F452632

General Info

Members Datasets Scaffolds Average Seq Length
482 321 458 154

Family's Representative Sequence

Representative Sequence 3300027543|Ga0209999_1067638|Ga0209999_10676381
Length 183
Sequence MPDLAFSSATLDDVDALVALVTSAYRGDASRAGWTTEADLLDGKRLHIGIVQARFNEAITDTLFSACQAELLALGVQEKNIAHVKVPGALEVPVALQAMAELDEYDALIALGCIIRGETYHFELVANESAAGVTRIALDYQLPIANAILTTENMDQAIARQLEKGRDAAQVAIEMANLLEDIG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2643221570 Acidovorax sp. Root568 Isolate Unclassified
4 2643221596 Acidovorax sp. Root70 Isolate Unclassified
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221611 Acidovorax sp. Root219 Isolate Unclassified
7 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
8 2643221652 Acidovorax sp. Root402 Isolate Unclassified
9 2643221717 Acidovorax sp. Root267 Isolate Unclassified
10 2721755523 Delftia sp. HK171 Isolate Unclassified
11 2738543012 Acidovorax sp. CF301 Isolate Unclassified
12 2816332133 Acidovorax radicis 2721A Isolate Unclassified
13 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
14 2842677519 Variovorax sp. R-72495 Isolate Unclassified
15 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
16 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
17 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
18 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
19 2929520902 Variovorax beijingensis 502 Isolate Unclassified
20 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
21 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
22 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
23 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
24 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
25 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
26 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
187 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
190 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
193 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
194 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
195 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
196 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
197 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
198 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
216 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
217 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
228 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
234 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
235 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
236 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
237 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
238 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
239 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
240 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
241 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
242 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
243 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
244 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
245 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
246 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
247 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
248 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
249 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
250 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
251 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
252 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
253 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
254 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
255 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
256 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
257 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
258 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
259 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
260 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
261 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
262 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
263 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
278 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
279 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
302 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
303 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
304 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
305 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
306 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
317 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
318 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
319 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 0.41
Isolates 4.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.33
Nodule 1.24
Rhizoplane 3.32
Rhizosphere 69.09
Stem 0
Stem Tuber 0
Unclassified 6.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000002 3300002705 Bacteria 343501
2 JGI25154J39366_1000010 3300002738 Bacteria 297985
3 JGI25157J39369_1000001 3300002741 Bacteria 363277
4 JGI25150J39212_1006148 3300002774 Bacteria 2505
5 JGI25159J45721_1000336 3300002987 Bacteria 21694
6 JGI25159J45721_1000418 3300002987 Bacteria 19658
7 JGI25151J46595_10057677 3300003187 Bacteria 1264
8 JGI25151J46595_10069671 3300003187 Bacteria 1072
9 JGI25151J46595_10086449 3300003187 Bacteria 888
10 JGI25151J46595_10127537 3300003187 Bacteria 639
11 JGI25160J50197_1000342 3300003354 Bacteria 31433
12 JGI25160J50197_1038778 3300003354 Bacteria 1123
13 JGI25161J50226_1000259 3300003374 Bacteria 31433
14 Ga0055526_1004095 3300003771 Bacteria 8904
15 Ga0055526_1004623 3300003771 Bacteria 8201
16 Ga0055537_1000102 3300003773 Bacteria 63809
17 Ga0055524_1000093 3300003775 Bacteria 111953
18 Ga0055536_1002186 3300003781 Bacteria 11135
19 Ga0055534_1000251 3300003784 Bacteria 37571
20 Ga0055534_1003916 3300003784 Bacteria 4509
21 Ga0055528_1016931 3300003790 Bacteria 2550
22 Ga0055528_1017193 3300003790 Bacteria 2519
23 Ga0055530_10000285 3300003791 Bacteria 46054
24 Ga0055530_10055629 3300003791 Bacteria 901
25 Ga0055540_1000196 3300003792 Bacteria 58476
26 Ga0055540_1014749 3300003792 Bacteria 2312
27 Ga0055531_10002290 3300003794 Bacteria 12955
28 Ga0055543_1000527 3300004625 Bacteria 21646
29 Ga0065165_1025946 3300005262 Bacteria 1936
30 Ga0065165_1038345 3300005262 Bacteria 1445
31 Ga0065714_10018834 3300005288 Bacteria 2452
32 Ga0065704_10182336 3300005289 Bacteria 1231
33 Ga0070658_10124413 3300005327 Bacteria 2145
34 Ga0070683_100042597 3300005329 Bacteria 4181
35 Ga0070683_100371353 3300005329 Bacteria 1362
36 Ga0070670_100136211 3300005331 Bacteria 2122
37 Ga0070670_100526810 3300005331 Bacteria 1053
38 Ga0070677_10034493 3300005333 Bacteria 1956
39 Ga0068869_100003710 3300005334 Bacteria 9400
40 Ga0070680_100335688 3300005336 Bacteria 1284
41 Ga0068868_100000789 3300005338 Bacteria 21436
42 Ga0068868_100109167 3300005338 Bacteria 2247
43 Ga0070660_100183328 3300005339 Bacteria 1695
44 Ga0070660_100239475 3300005339 Bacteria 1478
45 Ga0070661_100294274 3300005344 Bacteria 1262
46 Ga0070692_10362636 3300005345 Bacteria 904
47 Ga0070668_100155939 3300005347 Bacteria 1850
48 Ga0070669_100006970 3300005353 Bacteria 8120
49 Ga0070669_101029683 3300005353 Bacteria 707
50 Ga0070675_100018861 3300005354 Bacteria 5493
51 Ga0070671_100630318 3300005355 Bacteria 927
52 Ga0070659_100019568 3300005366 Bacteria 5133
53 Ga0070659_100020112 3300005366 Bacteria 5068
54 Ga0070659_100225753 3300005366 Bacteria 1547
55 Ga0070667_100220914 3300005367 Bacteria 1686
56 Ga0070667_100317415 3300005367 Bacteria 1406
57 Ga0070663_100006757 3300005455 Bacteria 6931
58 Ga0070678_100606356 3300005456 Bacteria 978
59 Ga0070662_100001468 3300005457 Bacteria 14517
60 Ga0068867_100230807 3300005459 Bacteria 1496
61 Ga0070679_100013143 3300005530 Bacteria 7926
62 Ga0070679_100087550 3300005530 Bacteria 3102
63 Ga0070684_100039911 3300005535 Bacteria 4039
64 Ga0070684_100497085 3300005535 Bacteria 1129
65 Ga0068853_100018272 3300005539 Bacteria 5801
66 Ga0068853_100113610 3300005539 Bacteria 2408
67 Ga0068853_100139793 3300005539 Bacteria 2173
68 Ga0070672_100031643 3300005543 Bacteria 3984
69 Ga0070672_100376898 3300005543 Bacteria 1213
70 Ga0070693_100120805 3300005547 Bacteria 1625
71 Ga0068855_100008990 3300005563 Bacteria 12069
72 Ga0068855_100280933 3300005563 Bacteria 1849
73 Ga0068855_100595386 3300005563 Bacteria 1193
74 Ga0070664_100532253 3300005564 Bacteria 1085
75 Ga0070664_101530149 3300005564 Bacteria 631
76 Ga0068857_100152614 3300005577 Bacteria 2093
77 Ga0068854_100229598 3300005578 Bacteria 1472
78 Ga0068854_101436301 3300005578 Bacteria 625
79 Ga0068856_100060104 3300005614 Bacteria 3755
80 Ga0070702_100350437 3300005615 Bacteria 1040
81 Ga0070702_100641976 3300005615 Bacteria 802
82 Ga0068852_100014734 3300005616 Bacteria 6033
83 Ga0068852_100015149 3300005616 Bacteria 5967
84 Ga0068852_100099663 3300005616 Bacteria 2619
85 Ga0068859_100073840 3300005617 Bacteria 3449
86 Ga0068864_100011079 3300005618 Bacteria 7451
87 Ga0068864_100467861 3300005618 Bacteria 1208
88 Ga0068864_102171262 3300005618 Bacteria 562
89 Ga0068861_100008404 3300005719 Bacteria 7107
90 Ga0068851_10019111 3300005834 Bacteria 3310
91 Ga0068851_10083282 3300005834 Bacteria 1673
92 Ga0068863_100096200 3300005841 Bacteria 2811
93 Ga0068863_100370735 3300005841 Bacteria 1397
94 Ga0068858_100002253 3300005842 Bacteria 19492
95 Ga0068858_100475544 3300005842 Bacteria 1206
96 Ga0068860_100092582 3300005843 Bacteria 2880
97 Ga0068860_100224213 3300005843 Bacteria 1826
98 Ga0075365_10022989 3300006038 Bacteria 3915
99 Ga0075363_100057247 3300006048 Bacteria 2091
100 Ga0075363_100571596 3300006048 Bacteria 676
101 Ga0075364_10203428 3300006051 Bacteria 1342
102 Ga0075432_10005092 3300006058 Bacteria 4477
103 Ga0075432_10015791 3300006058 Bacteria 2576
104 Ga0075362_10003552 3300006177 Bacteria 5470
105 Ga0075362_10031837 3300006177 Bacteria 2285
106 Ga0075362_10036633 3300006177 Bacteria 2147
107 Ga0075362_10069389 3300006177 Bacteria 1607
108 Ga0075362_10111245 3300006177 Bacteria 1289
109 Ga0075366_10027067 3300006195 Bacteria 3363
110 Ga0075366_10518364 3300006195 Bacteria 737
111 Ga0097621_100006973 3300006237 Bacteria 8046
112 Ga0075370_10032451 3300006353 Bacteria 2920
113 Ga0075370_10093322 3300006353 Bacteria 1738
114 Ga0075430_100068438 3300006846 Bacteria 2978
115 Ga0075434_100215913 3300006871 Bacteria 1938
116 Ga0075429_100089964 3300006880 Bacteria 2677
117 Ga0097620_100073840 3300006931 Bacteria 3449
118 Ga0079104_1000098 3300006946 Bacteria 129064
119 Ga0079104_1027952 3300006946 Bacteria 1439
120 Ga0099826_10045370 3300006948 Bacteria 3005
121 Ga0099826_10130283 3300006948 Bacteria 1468
122 Ga0075435_100672888 3300007076 Unclassified 899
123 Ga0105250_10001374 3300009092 Bacteria 13189
124 Ga0105240_10024979 3300009093 Bacteria 7864
125 Ga0105240_10432472 3300009093 Bacteria 1476
126 Ga0105245_10114476 3300009098 Bacteria 2512
127 Ga0105245_10329170 3300009098 Bacteria 1507
128 Ga0105247_10125752 3300009101 Bacteria 1666
129 Ga0105243_10005223 3300009148 Bacteria 10159
130 Ga0105241_10158159 3300009174 Bacteria 1860
131 Ga0105242_10001377 3300009176 Bacteria 19163
132 Ga0105248_10017706 3300009177 Bacteria 7859
133 Ga0105237_10145618 3300009545 Bacteria 2364
134 Ga0105238_10064347 3300009551 Bacteria 3667
135 Ga0105238_10175560 3300009551 Bacteria 2119
136 Ga0105238_10302225 3300009551 Bacteria 1584
137 Ga0105249_11163174 3300009553 Bacteria 842
138 Ga0105239_10034575 3300010375 Bacteria 5550
139 Ga0105239_10339651 3300010375 Bacteria 1695
140 Ga0157373_10360040 3300013100 Bacteria 1038
141 Ga0157371_10143156 3300013102 Bacteria 1703
142 Ga0157370_10433611 3300013104 Bacteria 1208
143 Ga0157370_10521716 3300013104 Bacteria 1090
144 Ga0157369_10029614 3300013105 Bacteria 6047
145 Ga0157374_10009105 3300013296 Bacteria 8508
146 Ga0157374_10793031 3300013296 Bacteria 963
147 Ga0157378_10782372 3300013297 Bacteria 979
148 Ga0163162_10024073 3300013306 Bacteria 6009
149 Ga0157372_10004314 3300013307 Bacteria 15202
150 Ga0157372_10037615 3300013307 Bacteria 5340
151 Ga0157372_11148458 3300013307 Bacteria 898
152 Ga0157375_10131342 3300013308 Bacteria 2624
153 Ga0157375_10808909 3300013308 Bacteria 1085
154 Ga0163163_10526958 3300014325 Bacteria 1244
155 Ga0157380_10020185 3300014326 Bacteria 4979
156 Ga0157377_10006609 3300014745 Bacteria 5541
157 Ga0157379_10034474 3300014968 Bacteria 4513
158 Ga0157379_10041922 3300014968 Bacteria 4086
159 Ga0157376_10013225 3300014969 Bacteria 6151
160 Ga0157376_10025416 3300014969 Bacteria 4663
161 Ga0163161_10124081 3300017792 Bacteria 1943
162 Ga0163161_10662355 3300017792 Bacteria 866
163 Ga0213872_10026675 3300021361 Bacteria 2653
164 Ga0209435_100001 3300025206 Bacteria 1424171
165 Ga0207425_1001506 3300025245 Bacteria 9637
166 Ga0207425_1015762 3300025245 Bacteria 1689
167 Ga0209646_1000001 3300025246 Bacteria 3092932
168 Ga0209026_1000001 3300025250 Bacteria 1228671
169 Ga0209759_1000001 3300025256 Bacteria 2799452
170 Ga0209565_1000040 3300025263 Bacteria 266543
171 Ga0209565_1000161 3300025263 Bacteria 90019
172 Ga0209565_1003337 3300025263 Bacteria 5247
173 Ga0209673_1000353 3300025273 Bacteria 83670
174 Ga0209673_1000391 3300025273 Bacteria 78867
175 Ga0209673_1034416 3300025273 Bacteria 1530
176 Ga0209130_1000118 3300025284 Bacteria 129005
177 Ga0209130_1000359 3300025284 Bacteria 52040
178 Ga0209675_1000024 3300025291 Bacteria 312615
179 Ga0209675_1003774 3300025291 Bacteria 7012
180 Ga0209675_1008503 3300025291 Bacteria 3760
181 Ga0209676_1000054 3300025292 Bacteria 365890
182 Ga0209676_1004136 3300025292 Bacteria 8260
183 Ga0209025_1003092 3300025294 Bacteria 16327
184 Ga0209025_1006330 3300025294 Bacteria 9231
185 Ga0209025_1025261 3300025294 Bacteria 3030
186 Ga0209025_1043813 3300025294 Bacteria 1879
187 Ga0209025_1068388 3300025294 Bacteria 1276
188 Ga0209564_1000610 3300025295 Bacteria 55376
189 Ga0209564_1000815 3300025295 Bacteria 42475
190 Ga0209564_1024969 3300025295 Bacteria 2026
191 Ga0209758_1053875 3300025297 Bacteria 1378
192 Ga0209050_1000066 3300025298 Bacteria 305458
193 Ga0209050_1018294 3300025298 Bacteria 2731
194 Ga0209050_1046436 3300025298 Bacteria 1141
195 Ga0209256_1000003 3300025299 Bacteria 1661127
196 Ga0209256_1057936 3300025299 Bacteria 912
197 Ga0207426_1000197 3300025302 Bacteria 146366
198 Ga0207426_1000997 3300025302 Bacteria 27622
199 Ga0209051_1000044 3300025303 Bacteria 305458
200 Ga0209051_1000115 3300025303 Bacteria 152010
201 Ga0209051_1000831 3300025303 Bacteria 31813
202 Ga0209051_1044273 3300025303 Bacteria 1552
203 Ga0209257_1000055 3300025304 Bacteria 415534
204 Ga0209257_1000082 3300025304 Bacteria 305458
205 Ga0209257_1026481 3300025304 Bacteria 1953
206 Ga0207656_10012545 3300025321 Bacteria 3225
207 Ga0207656_10016388 3300025321 Bacteria 2884
208 Ga0207682_10124003 3300025893 Bacteria 1148
209 Ga0207688_10026102 3300025901 Bacteria 3210
210 Ga0207688_10320068 3300025901 Bacteria 951
211 Ga0207680_10328320 3300025903 Bacteria 1071
212 Ga0207645_10006016 3300025907 Bacteria 8726
213 Ga0207695_10082917 3300025913 Bacteria 3240
214 Ga0207695_10252836 3300025913 Bacteria 1661
215 Ga0207660_10141700 3300025917 Bacteria 1838
216 Ga0207657_10021545 3300025919 Bacteria 6061
217 Ga0207657_10079164 3300025919 Bacteria 2766
218 Ga0207649_10148826 3300025920 Bacteria 1610
219 Ga0207652_10089225 3300025921 Bacteria 2707
220 Ga0207652_10209242 3300025921 Bacteria 1756
221 Ga0207694_10062632 3300025924 Bacteria 2896
222 Ga0207694_10187049 3300025924 Bacteria 1681
223 Ga0207650_10127240 3300025925 Bacteria 1990
224 Ga0207659_10003197 3300025926 Bacteria 9800
225 Ga0207687_10069875 3300025927 Bacteria 2506
226 Ga0207644_10541392 3300025931 Bacteria 963
227 Ga0207690_10055884 3300025932 Bacteria 2660
228 Ga0207706_10004428 3300025933 Bacteria 13206
229 Ga0207686_10016566 3300025934 Bacteria 4137
230 Ga0207709_10000105 3300025935 Bacteria 130495
231 Ga0207704_10353745 3300025938 Bacteria 1144
232 Ga0207691_10008646 3300025940 Bacteria 9771
233 Ga0207711_10027114 3300025941 Bacteria 4810
234 Ga0207689_10003092 3300025942 Bacteria 15316
235 Ga0207689_10234027 3300025942 Bacteria 1518
236 Ga0207689_10263738 3300025942 Bacteria 1425
237 Ga0207689_10516306 3300025942 Bacteria 1002
238 Ga0207661_10004291 3300025944 Bacteria 9981
239 Ga0207679_10034240 3300025945 Bacteria 3581
240 Ga0207667_10024701 3300025949 Bacteria 6591
241 Ga0207667_10227878 3300025949 Bacteria 1909
242 Ga0207712_10273557 3300025961 Bacteria 1375
243 Ga0207640_10478577 3300025981 Bacteria 1032
244 Ga0207658_10042663 3300025986 Bacteria 3292
245 Ga0207677_10009530 3300026023 Bacteria 5466
246 Ga0207677_10021519 3300026023 Bacteria 3943
247 Ga0207677_10206676 3300026023 Bacteria 1565
248 Ga0207703_10159883 3300026035 Bacteria 1972
249 Ga0207703_10235357 3300026035 Bacteria 1644
250 Ga0207639_10031714 3300026041 Bacteria 3886
251 Ga0207639_10053823 3300026041 Bacteria 3073
252 Ga0207678_10022377 3300026067 Bacteria 5537
253 Ga0207702_10379199 3300026078 Bacteria 1360
254 Ga0207702_10380550 3300026078 Bacteria 1357
255 Ga0207702_10494915 3300026078 Bacteria 1191
256 Ga0207641_10161186 3300026088 Bacteria 2039
257 Ga0207641_11326308 3300026088 Bacteria 720
258 Ga0207648_10264337 3300026089 Bacteria 1536
259 Ga0207676_10002235 3300026095 Bacteria 13907
260 Ga0207676_10372177 3300026095 Bacteria 1327
261 Ga0207674_10038709 3300026116 Bacteria 4945
262 Ga0207675_100004321 3300026118 Bacteria 13726
263 Ga0207698_10248775 3300026142 Bacteria 1625
264 Ga0207698_11111503 3300026142 Bacteria 803
265 Ga0207698_12414408 3300026142 Bacteria 537
266 Ga0209281_1000002 3300027111 Bacteria 1924012
267 Ga0209999_1067638 3300027543 Bacteria 683
268 Ga0209970_1009693 3300027614 Bacteria 1574
269 Ga0209282_1004487 3300027666 Bacteria 8416
270 Ga0209974_10020353 3300027876 Bacteria 2199
271 Ga0209974_10056310 3300027876 Bacteria 1327
272 Ga0268264_10092330 3300028381 Bacteria 2613
273 Ga0316177_1112436 3300030731 Bacteria 4990
274 Ga0316176_1155200 3300030732 Bacteria 1982
275 Ga0314311_1106220 3300030733 Bacteria 8350
276 Ga0316178_1027875 3300030735 Bacteria 7930
277 Ga0316180_1034070 3300030736 Bacteria 2104
278 Ga0316183_1044344 3300030742 Bacteria 6871
279 Ga0316182_1135240 3300030745 Bacteria 841
280 Ga0265332_10000003 3300031238 Bacteria 482849
281 Ga0265331_10161806 3300031250 Bacteria 1014
282 Ga0307513_10000017 3300031456 Bacteria 282386
283 Ga0307513_10000021 3300031456 Bacteria 228078
284 Ga0307408_100000235 3300031548 Bacteria 58041
285 Ga0307408_100000755 3300031548 Bacteria 26051
286 Ga0307408_100096884 3300031548 Bacteria 2239
287 Ga0307408_100219779 3300031548 Bacteria 1549
288 Ga0307408_100580833 3300031548 Bacteria 993
289 Ga0307408_101017731 3300031548 Bacteria 764
290 Ga0307514_10032954 3300031649 Bacteria 4138
291 Ga0307516_10150138 3300031730 Bacteria 2091
292 Ga0307405_10035366 3300031731 Bacteria 2982
293 Ga0307405_11067038 3300031731 Bacteria 692
294 Ga0307413_11003489 3300031824 Bacteria 716
295 Ga0307410_10749074 3300031852 Bacteria 827
296 Ga0307406_10003103 3300031901 Bacteria 9028
297 Ga0307406_10023921 3300031901 Bacteria 3642
298 Ga0307406_10312285 3300031901 Bacteria 1212
299 Ga0307407_10766874 3300031903 Bacteria 731
300 Ga0307412_10021912 3300031911 Bacteria 3908
301 Ga0307412_10099612 3300031911 Bacteria 2052
302 Ga0307412_10121127 3300031911 Bacteria 1884
303 Ga0307412_10199433 3300031911 Bacteria 1518
304 Ga0307412_10540015 3300031911 Bacteria 977
305 Ga0307409_100889328 3300031995 Bacteria 904
306 Ga0307416_100126228 3300032002 Bacteria 2292
307 Ga0307414_10812153 3300032004 Bacteria 853
308 Ga0307411_10122204 3300032005 Bacteria 1886
309 Ga0307411_10165168 3300032005 Bacteria 1663
310 Ga0307411_10929535 3300032005 Bacteria 774
311 Ga0307411_11840854 3300032005 Bacteria 562
312 Ga0373938_0031310 3300034957 Bacteria 1140
313 Ga0373940_0033952 3300035088 Bacteria 1374
314 Ga0373952_0014815 3300035092 Bacteria 1565
315 Ga0373939_0205457 3300035114 Bacteria 747
316 Ga0373931_0002900 3300035691 Bacteria 7647
317 Ga0373931_0352704 3300035691 Bacteria 921
318 Ga0395900_0043174 3300037418 Bacteria 4646
319 Ga0395900_0109421 3300037418 Bacteria 2839
320 Ga0395900_0123229 3300037418 Bacteria 2659
321 Ga0395898_0101573 3300037466 Bacteria 2761
322 Ga0395898_0443756 3300037466 Bacteria 1236
323 Ga0395905_0008622 3300037471 Bacteria 10044
324 Ga0395905_0012926 3300037471 Bacteria 8025
325 Ga0395905_0026012 3300037471 Bacteria 5518
326 Ga0395901_0046555 3300038443 Bacteria 4506
327 Ga0395901_0180108 3300038443 Bacteria 2216
328 Ga0395901_0552072 3300038443 Bacteria 1167
329 Ga0395901_0834041 3300038443 Bacteria 908
330 Ga0395901_0998198 3300038443 Bacteria 813
331 Ga0436361_0241328 3300039447 Bacteria 14795
332 Ga0439436_0021298 3300041404 Bacteria 1927
333 Ga0439439_0005447 3300041406 Bacteria 2906
334 Ga0439439_0012075 3300041406 Bacteria 2084
335 Ga0439447_022240 3300041407 Bacteria 1663
336 Ga0439453_0055517 3300041408 Bacteria 809
337 Ga0439465_0018847 3300041413 Bacteria 2156
338 Ga0451791_0602409 3300041451 Bacteria 1108
339 Ga0451807_2742432 3300041486 Bacteria 1192
340 Ga0451853_3633780 3300041512 Bacteria 1093
341 Ga0439431_0093714 3300041997 Bacteria 820
342 Ga0439433_0012937 3300041999 Bacteria 1832
343 Ga0439437_002334 3300042000 Bacteria 2028
344 Ga0439442_025504 3300042002 Bacteria 1229
345 Ga0439445_0065067 3300042004 Bacteria 1002
346 Ga0439432_069571 3300042006 Bacteria 1075
347 Ga0439432_148791 3300042006 Bacteria 687
348 Ga0439449_0001824 3300042007 Bacteria 8379
349 Ga0439449_0019753 3300042007 Bacteria 2525
350 Ga0439449_0040710 3300042007 Bacteria 1728
351 Ga0439452_007463 3300042010 Bacteria 3347
352 Ga0439454_004903 3300042011 Bacteria 1572
353 Ga0439457_055215 3300042014 Bacteria 895
354 Ga0439462_0017839 3300042015 Bacteria 1840
355 Ga0450912_021836 3300042116 Bacteria 623
356 Ga0450919_003610 3300042121 Bacteria 1921
357 Ga0450920_020209 3300042122 Bacteria 1282
358 Ga0450923_004673 3300042125 Bacteria 2161
359 Ga0450897_005291 3300042128 Bacteria 1113
360 Ga0450894_011007 3300042131 Bacteria 1176
361 Ga0450894_064682 3300042131 Bacteria 554
362 Ga0450898_009138 3300042134 Bacteria 1579
363 Ga0450898_018656 3300042134 Bacteria 1203
364 Ga0450898_024020 3300042134 Bacteria 1087
365 Ga0450898_090082 3300042134 Bacteria 632
366 Ga0450902_026189 3300042137 Bacteria 975
367 Ga0450903_008687 3300042138 Bacteria 1660
368 Ga0450889_015778 3300042144 Bacteria 813
369 Ga0450906_006172 3300042145 Bacteria 2427
370 Ga0450906_016592 3300042145 Bacteria 1332
371 Ga0450910_065780 3300042147 Bacteria 617
372 Ga0439446_0020222 3300042156 Bacteria 1874
373 Ga0439446_0217979 3300042156 Bacteria 649
374 Ga0450908_001492 3300042184 Bacteria 4540
375 Ga0439434_0009659 3300042435 Bacteria 2836
376 Ga0439434_0014796 3300042435 Bacteria 2322
377 Ga0439444_0018584 3300042437 Bacteria 1205
378 Ga0439459_0135471 3300042438 Bacteria 633
379 Ga0439464_0003599 3300042439 Bacteria 3925
380 Ga0450918_000580 3300042531 Bacteria 7798
381 Ga0450893_0006613 3300042532 Bacteria 1877
382 Ga0450893_0011612 3300042532 Bacteria 1457
383 Ga0451577_0000068 3300042876 Bacteria 241923
384 Ga0466969_0070633 3300044656 Bacteria 1679
385 Ga0453683_0079863 3300044673 Bacteria 2048
386 Ga0466966_0035847 3300044684 Bacteria 3204
387 Ga0466966_0557516 3300044684 Bacteria 689
388 Ga0453684_0000126 3300044712 Bacteria 336395
389 Ga0453684_0037089 3300044712 Bacteria 6696
390 Ga0453684_0815032 3300044712 Bacteria 1006
391 Ga0466971_0133523 3300044719 Bacteria 1153
392 Ga0466970_0419320 3300044765 Bacteria 765
393 Ga0466957_0658809 3300044842 Bacteria 736
394 Ga0466960_0263155 3300044901 Bacteria 962
395 Ga0451576_0006589 3300045051 Bacteria 14200
396 Ga0451576_0007283 3300045051 Bacteria 13291
397 Ga0451576_0107690 3300045051 Bacteria 2900
398 Ga0451576_0195927 3300045051 Bacteria 2110
399 Ga0451576_0365126 3300045051 Bacteria 1512
400 Ga0451576_0703714 3300045051 Bacteria 1062
401 Ga0466958_0650816 3300045836 Bacteria 686
402 Ga0466967_0768896 3300045976 Bacteria 956
403 Ga0466967_1063121 3300045976 Bacteria 806
404 Ga0495580_0190335 3300046472 Bacteria 1415
405 Ga0495654_0016403 3300046530 Bacteria 3918
406 Ga0495598_0158886 3300046537 Bacteria 794
407 Ga0495621_0421096 3300046539 Bacteria 568
408 Ga0495656_0080898 3300046615 Bacteria 1466
409 Ga0495625_0000572 3300046660 Bacteria 53759
410 Ga0495615_0027367 3300048090 Bacteria 1338
411 Ga0496100_0051262 3300048903 Bacteria 2678
412 Ga0496101_0607615 3300048904 Bacteria 864
413 Ga0496102_0230111 3300048905 Bacteria 1748
414 Ga0496103_0554862 3300048906 Bacteria 733
415 Ga0496106_0009429 3300048909 Bacteria 7215
416 Ga0496107_0109703 3300048910 Bacteria 2027
417 Ga0496108_0151883 3300048911 Bacteria 1999
418 Ga0496109_0297149 3300048912 Bacteria 1523
419 Ga0496109_0530024 3300048912 Bacteria 1111
420 Ga0496110_0029144 3300048913 Bacteria 4747
421 Ga0496111_0255589 3300048914 Bacteria 1300
422 Ga0496112_0092678 3300048915 Bacteria 2991
423 Ga0496113_0067088 3300048916 Bacteria 2719
424 Ga0496114_0045423 3300048917 Bacteria 3649
425 Ga0496122_0275168 3300048925 Bacteria 924
426 Ga0501310_006301 3300049130 Bacteria 1242
427 Ga0501319_021203 3300049535 Bacteria 584
428 Ga0501034_0430142 3300049571 Bacteria 1240
429 Ga0501047_0820809 3300049581 Bacteria 744
430 Ga0501222_026662 3300049662 Bacteria 785
431 Ga0501257_091861 3300049686 Bacteria 790
432 Ga0501225_0015390 3300049705 Bacteria 2129
433 Ga0501262_000558 3300049759 Bacteria 4446
434 Ga0501273_004744 3300049770 Bacteria 1509
435 nmdc:mga03683_4594_c1 3300050489 Bacteria 4596
436 nmdc:mga03683_66103_c1 3300050489 Bacteria 1537
437 nmdc:mga03n38_11568_c1 3300050490 Bacteria 3293
438 nmdc:mga03n38_52386_c1 3300050490 Bacteria 1826
439 nmdc:mga00v17_413115_c1 3300050491 Bacteria 877
440 nmdc:mga00v17_839446_c1 3300050491 Bacteria 584
441 nmdc:mga0yw44_61333_c1 3300050492 Bacteria 2307
442 nmdc:mga0k408_14552_c1 3300050493 Bacteria 4338
443 nmdc:mga07m45_12737_c2 3300050496 Bacteria 2370
444 nmdc:mga07m45_286149_c1 3300050496 Bacteria 959
445 nmdc:mga07m45_481906_c1 3300050496 Bacteria 719
446 nmdc:mga07m45_84_c1 3300050496 Bacteria 35438
447 nmdc:mga09592_150874_c1 3300050508 Bacteria 2005
448 nmdc:mga0qj67_363149_c1 3300050509 Bacteria 1170
449 nmdc:mga0n895_936373_c1 3300050512 Bacteria 850
450 nmdc:mga0rr50_89535_c1 3300050513 Bacteria 2393
451 Ga0500650_0212810 3300053098 Bacteria 877
452 Ga0500593_044150 3300053117 Bacteria 1988
453 Ga0500628_003530 3300053129 Bacteria 2583
454 Ga0500628_091000 3300053129 Bacteria 795
455 Ga0500634_0107301 3300053161 Bacteria 1385
456 Ga0500645_000214 3300053730 Bacteria 44143
457 Ga0500645_005598 3300053730 Bacteria 4594
458 Ga0500661_078399 3300055283 Bacteria 610

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2932422444 2932423303 149
2 iso_pu_bacteria 2945945610 2945947183 149
3 iso_pu_bacteria 2511231002 2511246231 150
4 iso_pu_bacteria 2547132374 2548498116 150
5 iso_pu_bacteria 2643221570 2643867405 150
6 iso_pu_bacteria 2643221596 2643992096 150
7 iso_pu_bacteria 2643221609 2644063035 150
8 iso_pu_bacteria 2643221611 2644074334 150
9 iso_pu_bacteria 2643221628 2644163092 150
10 iso_pu_bacteria 2643221652 2644295157 150
11 iso_pu_bacteria 2643221717 2644648642 150
12 iso_pu_bacteria 2721755523 2722884849 150
13 iso_pu_bacteria 2738543012 2739246550 150
14 iso_pu_bacteria 2816332133 2816475935 150
15 iso_pu_bacteria 2839138175 2839143287 150
16 iso_pu_bacteria 2842677519 2842682621 150
17 iso_pu_bacteria 2842718218 2842719670 150
18 iso_pu_bacteria 2881101125 2881101642 150
19 iso_pu_bacteria 2919462493 2919464348 150
20 iso_pu_bacteria 2919704043 2919704462 150
21 iso_pu_bacteria 2929520902 2929524769 150
22 iso_pu_bacteria 2945972063 2945976871 150
23 iso_pu_bacteria 2974320154 2974323741 150
24 iso_pu_bacteria 2990710928 2990713341 150
25 3300006048 Ga0075363_100057247 Ga0075363_1000572472 152
26 3300006177 Ga0075362_10003552 Ga0075362_100035521 152
27 3300050489 nmdc:mga03683_4594_c1 nmdc:mga03683_4594_c1_3298_3756 152
28 3300050490 nmdc:mga03n38_52386_c1 nmdc:mga03n38_52386_c1_337_795 152
29 3300005327 Ga0070658_10124413 Ga0070658_101244132 153
30 3300005331 Ga0070670_100136211 Ga0070670_1001362112 153
31 3300005336 Ga0070680_100335688 Ga0070680_1003356882 153
32 3300005353 Ga0070669_101029683 Ga0070669_1010296832 153
33 3300005530 Ga0070679_100013143 Ga0070679_1000131436 153
34 3300005530 Ga0070679_100087550 Ga0070679_1000875504 153
35 3300005563 Ga0068855_100008990 Ga0068855_1000089903 153
36 3300005618 Ga0068864_100467861 Ga0068864_1004678613 153
37 3300005841 Ga0068863_100370735 Ga0068863_1003707352 153
38 3300009093 Ga0105240_10024979 Ga0105240_100249798 153
39 3300009551 Ga0105238_10064347 Ga0105238_100643475 153
40 3300025913 Ga0207695_10082917 Ga0207695_100829173 153
41 3300025917 Ga0207660_10141700 Ga0207660_101417003 153
42 3300025921 Ga0207652_10089225 Ga0207652_100892254 153
43 3300025921 Ga0207652_10209242 Ga0207652_102092422 153
44 3300025925 Ga0207650_10127240 Ga0207650_101272402 153
45 3300025949 Ga0207667_10024701 Ga0207667_100247018 153
46 3300026088 Ga0207641_10161186 Ga0207641_101611862 153
47 3300026095 Ga0207676_10372177 Ga0207676_103721771 153
48 3300031238 Ga0265332_10000003 Ga0265332_10000003162 153
49 3300031548 Ga0307408_100096884 Ga0307408_1000968843 153
50 3300031548 Ga0307408_100580833 Ga0307408_1005808332 153
51 3300031824 Ga0307413_11003489 Ga0307413_110034891 153
52 3300031911 Ga0307412_10121127 Ga0307412_101211273 153
53 3300031911 Ga0307412_10540015 Ga0307412_105400152 153
54 3300031995 Ga0307409_100889328 Ga0307409_1008893282 153
55 3300032002 Ga0307416_100126228 Ga0307416_1001262284 153
56 3300038443 Ga0395901_0552072 Ga0395901_0552072_100_561 153
57 3300041406 Ga0439439_0005447 Ga0439439_0005447_774_1235 153
58 3300042006 Ga0439432_148791 Ga0439432_148791_49_510 153
59 3300042007 Ga0439449_0001824 Ga0439449_0001824_5251_5712 153
60 3300042134 Ga0450898_090082 Ga0450898_090082_48_509 153
61 3300042156 Ga0439446_0020222 Ga0439446_0020222_153_614 153
62 3300044712 Ga0453684_0037089 Ga0453684_0037089_1918_2391 153
63 3300045051 Ga0451576_0006589 Ga0451576_0006589_1753_2226 153
64 3300048912 Ga0496109_0297149 Ga0496109_0297149_45_506 153
65 3300048925 Ga0496122_0275168 Ga0496122_0275168_404_865 153
66 3300049770 Ga0501273_004744 Ga0501273_004744_599_1060 153
67 3300002705 JGI25156J39149_1000002 JGI25156J39149_100000263 154
68 3300002738 JGI25154J39366_1000010 JGI25154J39366_1000010254 154
69 3300002741 JGI25157J39369_1000001 JGI25157J39369_100000184 154
70 3300002774 JGI25150J39212_1006148 JGI25150J39212_10061483 154
71 3300002987 JGI25159J45721_1000336 JGI25159J45721_10003369 154
72 3300002987 JGI25159J45721_1000418 JGI25159J45721_100041812 154
73 3300003187 JGI25151J46595_10057677 JGI25151J46595_100576771 154
74 3300003187 JGI25151J46595_10069671 JGI25151J46595_100696712 154
75 3300003187 JGI25151J46595_10086449 JGI25151J46595_100864492 154
76 3300003187 JGI25151J46595_10127537 JGI25151J46595_101275371 154
77 3300003354 JGI25160J50197_1000342 JGI25160J50197_100034222 154
78 3300003354 JGI25160J50197_1038778 JGI25160J50197_10387782 154
79 3300003374 JGI25161J50226_1000259 JGI25161J50226_100025922 154
80 3300003771 Ga0055526_1004095 Ga0055526_10040953 154
81 3300003771 Ga0055526_1004623 Ga0055526_10046238 154
82 3300003773 Ga0055537_1000102 Ga0055537_100010227 154
83 3300003775 Ga0055524_1000093 Ga0055524_100009377 154
84 3300003781 Ga0055536_1002186 Ga0055536_10021867 154
85 3300003784 Ga0055534_1000251 Ga0055534_10002518 154
86 3300003784 Ga0055534_1003916 Ga0055534_10039162 154
87 3300003790 Ga0055528_1016931 Ga0055528_10169311 154
88 3300003790 Ga0055528_1017193 Ga0055528_10171933 154
89 3300003791 Ga0055530_10000285 Ga0055530_100002859 154
90 3300003791 Ga0055530_10055629 Ga0055530_100556292 154
91 3300003792 Ga0055540_1000196 Ga0055540_100019619 154
92 3300003792 Ga0055540_1014749 Ga0055540_10147492 154
93 3300003794 Ga0055531_10002290 Ga0055531_100022907 154
94 3300004625 Ga0055543_1000527 Ga0055543_10005272 154
95 3300005262 Ga0065165_1025946 Ga0065165_10259463 154
96 3300005262 Ga0065165_1038345 Ga0065165_10383452 154
97 3300005288 Ga0065714_10018834 Ga0065714_100188343 154
98 3300005289 Ga0065704_10182336 Ga0065704_101823362 154
99 3300005329 Ga0070683_100042597 Ga0070683_1000425976 154
100 3300005329 Ga0070683_100371353 Ga0070683_1003713531 154
101 3300005331 Ga0070670_100526810 Ga0070670_1005268102 154
102 3300005333 Ga0070677_10034493 Ga0070677_100344932 154
103 3300005334 Ga0068869_100003710 Ga0068869_1000037106 154
104 3300005338 Ga0068868_100000789 Ga0068868_1000007898 154
105 3300005338 Ga0068868_100109167 Ga0068868_1001091672 154
106 3300005339 Ga0070660_100183328 Ga0070660_1001833283 154
107 3300005339 Ga0070660_100239475 Ga0070660_1002394752 154
108 3300005344 Ga0070661_100294274 Ga0070661_1002942742 154
109 3300005345 Ga0070692_10362636 Ga0070692_103626362 154
110 3300005347 Ga0070668_100155939 Ga0070668_1001559393 154
111 3300005353 Ga0070669_100006970 Ga0070669_1000069706 154
112 3300005354 Ga0070675_100018861 Ga0070675_1000188617 154
113 3300005355 Ga0070671_100630318 Ga0070671_1006303182 154
114 3300005366 Ga0070659_100019568 Ga0070659_1000195685 154
115 3300005366 Ga0070659_100020112 Ga0070659_1000201126 154
116 3300005366 Ga0070659_100225753 Ga0070659_1002257532 154
117 3300005367 Ga0070667_100220914 Ga0070667_1002209143 154
118 3300005367 Ga0070667_100317415 Ga0070667_1003174152 154
119 3300005455 Ga0070663_100006757 Ga0070663_10000675710 154
120 3300005456 Ga0070678_100606356 Ga0070678_1006063562 154
121 3300005457 Ga0070662_100001468 Ga0070662_1000014682 154
122 3300005459 Ga0068867_100230807 Ga0068867_1002308072 154
123 3300005535 Ga0070684_100039911 Ga0070684_1000399112 154
124 3300005535 Ga0070684_100497085 Ga0070684_1004970852 154
125 3300005539 Ga0068853_100018272 Ga0068853_1000182728 154
126 3300005539 Ga0068853_100113610 Ga0068853_1001136102 154
127 3300005539 Ga0068853_100139793 Ga0068853_1001397932 154
128 3300005543 Ga0070672_100031643 Ga0070672_1000316432 154
129 3300005543 Ga0070672_100376898 Ga0070672_1003768982 154
130 3300005547 Ga0070693_100120805 Ga0070693_1001208052 154
131 3300005563 Ga0068855_100280933 Ga0068855_1002809333 154
132 3300005563 Ga0068855_100595386 Ga0068855_1005953862 154
133 3300005564 Ga0070664_100532253 Ga0070664_1005322532 154
134 3300005564 Ga0070664_101530149 Ga0070664_1015301491 154
135 3300005577 Ga0068857_100152614 Ga0068857_1001526143 154
136 3300005578 Ga0068854_100229598 Ga0068854_1002295983 154
137 3300005578 Ga0068854_101436301 Ga0068854_1014363012 154
138 3300005614 Ga0068856_100060104 Ga0068856_1000601045 154
139 3300005615 Ga0070702_100350437 Ga0070702_1003504372 154
140 3300005615 Ga0070702_100641976 Ga0070702_1006419761 154
141 3300005616 Ga0068852_100014734 Ga0068852_1000147343 154
142 3300005616 Ga0068852_100015149 Ga0068852_1000151498 154
143 3300005616 Ga0068852_100099663 Ga0068852_1000996633 154
144 3300005617 Ga0068859_100073840 Ga0068859_1000738402 154
145 3300005618 Ga0068864_100011079 Ga0068864_1000110792 154
146 3300005618 Ga0068864_102171262 Ga0068864_1021712621 154
147 3300005719 Ga0068861_100008404 Ga0068861_1000084042 154
148 3300005834 Ga0068851_10019111 Ga0068851_100191111 154
149 3300005834 Ga0068851_10083282 Ga0068851_100832822 154
150 3300005841 Ga0068863_100096200 Ga0068863_1000962002 154
151 3300005842 Ga0068858_100002253 Ga0068858_10000225315 154
152 3300005842 Ga0068858_100475544 Ga0068858_1004755442 154
153 3300005843 Ga0068860_100092582 Ga0068860_1000925822 154
154 3300005843 Ga0068860_100224213 Ga0068860_1002242132 154
155 3300006038 Ga0075365_10022989 Ga0075365_100229895 154
156 3300006048 Ga0075363_100571596 Ga0075363_1005715961 154
157 3300006051 Ga0075364_10203428 Ga0075364_102034282 154
158 3300006058 Ga0075432_10005092 Ga0075432_100050925 154
159 3300006058 Ga0075432_10015791 Ga0075432_100157913 154
160 3300006177 Ga0075362_10031837 Ga0075362_100318373 154
161 3300006177 Ga0075362_10036633 Ga0075362_100366333 154
162 3300006177 Ga0075362_10069389 Ga0075362_100693892 154
163 3300006177 Ga0075362_10111245 Ga0075362_101112453 154
164 3300006195 Ga0075366_10027067 Ga0075366_100270675 154
165 3300006195 Ga0075366_10518364 Ga0075366_105183642 154
166 3300006237 Ga0097621_100006973 Ga0097621_1000069733 154
167 3300006353 Ga0075370_10032451 Ga0075370_100324512 154
168 3300006353 Ga0075370_10093322 Ga0075370_100933222 154
169 3300006846 Ga0075430_100068438 Ga0075430_1000684383 154
170 3300006871 Ga0075434_100215913 Ga0075434_1002159132 154
171 3300006880 Ga0075429_100089964 Ga0075429_1000899643 154
172 3300006931 Ga0097620_100073840 Ga0097620_1000738402 154
173 3300006946 Ga0079104_1000098 Ga0079104_100009871 154
174 3300006946 Ga0079104_1027952 Ga0079104_10279523 154
175 3300006948 Ga0099826_10045370 Ga0099826_100453705 154
176 3300006948 Ga0099826_10130283 Ga0099826_101302833 154
177 3300007076 Ga0075435_100672888 Ga0075435_1006728882 154
178 3300009092 Ga0105250_10001374 Ga0105250_100013749 154
179 3300009093 Ga0105240_10432472 Ga0105240_104324722 154
180 3300009098 Ga0105245_10114476 Ga0105245_101144763 154
181 3300009098 Ga0105245_10329170 Ga0105245_103291702 154
182 3300009101 Ga0105247_10125752 Ga0105247_101257522 154
183 3300009148 Ga0105243_10005223 Ga0105243_100052234 154
184 3300009174 Ga0105241_10158159 Ga0105241_101581592 154
185 3300009176 Ga0105242_10001377 Ga0105242_100013779 154
186 3300009177 Ga0105248_10017706 Ga0105248_100177063 154
187 3300009545 Ga0105237_10145618 Ga0105237_101456183 154
188 3300009551 Ga0105238_10175560 Ga0105238_101755603 154
189 3300009551 Ga0105238_10302225 Ga0105238_103022252 154
190 3300009553 Ga0105249_11163174 Ga0105249_111631742 154
191 3300010375 Ga0105239_10034575 Ga0105239_100345752 154
192 3300010375 Ga0105239_10339651 Ga0105239_103396512 154
193 3300013100 Ga0157373_10360040 Ga0157373_103600402 154
194 3300013102 Ga0157371_10143156 Ga0157371_101431562 154
195 3300013104 Ga0157370_10433611 Ga0157370_104336112 154
196 3300013104 Ga0157370_10521716 Ga0157370_105217162 154
197 3300013105 Ga0157369_10029614 Ga0157369_100296148 154
198 3300013296 Ga0157374_10009105 Ga0157374_100091052 154
199 3300013296 Ga0157374_10793031 Ga0157374_107930312 154
200 3300013297 Ga0157378_10782372 Ga0157378_107823722 154
201 3300013306 Ga0163162_10024073 Ga0163162_100240738 154
202 3300013307 Ga0157372_10004314 Ga0157372_1000431410 154
203 3300013307 Ga0157372_10037615 Ga0157372_100376155 154
204 3300013307 Ga0157372_11148458 Ga0157372_111484582 154
205 3300013308 Ga0157375_10131342 Ga0157375_101313423 154
206 3300013308 Ga0157375_10808909 Ga0157375_108089092 154
207 3300014325 Ga0163163_10526958 Ga0163163_105269582 154
208 3300014326 Ga0157380_10020185 Ga0157380_100201855 154
209 3300014745 Ga0157377_10006609 Ga0157377_100066095 154
210 3300014968 Ga0157379_10034474 Ga0157379_100344746 154
211 3300014968 Ga0157379_10041922 Ga0157379_100419224 154
212 3300014969 Ga0157376_10013225 Ga0157376_100132258 154
213 3300014969 Ga0157376_10025416 Ga0157376_100254164 154
214 3300017792 Ga0163161_10124081 Ga0163161_101240813 154
215 3300017792 Ga0163161_10662355 Ga0163161_106623552 154
216 3300021361 Ga0213872_10026675 Ga0213872_100266752 154
217 3300025206 Ga0209435_100001 Ga0209435_1000011232 154
218 3300025245 Ga0207425_1001506 Ga0207425_10015064 154
219 3300025245 Ga0207425_1015762 Ga0207425_10157623 154
220 3300025246 Ga0209646_1000001 Ga0209646_10000011601 154
221 3300025250 Ga0209026_1000001 Ga0209026_1000001254 154
222 3300025256 Ga0209759_1000001 Ga0209759_10000011232 154
223 3300025263 Ga0209565_1000040 Ga0209565_1000040169 154
224 3300025263 Ga0209565_1000161 Ga0209565_100016157 154
225 3300025263 Ga0209565_1003337 Ga0209565_10033372 154
226 3300025273 Ga0209673_1000353 Ga0209673_10003538 154
227 3300025273 Ga0209673_1000391 Ga0209673_100039132 154
228 3300025273 Ga0209673_1034416 Ga0209673_10344162 154
229 3300025284 Ga0209130_1000118 Ga0209130_100011818 154
230 3300025284 Ga0209130_1000359 Ga0209130_100035930 154
231 3300025291 Ga0209675_1000024 Ga0209675_100002499 154
232 3300025291 Ga0209675_1003774 Ga0209675_10037743 154
233 3300025291 Ga0209675_1008503 Ga0209675_10085034 154
234 3300025292 Ga0209676_1000054 Ga0209676_1000054104 154
235 3300025292 Ga0209676_1004136 Ga0209676_10041363 154
236 3300025294 Ga0209025_1003092 Ga0209025_10030923 154
237 3300025294 Ga0209025_1006330 Ga0209025_10063303 154
238 3300025294 Ga0209025_1025261 Ga0209025_10252612 154
239 3300025294 Ga0209025_1043813 Ga0209025_10438132 154
240 3300025294 Ga0209025_1068388 Ga0209025_10683882 154
241 3300025295 Ga0209564_1000610 Ga0209564_100061039 154
242 3300025295 Ga0209564_1000815 Ga0209564_100081540 154
243 3300025295 Ga0209564_1024969 Ga0209564_10249693 154
244 3300025297 Ga0209758_1053875 Ga0209758_10538752 154
245 3300025298 Ga0209050_1000066 Ga0209050_1000066104 154
246 3300025298 Ga0209050_1018294 Ga0209050_10182942 154
247 3300025298 Ga0209050_1046436 Ga0209050_10464362 154
248 3300025299 Ga0209256_1000003 Ga0209256_10000031377 154
249 3300025299 Ga0209256_1057936 Ga0209256_10579362 154
250 3300025302 Ga0207426_1000197 Ga0207426_100019740 154
251 3300025302 Ga0207426_1000997 Ga0207426_100099718 154
252 3300025303 Ga0209051_1000044 Ga0209051_1000044104 154
253 3300025303 Ga0209051_1000115 Ga0209051_100011568 154
254 3300025303 Ga0209051_1000831 Ga0209051_100083122 154
255 3300025303 Ga0209051_1044273 Ga0209051_10442733 154
256 3300025304 Ga0209257_1000055 Ga0209257_1000055103 154
257 3300025304 Ga0209257_1000082 Ga0209257_1000082104 154
258 3300025304 Ga0209257_1026481 Ga0209257_10264812 154
259 3300025321 Ga0207656_10012545 Ga0207656_100125451 154
260 3300025321 Ga0207656_10016388 Ga0207656_100163883 154
261 3300025893 Ga0207682_10124003 Ga0207682_101240032 154
262 3300025901 Ga0207688_10026102 Ga0207688_100261023 154
263 3300025901 Ga0207688_10320068 Ga0207688_103200682 154
264 3300025903 Ga0207680_10328320 Ga0207680_103283202 154
265 3300025907 Ga0207645_10006016 Ga0207645_100060168 154
266 3300025913 Ga0207695_10252836 Ga0207695_102528362 154
267 3300025919 Ga0207657_10021545 Ga0207657_100215452 154
268 3300025919 Ga0207657_10079164 Ga0207657_100791642 154
269 3300025920 Ga0207649_10148826 Ga0207649_101488261 154
270 3300025924 Ga0207694_10062632 Ga0207694_100626322 154
271 3300025924 Ga0207694_10187049 Ga0207694_101870492 154
272 3300025926 Ga0207659_10003197 Ga0207659_100031976 154
273 3300025927 Ga0207687_10069875 Ga0207687_100698753 154
274 3300025931 Ga0207644_10541392 Ga0207644_105413922 154
275 3300025932 Ga0207690_10055884 Ga0207690_100558842 154
276 3300025933 Ga0207706_10004428 Ga0207706_1000442812 154
277 3300025934 Ga0207686_10016566 Ga0207686_100165663 154
278 3300025935 Ga0207709_10000105 Ga0207709_1000010549 154
279 3300025938 Ga0207704_10353745 Ga0207704_103537452 154
280 3300025940 Ga0207691_10008646 Ga0207691_1000864611 154
281 3300025941 Ga0207711_10027114 Ga0207711_100271147 154
282 3300025942 Ga0207689_10003092 Ga0207689_1000309211 154
283 3300025942 Ga0207689_10234027 Ga0207689_102340272 154
284 3300025942 Ga0207689_10263738 Ga0207689_102637382 154
285 3300025942 Ga0207689_10516306 Ga0207689_105163062 154
286 3300025944 Ga0207661_10004291 Ga0207661_1000429110 154
287 3300025945 Ga0207679_10034240 Ga0207679_100342403 154
288 3300025949 Ga0207667_10227878 Ga0207667_102278782 154
289 3300025961 Ga0207712_10273557 Ga0207712_102735573 154
290 3300025981 Ga0207640_10478577 Ga0207640_104785772 154
291 3300025986 Ga0207658_10042663 Ga0207658_100426634 154
292 3300026023 Ga0207677_10009530 Ga0207677_100095308 154
293 3300026023 Ga0207677_10021519 Ga0207677_100215194 154
294 3300026023 Ga0207677_10206676 Ga0207677_102066763 154
295 3300026035 Ga0207703_10159883 Ga0207703_101598832 154
296 3300026035 Ga0207703_10235357 Ga0207703_102353572 154
297 3300026041 Ga0207639_10031714 Ga0207639_100317142 154
298 3300026041 Ga0207639_10053823 Ga0207639_100538233 154
299 3300026067 Ga0207678_10022377 Ga0207678_100223772 154
300 3300026078 Ga0207702_10379199 Ga0207702_103791992 154
301 3300026078 Ga0207702_10380550 Ga0207702_103805502 154
302 3300026078 Ga0207702_10494915 Ga0207702_104949152 154
303 3300026088 Ga0207641_11326308 Ga0207641_113263081 154
304 3300026089 Ga0207648_10264337 Ga0207648_102643372 154
305 3300026095 Ga0207676_10002235 Ga0207676_1000223514 154
306 3300026116 Ga0207674_10038709 Ga0207674_100387093 154
307 3300026118 Ga0207675_100004321 Ga0207675_10000432111 154
308 3300026142 Ga0207698_10248775 Ga0207698_102487753 154
309 3300026142 Ga0207698_11111503 Ga0207698_111115032 154
310 3300026142 Ga0207698_12414408 Ga0207698_124144081 154
311 3300027111 Ga0209281_1000002 Ga0209281_10000021715 154
312 3300027543 Ga0209999_1067638 Ga0209999_10676381 154
313 3300027614 Ga0209970_1009693 Ga0209970_10096931 154
314 3300027666 Ga0209282_1004487 Ga0209282_10044878 154
315 3300027876 Ga0209974_10020353 Ga0209974_100203533 154
316 3300027876 Ga0209974_10056310 Ga0209974_100563103 154
317 3300028381 Ga0268264_10092330 Ga0268264_100923303 154
318 3300030731 Ga0316177_1112436 Ga0316177_11124362 154
319 3300030732 Ga0316176_1155200 Ga0316176_11552003 154
320 3300030733 Ga0314311_1106220 Ga0314311_11062202 154
321 3300030735 Ga0316178_1027875 Ga0316178_10278758 154
322 3300030736 Ga0316180_1034070 Ga0316180_10340702 154
323 3300030742 Ga0316183_1044344 Ga0316183_10443447 154
324 3300030745 Ga0316182_1135240 Ga0316182_11352402 154
325 3300031250 Ga0265331_10161806 Ga0265331_101618062 154
326 3300031456 Ga0307513_10000017 Ga0307513_10000017282 154
327 3300031456 Ga0307513_10000021 Ga0307513_10000021185 154
328 3300031548 Ga0307408_100000235 Ga0307408_10000023510 154
329 3300031548 Ga0307408_100000755 Ga0307408_10000075514 154
330 3300031548 Ga0307408_100219779 Ga0307408_1002197793 154
331 3300031548 Ga0307408_101017731 Ga0307408_1010177311 154
332 3300031649 Ga0307514_10032954 Ga0307514_100329547 154
333 3300031730 Ga0307516_10150138 Ga0307516_101501383 154
334 3300031731 Ga0307405_10035366 Ga0307405_100353662 154
335 3300031731 Ga0307405_11067038 Ga0307405_110670382 154
336 3300031852 Ga0307410_10749074 Ga0307410_107490742 154
337 3300031901 Ga0307406_10003103 Ga0307406_100031038 154
338 3300031901 Ga0307406_10023921 Ga0307406_100239214 154
339 3300031901 Ga0307406_10312285 Ga0307406_103122852 154
340 3300031903 Ga0307407_10766874 Ga0307407_107668741 154
341 3300031911 Ga0307412_10021912 Ga0307412_100219123 154
342 3300031911 Ga0307412_10099612 Ga0307412_100996122 154
343 3300031911 Ga0307412_10199433 Ga0307412_101994331 154
344 3300032004 Ga0307414_10812153 Ga0307414_108121532 154
345 3300032005 Ga0307411_10122204 Ga0307411_101222043 154
346 3300032005 Ga0307411_10165168 Ga0307411_101651682 154
347 3300032005 Ga0307411_10929535 Ga0307411_109295352 154
348 3300032005 Ga0307411_11840854 Ga0307411_118408541 154
349 3300034957 Ga0373938_0031310 Ga0373938_0031310_557_1021 154
350 3300035088 Ga0373940_0033952 Ga0373940_0033952_797_1261 154
351 3300035092 Ga0373952_0014815 Ga0373952_0014815_1091_1555 154
352 3300035114 Ga0373939_0205457 Ga0373939_0205457_41_505 154
353 3300035691 Ga0373931_0002900 Ga0373931_0002900_4781_5245 154
354 3300035691 Ga0373931_0352704 Ga0373931_0352704_425_889 154
355 3300037418 Ga0395900_0043174 Ga0395900_0043174_2512_2976 154
356 3300037418 Ga0395900_0109421 Ga0395900_0109421_649_1113 154
357 3300037418 Ga0395900_0123229 Ga0395900_0123229_38_502 154
358 3300037466 Ga0395898_0101573 Ga0395898_0101573_524_988 154
359 3300037466 Ga0395898_0443756 Ga0395898_0443756_565_1029 154
360 3300037471 Ga0395905_0008622 Ga0395905_0008622_2464_2928 154
361 3300037471 Ga0395905_0012926 Ga0395905_0012926_935_1399 154
362 3300037471 Ga0395905_0026012 Ga0395905_0026012_4898_5362 154
363 3300038443 Ga0395901_0046555 Ga0395901_0046555_2476_2940 154
364 3300038443 Ga0395901_0180108 Ga0395901_0180108_174_638 154
365 3300038443 Ga0395901_0834041 Ga0395901_0834041_313_777 154
366 3300038443 Ga0395901_0998198 Ga0395901_0998198_232_696 154
367 3300039447 Ga0436361_0241328 Ga0436361_0241328_11656_12120 154
368 3300041404 Ga0439436_0021298 Ga0439436_0021298_32_502 154
369 3300041406 Ga0439439_0012075 Ga0439439_0012075_983_1453 154
370 3300041407 Ga0439447_022240 Ga0439447_022240_473_943 154
371 3300041408 Ga0439453_0055517 Ga0439453_0055517_190_654 154
372 3300041413 Ga0439465_0018847 Ga0439465_0018847_669_1136 154
373 3300041451 Ga0451791_0602409 Ga0451791_0602409_319_783 154
374 3300041486 Ga0451807_2742432 Ga0451807_2742432_97_561 154
375 3300041512 Ga0451853_3633780 Ga0451853_3633780_561_1034 154
376 3300041997 Ga0439431_0093714 Ga0439431_0093714_52_519 154
377 3300041999 Ga0439433_0012937 Ga0439433_0012937_844_1314 154
378 3300042000 Ga0439437_002334 Ga0439437_002334_909_1373 154
379 3300042002 Ga0439442_025504 Ga0439442_025504_62_532 154
380 3300042004 Ga0439445_0065067 Ga0439445_0065067_357_824 154
381 3300042006 Ga0439432_069571 Ga0439432_069571_496_966 154
382 3300042007 Ga0439449_0019753 Ga0439449_0019753_1653_2123 154
383 3300042007 Ga0439449_0040710 Ga0439449_0040710_587_1054 154
384 3300042010 Ga0439452_007463 Ga0439452_007463_2804_3274 154
385 3300042011 Ga0439454_004903 Ga0439454_004903_846_1310 154
386 3300042014 Ga0439457_055215 Ga0439457_055215_258_728 154
387 3300042015 Ga0439462_0017839 Ga0439462_0017839_195_665 154
388 3300042116 Ga0450912_021836 Ga0450912_021836_57_521 154
389 3300042121 Ga0450919_003610 Ga0450919_003610_673_1140 154
390 3300042122 Ga0450920_020209 Ga0450920_020209_428_895 154
391 3300042125 Ga0450923_004673 Ga0450923_004673_737_1207 154
392 3300042128 Ga0450897_005291 Ga0450897_005291_210_680 154
393 3300042131 Ga0450894_011007 Ga0450894_011007_613_1083 154
394 3300042131 Ga0450894_064682 Ga0450894_064682_67_531 154
395 3300042134 Ga0450898_009138 Ga0450898_009138_875_1339 154
396 3300042134 Ga0450898_018656 Ga0450898_018656_641_1108 154
397 3300042134 Ga0450898_024020 Ga0450898_024020_193_663 154
398 3300042137 Ga0450902_026189 Ga0450902_026189_373_837 154
399 3300042138 Ga0450903_008687 Ga0450903_008687_264_728 154
400 3300042144 Ga0450889_015778 Ga0450889_015778_325_792 154
401 3300042145 Ga0450906_006172 Ga0450906_006172_1051_1518 154
402 3300042145 Ga0450906_016592 Ga0450906_016592_770_1240 154
403 3300042147 Ga0450910_065780 Ga0450910_065780_22_492 154
404 3300042156 Ga0439446_0217979 Ga0439446_0217979_128_592 154
405 3300042184 Ga0450908_001492 Ga0450908_001492_2586_3053 154
406 3300042435 Ga0439434_0009659 Ga0439434_0009659_661_1128 154
407 3300042435 Ga0439434_0014796 Ga0439434_0014796_1082_1552 154
408 3300042437 Ga0439444_0018584 Ga0439444_0018584_66_530 154
409 3300042438 Ga0439459_0135471 Ga0439459_0135471_37_501 154
410 3300042439 Ga0439464_0003599 Ga0439464_0003599_2722_3186 154
411 3300042531 Ga0450918_000580 Ga0450918_000580_1783_2250 154
412 3300042532 Ga0450893_0006613 Ga0450893_0006613_1231_1695 154
413 3300042532 Ga0450893_0011612 Ga0450893_0011612_783_1247 154
414 3300042876 Ga0451577_0000068 Ga0451577_0000068_150554_151018 154
415 3300044656 Ga0466969_0070633 Ga0466969_0070633_111_575 154
416 3300044673 Ga0453683_0079863 Ga0453683_0079863_474_938 154
417 3300044684 Ga0466966_0035847 Ga0466966_0035847_2570_3034 154
418 3300044684 Ga0466966_0557516 Ga0466966_0557516_209_673 154
419 3300044712 Ga0453684_0000126 Ga0453684_0000126_60505_60969 154
420 3300044712 Ga0453684_0815032 Ga0453684_0815032_426_890 154
421 3300044719 Ga0466971_0133523 Ga0466971_0133523_591_1055 154
422 3300044765 Ga0466970_0419320 Ga0466970_0419320_233_697 154
423 3300044842 Ga0466957_0658809 Ga0466957_0658809_184_648 154
424 3300044901 Ga0466960_0263155 Ga0466960_0263155_413_877 154
425 3300045051 Ga0451576_0007283 Ga0451576_0007283_1263_1727 154
426 3300045051 Ga0451576_0107690 Ga0451576_0107690_917_1381 154
427 3300045051 Ga0451576_0195927 Ga0451576_0195927_902_1366 154
428 3300045051 Ga0451576_0365126 Ga0451576_0365126_769_1233 154
429 3300045051 Ga0451576_0703714 Ga0451576_0703714_313_789 154
430 3300045836 Ga0466958_0650816 Ga0466958_0650816_56_520 154
431 3300045976 Ga0466967_0768896 Ga0466967_0768896_32_496 154
432 3300045976 Ga0466967_1063121 Ga0466967_1063121_18_482 154
433 3300046472 Ga0495580_0190335 Ga0495580_0190335_42_506 154
434 3300046530 Ga0495654_0016403 Ga0495654_0016403_712_1188 154
435 3300046537 Ga0495598_0158886 Ga0495598_0158886_228_692 154
436 3300046539 Ga0495621_0421096 Ga0495621_0421096_22_486 154
437 3300046615 Ga0495656_0080898 Ga0495656_0080898_221_685 154
438 3300046660 Ga0495625_0000572 Ga0495625_0000572_42012_42479 154
439 3300048090 Ga0495615_0027367 Ga0495615_0027367_235_699 154
440 3300048903 Ga0496100_0051262 Ga0496100_0051262_1916_2380 154
441 3300048904 Ga0496101_0607615 Ga0496101_0607615_279_743 154
442 3300048905 Ga0496102_0230111 Ga0496102_0230111_268_732 154
443 3300048906 Ga0496103_0554862 Ga0496103_0554862_215_679 154
444 3300048909 Ga0496106_0009429 Ga0496106_0009429_468_932 154
445 3300048910 Ga0496107_0109703 Ga0496107_0109703_1439_1903 154
446 3300048911 Ga0496108_0151883 Ga0496108_0151883_219_683 154
447 3300048912 Ga0496109_0530024 Ga0496109_0530024_264_728 154
448 3300048913 Ga0496110_0029144 Ga0496110_0029144_514_978 154
449 3300048914 Ga0496111_0255589 Ga0496111_0255589_514_978 154
450 3300048915 Ga0496112_0092678 Ga0496112_0092678_919_1383 154
451 3300048916 Ga0496113_0067088 Ga0496113_0067088_172_636 154
452 3300048917 Ga0496114_0045423 Ga0496114_0045423_1372_1836 154
453 3300049130 Ga0501310_006301 Ga0501310_006301_452_919 154
454 3300049535 Ga0501319_021203 Ga0501319_021203_28_495 154
455 3300049571 Ga0501034_0430142 Ga0501034_0430142_389_865 154
456 3300049581 Ga0501047_0820809 Ga0501047_0820809_32_496 154
457 3300049662 Ga0501222_026662 Ga0501222_026662_287_751 154
458 3300049686 Ga0501257_091861 Ga0501257_091861_287_751 154
459 3300049705 Ga0501225_0015390 Ga0501225_0015390_788_1255 154
460 3300049759 Ga0501262_000558 Ga0501262_000558_543_1010 154
461 3300050489 nmdc:mga03683_66103_c1 nmdc:mga03683_66103_c1_216_686 154
462 3300050490 nmdc:mga03n38_11568_c1 nmdc:mga03n38_11568_c1_1375_1842 154
463 3300050491 nmdc:mga00v17_413115_c1 nmdc:mga00v17_413115_c1_102_569 154
464 3300050491 nmdc:mga00v17_839446_c1 nmdc:mga00v17_839446_c1_68_532 154
465 3300050492 nmdc:mga0yw44_61333_c1 nmdc:mga0yw44_61333_c1_438_905 154
466 3300050493 nmdc:mga0k408_14552_c1 nmdc:mga0k408_14552_c1_209_676 154
467 3300050496 nmdc:mga07m45_12737_c2 nmdc:mga07m45_12737_c2_734_1201 154
468 3300050496 nmdc:mga07m45_286149_c1 nmdc:mga07m45_286149_c1_226_696 154
469 3300050496 nmdc:mga07m45_481906_c1 nmdc:mga07m45_481906_c1_66_530 154
470 3300050496 nmdc:mga07m45_84_c1 nmdc:mga07m45_84_c1_3888_4355 154
471 3300050508 nmdc:mga09592_150874_c1 nmdc:mga09592_150874_c1_551_1015 154
472 3300050509 nmdc:mga0qj67_363149_c1 nmdc:mga0qj67_363149_c1_388_852 154
473 3300050512 nmdc:mga0n895_936373_c1 nmdc:mga0n895_936373_c1_140_604 154
474 3300050513 nmdc:mga0rr50_89535_c1 nmdc:mga0rr50_89535_c1_149_613 154
475 3300053098 Ga0500650_0212810 Ga0500650_0212810_187_651 154
476 3300053117 Ga0500593_044150 Ga0500593_044150_1326_1790 154
477 3300053129 Ga0500628_003530 Ga0500628_003530_1299_1763 154
478 3300053129 Ga0500628_091000 Ga0500628_091000_317_781 154
479 3300053161 Ga0500634_0107301 Ga0500634_0107301_142_606 154
480 3300053730 Ga0500645_000214 Ga0500645_000214_15029_15493 154
481 3300053730 Ga0500645_005598 Ga0500645_005598_3375_3839 154
482 3300055283 Ga0500661_078399 Ga0500661_078399_10_474 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

45

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a4f-assembly1.cif.gz_AI aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) 0.9926 15 83
7a4h-assembly1.cif.gz_BI aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9781 15 81
7a4f-assembly1.cif.gz_AC aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) 0.974 11 83
7a4h-assembly1.cif.gz_BB aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9726 11 81
7a4h-assembly1.cif.gz_BK aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9717 11 81
ID Description Score Start End Superfamily
1nqwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9617 11 154 3.40.50.960
af_Q57751_4_141_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9468 17 153 3.40.50.960
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9335 12 154 3.40.50.960
3mk3100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9318 5 152 3.40.50.960
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9288 11 154 3.40.50.960
ID Description Score Start End GO Terms
AF-A0A519F3S4-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) 0.9889 14 154 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A415CIA9-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9886 12 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A6N0ZF49-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9842 11 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A519F3S4-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) 0.9819 14 154 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A537D277-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) 0.9816 23 153 GO:0000906
GO:0005829
GO:0009231
GO:0009349

Feature Viewer

pLDDT pTM Quality
93.45 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map