065704_10070575 3300005289 Bacteria 20060
8 Ga0065712_10000119 3300005290 Bacteria 137052
9 Ga0065712_10135620 3300005290 Bacteria 1429
10 Ga0065712_10255835 3300005290 Bacteria 921
11 Ga0065715_10089467 3300005293 Bacteria 10038
12 Ga0065715_10266570 3300005293 Bacteria 1113
13 Ga0065715_10335324 3300005293 Bacteria 976
14 Ga0065707_10005873 3300005295 Bacteria 4362
15 Ga0065707_10007266 3300005295 Bacteria 3319
16 Ga0065707_10082364 3300005295 Bacteria 16154
17 Ga0070690_100359687 3300005330 Bacteria 1059
18 Ga0070670_100003166 3300005331 Bacteria 13604
19 Ga0070670_100018717 3300005331 Bacteria 5937
20 Ga0068869_100000137 3300005334 Bacteria 35570
21 Ga0068869_100535877 3300005334 Bacteria 982
22 Ga0070666_10049209 3300005335 Bacteria 2832
23 Ga0070666_10310055 3300005335 Bacteria 1125
24 Ga0068868_100063856 3300005338 Bacteria 2922
25 Ga0070689_100414349 3300005340 Unclassified 1141
26 Ga0070687_100375058 3300005343 Bacteria 925
27 Ga0070692_10207225 3300005345 Bacteria 1152
28 Ga0070669_100210792 3300005353 Bacteria 1533
29 Ga0070669_100881500 3300005353 Unclassified 764
30 Ga0070675_100155735 3300005354 Bacteria 1962
31 Ga0070675_100301794 3300005354 Unclassified 1411
32 Ga0070671_100001809 3300005355 Bacteria 16263
33 Ga0070671_100043971 3300005355 Bacteria 3711
34 Ga0070671_100247039 3300005355 Bacteria 1515
35 Ga0070673_100206101 3300005364 Bacteria 1696
36 Ga0070673_100354540 3300005364 Bacteria 1303
37 Ga0070673_100689189 3300005364 Bacteria 938
38 Ga0070703_10000501 3300005406 Bacteria 15404
39 Ga0070709_10000084 3300005434 Bacteria 70621
40 Ga0070710_10015583 3300005437 Bacteria 3851
41 Ga0070701_10075638 3300005438 Bacteria 1811
42 Ga0070711_100000175 3300005439 Bacteria 34287
43 Ga0070711_100048533 3300005439 Unclassified 2904
44 Ga0070711_100067686 3300005439 Bacteria 2506
45 Ga0070700_100000289 3300005441 Bacteria 26444
46 Ga0070700_100021378 3300005441 Bacteria 3760
47 Ga0070700_100438833 3300005441 Bacteria 991
48 Ga0070694_100021506 3300005444 Bacteria 4124
49 Ga0070694_100576088 3300005444 Unclassified 904
50 Ga0070708_100038080 3300005445 Bacteria 4199
51 Ga0070708_100150220 3300005445 Bacteria 2166
52 Ga0070708_100786505 3300005445 Bacteria 894
53 Ga0068867_100717954 3300005459 Unclassified 884
54 Ga0070685_10497965 3300005466 Bacteria 862
55 Ga0070706_100000050 3300005467 Bacteria 140240
56 Ga0070706_100277512 3300005467 Bacteria 1564
57 Ga0070706_100300673 3300005467 Bacteria 1497
58 Ga0070707_100132691 3300005468 Bacteria 2422
59 Ga0070707_100231230 3300005468 Unclassified 1800
60 Ga0070707_100397281 3300005468 Unclassified 1339
61 Ga0070707_100583100 3300005468 Bacteria 1080
62 Ga0070707_101118697 3300005468 Bacteria 754
63 Ga0070698_100005844 3300005471 Bacteria 13448
64 Ga0070698_100068432 3300005471 Unclassified 3568
65 Ga0070698_100107406 3300005471 Unclassified 2759
66 Ga0070698_100226161 3300005471 Bacteria 1804
67 Ga0070698_100389258 3300005471 Bacteria 1327
68 Ga0070698_100669279 3300005471 Unclassified 979
69 Ga0070699_100010494 3300005518 Bacteria 8013
70 Ga0070699_100010501 3300005518 Bacteria 8011
71 Ga0070699_100020952 3300005518 Bacteria 5636
72 Ga0070699_100136422 3300005518 Bacteria 2164
73 Ga0070699_100231026 3300005518 Bacteria 1649
74 Ga0070699_100267165 3300005518 Bacteria 1530
75 Ga0070699_100491242 3300005518 Unclassified 1115
76 Ga0070697_100211679 3300005536 Bacteria 1650
77 Ga0070696_100192268 3300005546 Bacteria 1519
78 Ga0070693_100511206 3300005547 Bacteria 854
79 Ga0070665_100140212 3300005548 Bacteria 2421
80 Ga0070704_100193779 3300005549 Bacteria 1635
81 Ga0068855_101412359 3300005563 Bacteria 717
82 Ga0070664_100401738 3300005564 Bacteria 1253
83 Ga0070664_100533114 3300005564 Bacteria 1085
84 Ga0068857_100089359 3300005577 Bacteria 2756
85 Ga0068856_100036190 3300005614 Bacteria 4840
86 Ga0070702_100131075 3300005615 Unclassified 1584
87 Ga0068852_100450827 3300005616 Unclassified 1274
88 Ga0068859_100003735 3300005617 Bacteria 15514
89 Ga0068859_100027122 3300005617 Bacteria 5746
90 Ga0068859_100070669 3300005617 Bacteria 3526
91 Ga0068859_100299772 3300005617 Bacteria 1700
92 Ga0068859_100302057 3300005617 Bacteria 1694
93 Ga0068859_100406654 3300005617 Unclassified 1457
94 Ga0068859_100642022 3300005617 Bacteria 1154
95 Ga0068859_100863168 3300005617 Bacteria 991
96 Ga0068859_100997226 3300005617 Bacteria 920
97 Ga0068864_100107413 3300005618 Bacteria 2483
98 Ga0068864_100397902 3300005618 Bacteria 1308
99 Ga0068861_100007458 3300005719 Bacteria 7496
100 Ga0068861_100238763 3300005719 Bacteria 1545
101 Ga0068861_100379194 3300005719 Bacteria 1249
102 Ga0068870_10122012 3300005840 Bacteria 1502
103 Ga0068863_100036888 3300005841 Bacteria 4655
104 Ga0068863_100462002 3300005841 Bacteria 1247
105 Ga0068858_100000005 3300005842 Bacteria 305830
106 Ga0068858_100055152 3300005842 Bacteria 3674
107 Ga0068858_100367395 3300005842 Bacteria 1379
108 Ga0068860_100347170 3300005843 Unclassified 1460
109 Ga0068860_100560190 3300005843 Bacteria 1146
110 Ga0068862_100454079 3300005844 Bacteria 1209
111 Ga0081455_10138403 3300005937 Bacteria 1894
112 Ga0081539_10014025 3300005985 Bacteria 5968
113 Ga0081539_10169586 3300005985 Bacteria 1033
114 Ga0075365_10003194 3300006038 Bacteria 8371
115 Ga0075364_10009876 3300006051 Bacteria 5742
116 Ga0070716_100000002 3300006173 Bacteria 396037
117 Ga0070716_100511625 3300006173 Bacteria 888
118 Ga0075362_10069038 3300006177 Bacteria 1611
119 Ga0075367_10148887 3300006178 Bacteria 1452
120 Ga0075366_10065175 3300006195 Bacteria 2167
121 Ga0097621_100003491 3300006237 Bacteria 10844
122 Ga0097621_100597965 3300006237 Unclassified 1008
123 Ga0068871_100022816 3300006358 Bacteria 4831
124 Ga0068871_100201456 3300006358 Bacteria 1718
125 Ga0075428_100190111 3300006844 Bacteria 2221
126 Ga0075428_100991646 3300006844 Bacteria 889
127 Ga0075428_101425992 3300006844 Unclassified 726
128 Ga0075431_100084801 3300006847 Bacteria 3270
129 Ga0075431_100739390 3300006847 Bacteria 960
130 Ga0075433_10065408 3300006852 Unclassified 3189
131 Ga0075433_10246764 3300006852 Bacteria 1585
132 Ga0075433_10322099 3300006852 Bacteria 1367
133 Ga0075434_100047971 3300006871 Bacteria 4238
134 Ga0075434_100092864 3300006871 Unclassified 3020
135 Ga0075434_100485364 3300006871 Unclassified 1257
136 Ga0075434_100640234 3300006871 Unclassified 1081
137 Ga0075429_100057855 3300006880 Unclassified 3376
138 Ga0075429_100097945 3300006880 Plasmid 2559
139 Ga0075429_100190710 3300006880 Unclassified 1796
140 Ga0075429_100358625 3300006880 Unclassified 1277
141 Ga0075429_100492818 3300006880 Unclassified 1074
142 Ga0075429_101081777 3300006880 Unclassified 700
143 Ga0068865_100476605 3300006881 Bacteria 1036
144 Ga0075436_100000136 3300006914 Bacteria 44102
145 Ga0075436_100056914 3300006914 Bacteria 2700
146 Ga0075436_100240147 3300006914 Bacteria 1288
147 Ga0097620_100003735 3300006931 Bacteria 15514
148 Ga0097620_100027122 3300006931 Bacteria 5746
149 Ga0097620_100070669 3300006931 Bacteria 3526
150 Ga0097620_100299766 3300006931 Bacteria 1700
151 Ga0097620_100302060 3300006931 Bacteria 1694
152 Ga0097620_100406655 3300006931 Unclassified 1457
153 Ga0097620_100642056 3300006931 Bacteria 1154
154 Ga0097620_100997290 3300006931 Bacteria 920
155 Ga0075435_100005843 3300007076 Bacteria 8654
156 Ga0075435_100161030 3300007076 Unclassified 1890
157 Ga0075435_100281429 3300007076 Bacteria 1420
158 Ga0099794_10130041 3300007265 Bacteria 1271
159 Ga0099795_10054555 3300007788 Bacteria 1466
160 Ga0105240_11052168 3300009093 Bacteria 868
161 Ga0105240_11256615 3300009093 Unclassified 782
162 Ga0111539_10042648 3300009094 Bacteria 5445
163 Ga0111539_10239448 3300009094 Bacteria 2112
164 Ga0105247_10000002 3300009101 Bacteria 724587
165 Ga0105247_10325907 3300009101 Bacteria 1073
166 Ga0105247_10365141 3300009101 Bacteria 1019
167 Ga0114129_10115449 3300009147 Unclassified 3700
168 Ga0114129_10227593 3300009147 Bacteria 2512
169 Ga0114129_10513403 3300009147 Unclassified 1563
170 Ga0114129_10827396 3300009147 Unclassified 1179
171 Ga0105243_10000715 3300009148 Bacteria 31978
172 Ga0105243_10129053 3300009148 Unclassified 2142
173 Ga0105243_10313290 3300009148 Unclassified 1427
174 Ga0105243_10993984 3300009148 Bacteria 841
175 Ga0105243_11180047 3300009148 Unclassified 778
176 Ga0105241_10509778 3300009174 Bacteria 1074
177 Ga0105242_10001084 3300009176 Bacteria 21382
178 Ga0105242_10097799 3300009176 Unclassified 2482
179 Ga0105248_10009967 3300009177 Bacteria 10463
180 Ga0105248_10018120 3300009177 Bacteria 7775
181 Ga0105248_10236439 3300009177 Bacteria 2057
182 Ga0105248_10340307 3300009177 Bacteria 1689
183 Ga0105238_10035489 3300009551 Bacteria 5069
184 Ga0105249_10051727 3300009553 Bacteria 3749
185 Ga0105249_10082592 3300009553 Bacteria 2990
186 Ga0105249_11533135 3300009553 Bacteria 739
187 Ga0099796_10064329 3300010159 Bacteria 1308
188 Ga0105246_10012340 3300011119 Bacteria 5328
189 Ga0105246_10054956 3300011119 Bacteria 2746
190 Ga0105246_10106067 3300011119 Unclassified 2054
191 Ga0157373_10085404 3300013100 Bacteria 2225
192 Ga0157374_10041833 3300013296 Bacteria 4225
193 Ga0157374_10109734 3300013296 Unclassified 2653
194 Ga0157378_10000001 3300013297 Bacteria 352632
195 Ga0157378_10199438 3300013297 Bacteria 1892
196 Ga0157378_10219662 3300013297 Bacteria 1806
197 Ga0157378_10608325 3300013297 Bacteria 1105
198 Ga0157378_10819589 3300013297 Bacteria 957
199 Ga0163162_10014966 3300013306 Bacteria 7577
200 Ga0163162_10073113 3300013306 Bacteria 3484
201 Ga0163162_10143661 3300013306 Unclassified 2501
202 Ga0163162_10348630 3300013306 Bacteria 1613
203 Ga0163162_10814527 3300013306 Bacteria 1050
204 Ga0157375_10042802 3300013308 Bacteria 4387
205 Ga0157375_10449409 3300013308 Bacteria 1454
206 Ga0157375_10625346 3300013308 Bacteria 1234
207 Ga0157375_10922249 3300013308 Bacteria 1016
208 Ga0163163_10002456 3300014325 Bacteria 15671
209 Ga0163163_10192774 3300014325 Bacteria 2086
210 Ga0157380_10126483 3300014326 Bacteria 2173
211 Ga0157380_10310500 3300014326 Bacteria 1457
212 Ga0157376_10014983 3300014969 Bacteria 5844
213 Ga0157376_10053020 3300014969 Bacteria 3375
214 Ga0157376_10274697 3300014969 Bacteria 1584
215 Ga0157376_11266579 3300014969 Unclassified 767
216 Ga0163161_10035730 3300017792 Bacteria 3557
217 Ga0207653_10000240 3300025885 Bacteria 36488
218 Ga0207682_10134101 3300025893 Unclassified 1107
219 Ga0207710_10000002 3300025900 Bacteria 1251998
220 Ga0207710_10174412 3300025900 Unclassified 1052
221 Ga0207710_10212652 3300025900 Bacteria 958
222 Ga0207688_10164761 3300025901 Bacteria 1316
223 Ga0207685_10000038 3300025905 Bacteria 61306
224 Ga0207699_10000006 3300025906 Bacteria 430147
225 Ga0207645_10118329 3300025907 Bacteria 1719
226 Ga0207643_10483633 3300025908 Bacteria 790
227 Ga0207684_10000131 3300025910 Bacteria 137508
228 Ga0207684_10388842 3300025910 Bacteria 1199
229 Ga0207654_10083564 3300025911 Bacteria 1928
230 Ga0207693_10008793 3300025915 Bacteria 8255
231 Ga0207663_10000031 3300025916 Bacteria 96659
232 Ga0207663_10068726 3300025916 Unclassified 2276
233 Ga0207663_10106223 3300025916 Bacteria 1897
234 Ga0207660_10687289 3300025917 Unclassified 835
235 Ga0207662_10268617 3300025918 Bacteria 1125
236 Ga0207646_10080706 3300025922 Bacteria 2909
237 Ga0207646_10085680 3300025922 Bacteria 2818
238 Ga0207646_10153164 3300025922 Unclassified 2079
239 Ga0207646_10155367 3300025922 Bacteria 2063
240 Ga0207646_10226802 3300025922 Bacteria 1688
241 Ga0207646_10293621 3300025922 Bacteria 1469
242 Ga0207681_10000729 3300025923 Bacteria 21525
243 Ga0207694_10041840 3300025924 Unclassified 3532
244 Ga0207650_10000006 3300025925 Bacteria 544730
245 Ga0207650_10003171 3300025925 Bacteria 11327
246 Ga0207650_10311612 3300025925 Bacteria 1287
247 Ga0207659_10383532 3300025926 Bacteria 1172
248 Ga0207700_10463890 3300025928 Bacteria 1118
249 Ga0207700_10484894 3300025928 Bacteria 1093
250 Ga0207644_10005266 3300025931 Bacteria 8442
251 Ga0207644_10026968 3300025931 Bacteria 3966
252 Ga0207644_10150115 3300025931 Unclassified 1802
253 Ga0207644_10198051 3300025931 Bacteria 1583
254 Ga0207686_10002273 3300025934 Bacteria 10549
255 Ga0207686_10025988 3300025934 Bacteria 3413
256 Ga0207709_10000301 3300025935 Bacteria 54207
257 Ga0207709_10033452 3300025935 Unclassified 3019
258 Ga0207709_10832857 3300025935 Unclassified 746
259 Ga0207670_10144169 3300025936 Bacteria 1759
260 Ga0207704_10122997 3300025938 Bacteria 1780
261 Ga0207665_10000007 3300025939 Bacteria 177869
262 Ga0207665_10667260 3300025939 Unclassified 816
263 Ga0207691_10515310 3300025940 Unclassified 1015
264 Ga0207711_10021424 3300025941 Bacteria 5400
265 Ga0207711_10024802 3300025941 Bacteria 5030
266 Ga0207711_10201266 3300025941 Bacteria 1817
267 Ga0207711_10316635 3300025941 Bacteria 1441
268 Ga0207689_10015621 3300025942 Bacteria 6430
269 Ga0207689_10150192 3300025942 Bacteria 1920
270 Ga0207679_10146884 3300025945 Bacteria 1914
271 Ga0207679_10739484 3300025945 Bacteria 894
272 Ga0207651_10371321 3300025960 Bacteria 1210
273 Ga0207651_10738444 3300025960 Bacteria 869
274 Ga0207712_10026197 3300025961 Unclassified 3882
275 Ga0207712_10051094 3300025961 Bacteria 2889
276 Ga0207668_10859766 3300025972 Unclassified 806
277 Ga0207640_10226105 3300025981 Unclassified 1436
278 Ga0207703_10000475 3300026035 Bacteria 42000
279 Ga0207639_10757742 3300026041 Bacteria 903
280 Ga0207708_10000148 3300026075 Bacteria 56156
281 Ga0207708_10032184 3300026075 Bacteria 3983
282 Ga0207708_10456321 3300026075 Bacteria 1065
283 Ga0207702_10054003 3300026078 Bacteria 3403
284 Ga0207641_10560969 3300026088 Unclassified 1115
285 Ga0207648_10173152 3300026089 Unclassified 1908
286 Ga0207648_10437237 3300026089 Bacteria 1189
287 Ga0207676_10333789 3300026095 Bacteria 1396
288 Ga0207674_10121744 3300026116 Bacteria 2576
289 Ga0207674_10144377 3300026116 Unclassified 2339
290 Ga0207674_10159992 3300026116 Bacteria 2206
291 Ga0207674_10189876 3300026116 Bacteria 2004
292 Ga0207674_10545533 3300026116 Bacteria 1120
293 Ga0207675_100016334 3300026118 Bacteria 6929
294 Ga0207675_100060847 3300026118 Bacteria 3526
295 Ga0207675_100088039 3300026118 Bacteria 2917
296 Ga0207675_101021526 3300026118 Bacteria 845
297 Ga0207683_10294962 3300026121 Bacteria 1483
298 Ga0207428_10020626 3300027907 Bacteria 5595
299 Ga0268266_10324323 3300028379 Bacteria 1442
300 Ga0268265_10136276 3300028380 Bacteria 2049
301 Ga0268265_10191622 3300028380 Unclassified 1766
302 Ga0268264_10206139 3300028381 Unclassified 1802
303 Ga0268264_10558432 3300028381 Bacteria 1124
304 Ga0265338_10086628 3300028800 Unclassified 2606
305 Ga0265320_10056433 3300031240 Unclassified 1887
306 Ga0316575_10016152 3300031665 Bacteria 2821
307 Ga0316579_10009614 3300031691 Bacteria 4070
308 Ga0316576_10013391 3300031727 Bacteria 5450
309 Ga0316576_10270249 3300031727 Bacteria 1274
310 Ga0316576_10382667 3300031727 Bacteria 1044
311 Ga0316578_10003694 3300031728 Bacteria 7064
312 Ga0316578_10190678 3300031728 Bacteria 1235
313 Ga0316578_10275609 3300031728 Bacteria 1007
314 Ga0307405_10003287 3300031731 Bacteria 7387
315 Ga0316577_10049209 3300031733 Bacteria 2352
316 Ga0316577_10554804 3300031733 Bacteria 653
317 Ga0307413_10102245 3300031824 Bacteria 1897
318 Ga0307413_10173413 3300031824 Bacteria 1529
319 Ga0307413_10437259 3300031824 Bacteria 1035
320 Ga0307410_10232494 3300031852 Bacteria 1424
321 Ga0307410_10953214 3300031852 Unclassified 738
322 Ga0307406_10008863 3300031901 Bacteria 5623
323 Ga0307406_10396227 3300031901 Bacteria 1093
324 Ga0307407_10085280 3300031903 Bacteria 1921
325 Ga0307412_10011394 3300031911 Bacteria 5150
326 Ga0307412_10337338 3300031911 Bacteria 1205
327 Ga0307412_10703059 3300031911 Bacteria 868
328 Ga0307416_100012210 3300032002 Bacteria 5773
329 Ga0307416_100135443 3300032002 Bacteria 2227
330 Ga0307416_100347746 3300032002 Unclassified 1499
331 Ga0307414_10826749 3300032004 Bacteria 846
332 Ga0307411_10006879 3300032005 Bacteria 5733
333 Ga0307415_100084454 3300032126 Bacteria 2278
334 Ga0307415_100175984 3300032126 Bacteria 1674
335 Ga0307415_100786413 3300032126 Unclassified 867
336 Ga0316585_10180470 3300032137 Bacteria 697
337 Ga0316580_10085694 3300032139 Bacteria 963
338 Ga0316596_1007557 3300033541 Bacteria 2573
339 Ga0373951_0006494 3300035091 Bacteria 2675
340 Ga0373923_0092227 3300035111 Bacteria 1326
341 Ga0373939_0090071 3300035114 Unclassified 1035
342 Ga0373953_0009191 3300035117 Bacteria 3387
343 Ga0373956_0021635 3300035119 Bacteria 2744
344 Ga0373957_0082574 3300035120 Bacteria 1270
345 Ga0373955_0008153 3300035172 Bacteria 4848
346 Ga0316574_0009270 3300035398 Bacteria 5505
347 Ga0373924_0338281 3300035410 Bacteria 670
348 Ga0373933_0045593 3300035724 Bacteria 2600
349 Ga0373937_0074551 3300036401 Bacteria 3131
350 Ga0373937_0535123 3300036401 Bacteria 1113
351 Ga0316584_0011081 3300036712 Bacteria 6321
352 Ga0316584_0014818 3300036712 Bacteria 5568
353 Ga0316584_0274052 3300036712 Bacteria 1227
354 Ga0316584_0298849 3300036712 Bacteria 1166
355 Ga0395899_0433648 3300037312 Unclassified 864
356 Ga0395900_0728021 3300037418 Bacteria 924
357 Ga0395898_0217592 3300037466 Bacteria 1822
358 Ga0436364_1430824 3300037853 Bacteria 6375
359 Ga0395901_0167524 3300038443 Bacteria 2306
360 Ga0451853_0085171 3300041512 Unclassified 741
361 Ga0439433_0061682 3300041999 Bacteria 895
362 Ga0439455_0119533 3300042012 Unclassified 738
363 Ga0439444_0019467 3300042437 Unclassified 1185
364 Ga0451577_0000003 3300042876 Bacteria 921850
365 Ga0451577_0000007 3300042876 Bacteria 694123
366 Ga0451577_0001447 3300042876 Bacteria 31590
367 Ga0451577_0027855 3300042876 Bacteria 5113
368 Ga0451577_0065071 3300042876 Bacteria 3251
369 Ga0451577_0155812 3300042876 Bacteria 2056
370 Ga0451577_0482013 3300042876 Unclassified 1126
371 Ga0451577_0777843 3300042876 Unclassified 865
372 Ga0453683_0002041 3300044673 Bacteria 16222
373 Ga0453683_0047058 3300044673 Bacteria 2703
374 Ga0453683_0278241 3300044673 Bacteria 1068
375 Ga0453683_0349867 3300044673 Unclassified 949
376 Ga0453683_0610417 3300044673 Unclassified 712
377 Ga0466963_0055839 3300044694 Bacteria 2627
378 Ga0453684_0000003 3300044712 Bacteria 1481694
379 Ga0453684_0000018 3300044712 Bacteria 921850
380 Ga0453684_0000094 3300044712 Bacteria 382117
381 Ga0453684_0000162 3300044712 Bacteria 298154
382 Ga0453684_0001158 3300044712 Bacteria 82247
383 Ga0453684_0003650 3300044712 Bacteria 34176
384 Ga0453684_0040800 3300044712 Bacteria 6294
385 Ga0453684_0044672 3300044712 Bacteria 5922
386 Ga0453684_0082494 3300044712 Unclassified 4005
387 Ga0453684_0103049 3300044712 Unclassified 3488
388 Ga0453684_0105481 3300044712 Bacteria 3437
389 Ga0453684_0121530 3300044712 Bacteria 3151
390 Ga0453684_0144217 3300044712 Unclassified 2839
391 Ga0453684_0150406 3300044712 Unclassified 2767
392 Ga0453684_0222489 3300044712 Bacteria 2185
393 Ga0453684_0224238 3300044712 Bacteria 2175
394 Ga0453684_0226236 3300044712 Bacteria 2163
395 Ga0453684_0287352 3300044712 Bacteria 1874
396 Ga0453684_0315634 3300044712 Bacteria 1772
397 Ga0453684_0321373 3300044712 Bacteria 1753
398 Ga0453684_0469606 3300044712 Unclassified 1397
399 Ga0453684_0560312 3300044712 Bacteria 1257
400 Ga0453684_0578979 3300044712 Unclassified 1233
401 Ga0453684_0670733 3300044712 Unclassified 1129
402 Ga0453684_0817992 3300044712 Bacteria 1003
403 Ga0453684_0908031 3300044712 Bacteria 943
404 Ga0453684_1108921 3300044712 Unclassified 835
405 Ga0453684_1220448 3300044712 Unclassified 788
406 Ga0466959_0028404 3300045049 Bacteria 4148
407 Ga0451576_0000027 3300045051 Bacteria 422925
408 Ga0451576_0001312 3300045051 Bacteria 43065
409 Ga0451576_0014148 3300045051 Bacteria 8890
410 Ga0451576_0054176 3300045051 Unclassified 4200
411 Ga0451576_0058635 3300045051 Bacteria 4022
412 Ga0451576_0442932 3300045051 Unclassified 1363
413 Ga0495652_0241674 3300046529 Bacteria 1343
414 Ga0495587_0004239 3300046536 Bacteria 9480
415 Ga0495604_0063033 3300047317 Bacteria 2830
416 Ga0495636_0103817 3300047318 Bacteria 1245
417 Ga0495636_0105137 3300047318 Bacteria 1238
418 Ga0495684_0119211 3300047471 Bacteria 1988
419 Ga0495602_0054553 3300048088 Bacteria 3527
420 Ga0496106_0000698 3300048909 Bacteria 24110
421 Ga0496106_0236934 3300048909 Bacteria 1458
422 Ga0496107_0213812 3300048910 Bacteria 1434
423 Ga0496107_0770084 3300048910 Unclassified 706
424 Ga0501308_014227 3300049128 Bacteria 929
425 Ga0501031_0292730 3300049568 Bacteria 1056
426 Ga0501039_0721923 3300049575 Bacteria 779
427 Ga0501042_0474456 3300049578 Unclassified 908
428 Ga0501068_0370684 3300049584 Unclassified 921
429 Ga0501068_0653089 3300049584 Bacteria 687
430 Ga0501072_0290918 3300049588 Unclassified 1299
431 Ga0501072_0820063 3300049588 Unclassified 728
432 Ga0501075_0224792 3300049591 Unclassified 1432
433 Ga0501076_0398244 3300049592 Unclassified 1132
434 Ga0501207_001509 3300049654 Bacteria 2917
435 Ga0501209_013404 3300049656 Bacteria 1773
436 Ga0501217_013260 3300049661 Bacteria 1848
437 Ga0501223_001818 3300049663 Bacteria 4816
438 Ga0501224_004485 3300049664 Bacteria 1983
439 Ga0501230_003470 3300049667 Bacteria 2099
440 Ga0501233_009297 3300049668 Bacteria 1915
441 Ga0501235_004346 3300049669 Bacteria 3068
442 Ga0501257_008978 3300049686 Bacteria 2253
443 Ga0501283_021685 3300049779 Bacteria 1032
444 Ga0501212_027287 3300049851 Bacteria 908
445 nmdc:mga00v17_7675_c1 3300050491 Bacteria 5771
446 nmdc:mga0yw44_214_c1 3300050492 Bacteria 20542
447 nmdc:mga0k408_30215_c2 3300050493 Bacteria 2490
448 nmdc:mga06z11_127432_c1 3300050494 Bacteria 1426
449 nmdc:mga05p37_1012992_c1 3300050507 Unclassified 881
450 nmdc:mga05p37_1094961_c1 3300050507 Bacteria 835
451 nmdc:mga05p37_175410_c1 3300050507 Unclassified 2612
452 nmdc:mga05p37_19131_c1 3300050507 Bacteria 8284
453 nmdc:mga05p37_344679_c1 3300050507 Unclassified 1756
454 nmdc:mga05p37_39878_c1 3300050507 Bacteria 5766
455 nmdc:mga05p37_725247_c1 3300050507 Bacteria 1100
456 nmdc:mga05p37_80409_c1 3300050507 Bacteria 4015
457 nmdc:mga05p37_833762_c1 3300050507 Bacteria 1004
458 nmdc:mga09592_127820_c1 3300050508 Unclassified 2185
459 nmdc:mga09592_197333_c1 3300050508 Unclassified 1743
460 nmdc:mga09592_46270_c2 3300050508 Bacteria 1844
461 nmdc:mga09592_552413_c1 3300050508 Bacteria 989
462 nmdc:mga09592_92773_c1 3300050508 Unclassified 2581
463 nmdc:mga09592_959516_c1 3300050508 Unclassified 716
464 nmdc:mga06r32_190839_c1 3300050510 Bacteria 2037
465 nmdc:mga06r32_460308_c1 3300050510 Unclassified 1251
466 nmdc:mga08y16_59455_c1 3300050511 Bacteria 3992
467 nmdc:mga0n895_390590_c1 3300050512 Bacteria 1408
468 nmdc:mga0n895_458832_c1 3300050512 Bacteria 1286
469 nmdc:mga0n895_62802_c1 3300050512 Plasmid 3672
470 nmdc:mga0rr50_952_c1 3300050513 Bacteria 4356
471 nmdc:mga08x19_12_c1 3300050514 Bacteria 395395
472 nmdc:mga08x19_48925_c1 3300050514 Bacteria 2710
473 nmdc:mga0a205_118561_c1 3300050515 Unclassified 2545
474 nmdc:mga0a205_279527_c1 3300050515 Bacteria 1545
475 nmdc:mga0a205_41502_c1 3300050515 Plasmid 4431
476 Ga0500594_0000002 3300053118 Bacteria 916890
477 Ga0501084_0080957 3300054114 Bacteria 2723
478 Ga0501082_0372666 3300060353 Unclassified 1245
479 Ga0530510_0066546 3300061734 Bacteria 2613
480 2919037217 2919034639 Bacteria 4763403
481 2939675726 2939674588 Bacteria 4844420
482 2980186599 2980182181 Bacteria 9454109
483 Ga0114129_11095742
484 MRS1a_Contig_1954
485 JGI24034J26672_10000001
486 JGI24751J29686_10000036
487 Ga0055531_10001817
488 Ga0065714_10064460
489 Ga0065704_10070575
490 Ga0065712_10000119
491 Ga0065712_10135620
492 Ga0065712_10255835
493 Ga0065715_10089467
494 Ga0065715_10266570
495 Ga0065715_10335324
496 Ga0065707_10005873
497 Ga0065707_10007266
498 Ga0065707_10082364
499 Ga0070690_100359687
500 Ga0070670_100003166
501 Ga0070670_100018717
502 Ga0068869_100000137
503 Ga0068869_100535877
504 Ga0070666_10049209
505 Ga0070666_10310055
506 Ga0068868_100063856
507 Ga0070689_100414349
508 Ga0070687_100375058
509 Ga0070692_10207225
510 Ga0070669_100210792
511 Ga0070669_100881500
512 Ga0070675_100155735
513 Ga0070675_100301794
514 Ga0070671_100001809
515 Ga0070671_100043971
516 Ga0070671_100247039
517 Ga0070673_100206101
518 Ga0070673_100354540
519 Ga0070673_100689189
520 Ga0070703_10000501
521 Ga0070709_10000084
522 Ga0070710_10015583
523 Ga0070701_10075638
524 Ga0070711_100000175
525 Ga0070711_100048533
526 Ga0070711_100067686
527 Ga0070700_100000289
528 Ga0070700_100021378
529 Ga0070700_100438833
530 Ga0070694_100021506
531 Ga0070694_100576088
532 Ga0070708_100038080
533 Ga0070708_100150220
534 Ga0070708_100786505
535 Ga0068867_100717954
536 Ga0070685_10497965
537 Ga0070706_100000050
538 Ga0070706_100277512
539 Ga0070706_100300673
540 Ga0070707_100132691
541 Ga0070707_100231230
542 Ga0070707_100397281
543 Ga0070707_100583100
544 Ga0070707_101118697
545 Ga0070698_100005844
546 Ga0070698_100068432
547 Ga0070698_100107406
548 Ga0070698_100226161
549 Ga0070698_100389258
550 Ga0070698_100669279
551 Ga0070699_100010494
552 Ga0070699_100010501
553 Ga0070699_100020952
554 Ga0070699_100136422
555 Ga0070699_100231026
556 Ga0070699_100267165
557 Ga0070699_100491242
558 Ga0070697_100211679
559 Ga0070696_100192268
560 Ga0070693_100511206
561 Ga0070665_100140212
562 Ga0070704_100193779
563 Ga0068855_101412359
564 Ga0070664_100401738
565 Ga0070664_100533114
566 Ga0068857_100089359
567 Ga0068856_100036190
568 Ga0070702_100131075
569 Ga0068852_100450827
570 Ga0068859_100003735
571 Ga0068859_100027122
572 Ga0068859_100070669
573 Ga0068859_100299772
574 Ga0068859_100302057
575 Ga0068859_100406654
576 Ga0068859_100642022
577 Ga0068859_100863168
578 Ga0068859_100997226
579 Ga0068864_100107413
580 Ga0068864_100397902
581 Ga0068861_100007458
582 Ga0068861_100238763
583 Ga0068861_100379194
584 Ga0068870_10122012
585 Ga0068863_100036888
586 Ga0068863_100462002
587 Ga0068858_100000005
588 Ga0068858_100055152
589 Ga0068858_100367395
590 Ga0068860_100347170
591 Ga0068860_100560190
592 Ga0068862_100454079
593 Ga0081455_10138403
594 Ga0081539_10014025
595 Ga0081539_10169586
596 Ga0075365_10003194
597 Ga0075364_10009876
598 Ga0070716_100000002
599 Ga0070716_100511625
600 Ga0075362_10069038
601 Ga0075367_10148887
602 Ga0075366_10065175
603 Ga0097621_100003491
604 Ga0097621_100597965
605 Ga0068871_100022816
606 Ga0068871_100201456
607 Ga0075428_100190111
608 Ga0075428_100991646
609 Ga0075428_101425992
610 Ga0075431_100084801
611 Ga0075431_100739390
612 Ga0075433_10065408
613 Ga0075433_10246764
614 Ga0075433_10322099
615 Ga0075434_100047971
616 Ga0075434_100092864
617 Ga0075434_100485364
618 Ga0075434_100640234
619 Ga0075429_100057855
620 Ga0075429_100097945
621 Ga0075429_100190710
622 Ga0075429_100358625
623 Ga0075429_100492818
624 Ga0075429_101081777
625 Ga0068865_100476605
626 Ga0075436_100000136
627 Ga0075436_100056914
628 Ga0075436_100240147
629 Ga0097620_100003735
630 Ga0097620_100027122
631 Ga0097620_100070669
632 Ga0097620_100299766
633 Ga0097620_100302060
634 Ga0097620_100406655
635 Ga0097620_100642056
636 Ga0097620_100997290
637 Ga0075435_100005843
638 Ga0075435_100161030
639 Ga0075435_100281429
640 Ga0099794_10130041
641 Ga0099795_10054555
642 Ga0105240_11052168
643 Ga0105240_11256615
644 Ga0111539_10042648
645 Ga0111539_10239448
646 Ga0105247_10000002
647 Ga0105247_10325907
648 Ga0105247_10365141
649 Ga0114129_10115449
650 Ga0114129_10227593
651 Ga0114129_10513403
652 Ga0114129_10827396
653 Ga0105243_10000715
654 Ga0105243_10129053
655 Ga0105243_10313290
656 Ga0105243_10993984
657 Ga0105243_11180047
658 Ga0105241_10509778
659 Ga0105242_10001084
660 Ga0105242_10097799
661 Ga0105248_10009967
662 Ga0105248_10018120
663 Ga0105248_10236439
664 Ga0105248_10340307
665 Ga0105238_10035489
666 Ga0105249_10051727
667 Ga0105249_10082592
668 Ga0105249_11533135
669 Ga0099796_10064329
670 Ga0105246_10012340
671 Ga0105246_10054956
672 Ga0105246_10106067
673 Ga0157373_10085404
674 Ga0157374_10041833
675 Ga0157374_10109734
676 Ga0157378_10000001
677 Ga0157378_10199438
678 Ga0157378_10219662
679 Ga0157378_10608325
680 Ga0157378_10819589
681 Ga0163162_10014966
682 Ga0163162_10073113
683 Ga0163162_10143661
684 Ga0163162_10348630
685 Ga0163162_10814527
686 Ga0157375_10042802
687 Ga0157375_10449409
688 Ga0157375_10625346
689 Ga0157375_10922249
690 Ga0163163_10002456
691 Ga0163163_10192774
692 Ga0157380_10126483
693 Ga0157380_10310500
694 Ga0157376_10014983
695 Ga0157376_10053020
696 Ga0157376_10274697
697 Ga0157376_11266579
698 Ga0163161_10035730
699 Ga0207653_10000240
700 Ga0207682_10134101
701 Ga0207710_10000002
702 Ga0207710_10174412
703 Ga0207710_10212652
704 Ga0207688_10164761
705 Ga0207685_10000038
706 Ga0207699_10000006
707 Ga0207645_10118329
708 Ga0207643_10483633
709 Ga0207684_10000131
710 Ga0207684_10388842
711 Ga0207654_10083564
712 Ga0207693_10008793
713 Ga0207663_10000031
714 Ga0207663_10068726
715 Ga0207663_10106223
716 Ga0207660_10687289
717 Ga0207662_10268617
718 Ga0207646_10080706
719 Ga0207646_10085680
720 Ga0207646_10153164
721 Ga0207646_10155367
722 Ga0207646_10226802
723 Ga0207646_10293621
724 Ga0207681_10000729
725 Ga0207694_10041840
726 Ga0207650_10000006
727 Ga0207650_10003171
728 Ga0207650_10311612
729 Ga0207659_10383532
730 Ga0207700_10463890
731 Ga0207700_10484894
732 Ga0207644_10005266
733 Ga0207644_10026968
734 Ga0207644_10150115
735 Ga0207644_10198051
736 Ga0207686_10002273
737 Ga0207686_10025988
738 Ga0207709_10000301
739 Ga0207709_10033452
740 Ga0207709_10832857
741 Ga0207670_10144169
742 Ga0207704_10122997
743 Ga0207665_10000007
744 Ga0207665_10667260
745 Ga0207691_10515310
746 Ga0207711_10021424
747 Ga0207711_10024802
748 Ga0207711_10201266
749 Ga0207711_10316635
750 Ga0207689_10015621
751 Ga0207689_10150192
752 Ga0207679_10146884
753 Ga0207679_10739484
754 Ga0207651_10371321
755 Ga0207651_10738444
756 Ga0207712_10026197
757 Ga0207712_10051094
758 Ga0207668_10859766
759 Ga0207640_10226105
760 Ga0207703_10000475
761 Ga0207639_10757742
762 Ga0207708_10000148
763 Ga0207708_10032184
764 Ga0207708_10456321
765 Ga0207702_10054003
766 Ga0207641_10560969
767 Ga0207648_10173152
768 Ga0207648_10437237
769 Ga0207676_10333789
770 Ga0207674_10121744
771 Ga0207674_10144377
772 Ga0207674_10159992
773 Ga0207674_10189876
774 Ga0207674_10545533
775 Ga0207675_100016334
776 Ga0207675_100060847
777 Ga0207675_100088039
778 Ga0207675_101021526
779 Ga0207683_10294962
780 Ga0207428_10020626
781 Ga0268266_10324323
782 Ga0268265_10136276
783 Ga0268265_10191622
784 Ga0268264_10206139
785 Ga0268264_10558432
786 Ga0265338_10086628
787 Ga0265320_10056433
788 Ga0316575_10016152
789 Ga0316579_10009614
790 Ga0316576_10013391
791 Ga0316576_10270249
792 Ga0316576_10382667
793 Ga0316578_10003694
794 Ga0316578_10190678
795 Ga0316578_10275609
796 Ga0307405_10003287
797 Ga0316577_10049209
798 Ga0316577_10554804
799 Ga0307413_10102245
800 Ga0307413_10173413
801 Ga0307413_10437259
802 Ga0307410_10232494
803 Ga0307410_10953214
804 Ga0307406_10008863
805 Ga0307406_10396227
806 Ga0307407_10085280
807 Ga0307412_10011394
808 Ga0307412_10337338
809 Ga0307412_10703059
810 Ga0307416_100012210
811 Ga0307416_100135443
812 Ga0307416_100347746
813 Ga0307414_10826749
814 Ga0307411_10006879
815 Ga0307415_100084454
816 Ga0307415_100175984
817 Ga0307415_100786413
818 Ga0316585_10180470
819 Ga0316580_10085694
820 Ga0316596_1007557
821 Ga0373951_0006494
822 Ga0373923_0092227
823 Ga0373939_0090071
824 Ga0373953_0009191
825 Ga0373956_0021635
826 Ga0373957_0082574
827 Ga0373955_0008153
828 Ga0316574_0009270
829 Ga0373924_0338281
830 Ga0373933_0045593
831 Ga0373937_0074551
832 Ga0373937_0535123
833 Ga0316584_0011081
834 Ga0316584_0014818
835 Ga0316584_0274052
836 Ga0316584_0298849
837 Ga0395899_0433648
838 Ga0395900_0728021
839 Ga0395898_0217592
840 Ga0436364_1430824
841 Ga0395901_0167524
842 Ga0451853_0085171
843 Ga0439433_0061682
844 Ga0439455_0119533
845 Ga0439444_0019467
846 Ga0451577_0000003
847 Ga0451577_0000007
848 Ga0451577_0001447
849 Ga0451577_0027855
850 Ga0451577_0065071
851 Ga0451577_0155812
852 Ga0451577_0482013
853 Ga0451577_0777843
854 Ga0453683_0002041
855 Ga0453683_0047058
856 Ga0453683_0278241
857 Ga0453683_0349867
858 Ga0453683_0610417
859 Ga0466963_0055839
860 Ga0453684_0000003
861 Ga0453684_0000018
862 Ga0453684_0000094
863 Ga0453684_0000162
864 Ga0453684_0001158
865 Ga0453684_0003650
866 Ga0453684_0040800
867 Ga0453684_0044672
868 Ga0453684_0082494
869 Ga0453684_0103049
870 Ga0453684_0105481
871 Ga0453684_0121530
872 Ga0453684_0144217
873 Ga0453684_0150406
874 Ga0453684_0222489
875 Ga0453684_0224238
876 Ga0453684_0226236
877 Ga0453684_0287352
878 Ga0453684_0315634
879 Ga0453684_0321373
880 Ga0453684_0469606
881 Ga0453684_0560312
882 Ga0453684_0578979
883 Ga0453684_0670733
884 Ga0453684_0817992
885 Ga0453684_0908031
886 Ga0453684_1108921
887 Ga0453684_1220448
888 Ga0466959_0028404
889 Ga0451576_0000027
890 Ga0451576_0001312
891 Ga0451576_0014148
892 Ga0451576_0054176
893 Ga0451576_0058635
894 Ga0451576_0442932
895 Ga0495652_0241674
896 Ga0495587_0004239
897 Ga0495604_0063033
898 Ga0495636_0103817
899 Ga0495636_0105137
900 Ga0495684_0119211
901 Ga0495602_0054553
902 Ga0496106_0000698
903 Ga0496106_0236934
904 Ga0496107_0213812
905 Ga0496107_0770084
906 Ga0501308_014227
907 Ga0501031_0292730
908 Ga0501039_0721923
909 Ga0501042_0474456
910 Ga0501068_0370684
911 Ga0501068_0653089
912 Ga0501072_0290918
913 Ga0501072_0820063
914 Ga0501075_0224792
915 Ga0501076_0398244
916 Ga0501207_001509
917 Ga0501209_013404
918 Ga0501217_013260
919 Ga0501223_001818
920 Ga0501224_004485
921 Ga0501230_003470
922 Ga0501233_009297
923 Ga0501235_004346
924 Ga0501257_008978
925 Ga0501283_021685
926 Ga0501212_027287
927 nmdc:mga00v17_7675_c1
928 nmdc:mga0yw44_214_c1
929 nmdc:mga0k408_30215_c2
930 nmdc:mga06z11_127432_c1
931 nmdc:mga05p37_1012992_c1
932 nmdc:mga05p37_1094961_c1
933 nmdc:mga05p37_175410_c1
934 nmdc:mga05p37_19131_c1
935 nmdc:mga05p37_344679_c1
936 nmdc:mga05p37_39878_c1
937 nmdc:mga05p37_725247_c1
938 nmdc:mga05p37_80409_c1
939 nmdc:mga05p37_833762_c1
940 nmdc:mga09592_127820_c1
941 nmdc:mga09592_197333_c1
942 nmdc:mga09592_46270_c2
943 nmdc:mga09592_552413_c1
944 nmdc:mga09592_92773_c1
945 nmdc:mga09592_959516_c1
946 nmdc:mga06r32_190839_c1
947 nmdc:mga06r32_460308_c1
948 nmdc:mga08y16_59455_c1
949 nmdc:mga0n895_390590_c1
950 nmdc:mga0n895_458832_c1
951 nmdc:mga0n895_62802_c1
952 nmdc:mga0rr50_952_c1
953 nmdc:mga08x19_12_c1
954 nmdc:mga08x19_48925_c1
955 nmdc:mga0a205_118561_c1
956 nmdc:mga0a205_279527_c1
957 nmdc:mga0a205_41502_c1
958 Ga0500594_0000002
959 Ga0501084_0080957
960 Ga0501082_0372666
961 Ga0530510_0066546
962 2919037217
963 2939675726
964 2980186599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

30

212

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7685 2 190
1vdr-assembly1.cif.gz_B dihydrofolate reductase 0.7614 3 190
3ix9-assembly1.cif.gz_A crystal structure of streptococcus pneumoniae dihydrofolate reductase - sp9 mutant 0.7608 1 191
3e0b-assembly1.cif.gz_A bacillus anthracis dihydrofolate reductase complexed with nadph and 2,4-diamino-5-(3-(2,5-dimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (ucp120b) 0.7593 2 189
1vdr-assembly1.cif.gz_B dihydrofolate reductase 0.7571 3 190
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7675 2 187 3.40.430.10
3ix9B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7632 1 191 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7631 2 187 3.40.430.10
3ix9B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7591 1 191 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7527 3 190 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A520CGX7-F1-model_v4 Dihydrofolate reductase 0.929 57 198 GO:0008703
GO:0009231
AF-A0A1Y5U461-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9163 55 197 GO:0008703
GO:0009231
AF-A0A520CGX7-F1-model_v4 Dihydrofolate reductase 0.9104 57 198 GO:0008703
GO:0009231
AF-A0A0J7I096-F1-model_v4 Dihydrofolate reductase 0.9039 1 198 GO:0008703
GO:0009231
AF-A0A1Q7UMG8-F1-model_v4 Riboflavin biosynthesis protein RibD 0.9035 18 198 GO:0008703
GO:0009231

Map