F452632
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 482 | 321 | 458 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300027543|Ga0209999_1067638|Ga0209999_10676381 |
| Length | 183 |
| Sequence | MPDLAFSSATLDDVDALVALVTSAYRGDASRAGWTTEADLLDGKRLHIGIVQARFNEAITDTLFSACQAELLALGVQEKNIAHVKVPGALEVPVALQAMAELDEYDALIALGCIIRGETYHFELVANESAAGVTRIALDYQLPIANAILTTENMDQAIARQLEKGRDAAQVAIEMANLLEDIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 4 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 5 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 6 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 7 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 8 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 9 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 10 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 11 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 12 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 13 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 14 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 15 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 16 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 17 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 18 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 19 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 20 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 21 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 22 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 23 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 24 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 25 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 26 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 27 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 28 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 29 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 30 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 31 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 32 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 44 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 98 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 187 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 193 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 194 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 195 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 196 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 197 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 198 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 216 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 226 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 227 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 228 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 234 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 235 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 236 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 237 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 238 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 239 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 240 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 241 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 242 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 243 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 244 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 245 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 246 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 247 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 248 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 249 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 250 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 251 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 252 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 253 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 254 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 255 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 256 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 257 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 258 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 259 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 260 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 261 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 262 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 263 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 264 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 265 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 266 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 273 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 302 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 303 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 305 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 306 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 307 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 308 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 309 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 311 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 317 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 318 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 319 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 320 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 321 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.61 |
| Metatranscriptomes | 0.41 |
| Isolates | 4.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.33 |
| Nodule | 1.24 |
| Rhizoplane | 3.32 |
| Rhizosphere | 69.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000002 | 3300002705 | Bacteria | 343501 |
| 2 | JGI25154J39366_1000010 | 3300002738 | Bacteria | 297985 |
| 3 | JGI25157J39369_1000001 | 3300002741 | Bacteria | 363277 |
| 4 | JGI25150J39212_1006148 | 3300002774 | Bacteria | 2505 |
| 5 | JGI25159J45721_1000336 | 3300002987 | Bacteria | 21694 |
| 6 | JGI25159J45721_1000418 | 3300002987 | Bacteria | 19658 |
| 7 | JGI25151J46595_10057677 | 3300003187 | Bacteria | 1264 |
| 8 | JGI25151J46595_10069671 | 3300003187 | Bacteria | 1072 |
| 9 | JGI25151J46595_10086449 | 3300003187 | Bacteria | 888 |
| 10 | JGI25151J46595_10127537 | 3300003187 | Bacteria | 639 |
| 11 | JGI25160J50197_1000342 | 3300003354 | Bacteria | 31433 |
| 12 | JGI25160J50197_1038778 | 3300003354 | Bacteria | 1123 |
| 13 | JGI25161J50226_1000259 | 3300003374 | Bacteria | 31433 |
| 14 | Ga0055526_1004095 | 3300003771 | Bacteria | 8904 |
| 15 | Ga0055526_1004623 | 3300003771 | Bacteria | 8201 |
| 16 | Ga0055537_1000102 | 3300003773 | Bacteria | 63809 |
| 17 | Ga0055524_1000093 | 3300003775 | Bacteria | 111953 |
| 18 | Ga0055536_1002186 | 3300003781 | Bacteria | 11135 |
| 19 | Ga0055534_1000251 | 3300003784 | Bacteria | 37571 |
| 20 | Ga0055534_1003916 | 3300003784 | Bacteria | 4509 |
| 21 | Ga0055528_1016931 | 3300003790 | Bacteria | 2550 |
| 22 | Ga0055528_1017193 | 3300003790 | Bacteria | 2519 |
| 23 | Ga0055530_10000285 | 3300003791 | Bacteria | 46054 |
| 24 | Ga0055530_10055629 | 3300003791 | Bacteria | 901 |
| 25 | Ga0055540_1000196 | 3300003792 | Bacteria | 58476 |
| 26 | Ga0055540_1014749 | 3300003792 | Bacteria | 2312 |
| 27 | Ga0055531_10002290 | 3300003794 | Bacteria | 12955 |
| 28 | Ga0055543_1000527 | 3300004625 | Bacteria | 21646 |
| 29 | Ga0065165_1025946 | 3300005262 | Bacteria | 1936 |
| 30 | Ga0065165_1038345 | 3300005262 | Bacteria | 1445 |
| 31 | Ga0065714_10018834 | 3300005288 | Bacteria | 2452 |
| 32 | Ga0065704_10182336 | 3300005289 | Bacteria | 1231 |
| 33 | Ga0070658_10124413 | 3300005327 | Bacteria | 2145 |
| 34 | Ga0070683_100042597 | 3300005329 | Bacteria | 4181 |
| 35 | Ga0070683_100371353 | 3300005329 | Bacteria | 1362 |
| 36 | Ga0070670_100136211 | 3300005331 | Bacteria | 2122 |
| 37 | Ga0070670_100526810 | 3300005331 | Bacteria | 1053 |
| 38 | Ga0070677_10034493 | 3300005333 | Bacteria | 1956 |
| 39 | Ga0068869_100003710 | 3300005334 | Bacteria | 9400 |
| 40 | Ga0070680_100335688 | 3300005336 | Bacteria | 1284 |
| 41 | Ga0068868_100000789 | 3300005338 | Bacteria | 21436 |
| 42 | Ga0068868_100109167 | 3300005338 | Bacteria | 2247 |
| 43 | Ga0070660_100183328 | 3300005339 | Bacteria | 1695 |
| 44 | Ga0070660_100239475 | 3300005339 | Bacteria | 1478 |
| 45 | Ga0070661_100294274 | 3300005344 | Bacteria | 1262 |
| 46 | Ga0070692_10362636 | 3300005345 | Bacteria | 904 |
| 47 | Ga0070668_100155939 | 3300005347 | Bacteria | 1850 |
| 48 | Ga0070669_100006970 | 3300005353 | Bacteria | 8120 |
| 49 | Ga0070669_101029683 | 3300005353 | Bacteria | 707 |
| 50 | Ga0070675_100018861 | 3300005354 | Bacteria | 5493 |
| 51 | Ga0070671_100630318 | 3300005355 | Bacteria | 927 |
| 52 | Ga0070659_100019568 | 3300005366 | Bacteria | 5133 |
| 53 | Ga0070659_100020112 | 3300005366 | Bacteria | 5068 |
| 54 | Ga0070659_100225753 | 3300005366 | Bacteria | 1547 |
| 55 | Ga0070667_100220914 | 3300005367 | Bacteria | 1686 |
| 56 | Ga0070667_100317415 | 3300005367 | Bacteria | 1406 |
| 57 | Ga0070663_100006757 | 3300005455 | Bacteria | 6931 |
| 58 | Ga0070678_100606356 | 3300005456 | Bacteria | 978 |
| 59 | Ga0070662_100001468 | 3300005457 | Bacteria | 14517 |
| 60 | Ga0068867_100230807 | 3300005459 | Bacteria | 1496 |
| 61 | Ga0070679_100013143 | 3300005530 | Bacteria | 7926 |
| 62 | Ga0070679_100087550 | 3300005530 | Bacteria | 3102 |
| 63 | Ga0070684_100039911 | 3300005535 | Bacteria | 4039 |
| 64 | Ga0070684_100497085 | 3300005535 | Bacteria | 1129 |
| 65 | Ga0068853_100018272 | 3300005539 | Bacteria | 5801 |
| 66 | Ga0068853_100113610 | 3300005539 | Bacteria | 2408 |
| 67 | Ga0068853_100139793 | 3300005539 | Bacteria | 2173 |
| 68 | Ga0070672_100031643 | 3300005543 | Bacteria | 3984 |
| 69 | Ga0070672_100376898 | 3300005543 | Bacteria | 1213 |
| 70 | Ga0070693_100120805 | 3300005547 | Bacteria | 1625 |
| 71 | Ga0068855_100008990 | 3300005563 | Bacteria | 12069 |
| 72 | Ga0068855_100280933 | 3300005563 | Bacteria | 1849 |
| 73 | Ga0068855_100595386 | 3300005563 | Bacteria | 1193 |
| 74 | Ga0070664_100532253 | 3300005564 | Bacteria | 1085 |
| 75 | Ga0070664_101530149 | 3300005564 | Bacteria | 631 |
| 76 | Ga0068857_100152614 | 3300005577 | Bacteria | 2093 |
| 77 | Ga0068854_100229598 | 3300005578 | Bacteria | 1472 |
| 78 | Ga0068854_101436301 | 3300005578 | Bacteria | 625 |
| 79 | Ga0068856_100060104 | 3300005614 | Bacteria | 3755 |
| 80 | Ga0070702_100350437 | 3300005615 | Bacteria | 1040 |
| 81 | Ga0070702_100641976 | 3300005615 | Bacteria | 802 |
| 82 | Ga0068852_100014734 | 3300005616 | Bacteria | 6033 |
| 83 | Ga0068852_100015149 | 3300005616 | Bacteria | 5967 |
| 84 | Ga0068852_100099663 | 3300005616 | Bacteria | 2619 |
| 85 | Ga0068859_100073840 | 3300005617 | Bacteria | 3449 |
| 86 | Ga0068864_100011079 | 3300005618 | Bacteria | 7451 |
| 87 | Ga0068864_100467861 | 3300005618 | Bacteria | 1208 |
| 88 | Ga0068864_102171262 | 3300005618 | Bacteria | 562 |
| 89 | Ga0068861_100008404 | 3300005719 | Bacteria | 7107 |
| 90 | Ga0068851_10019111 | 3300005834 | Bacteria | 3310 |
| 91 | Ga0068851_10083282 | 3300005834 | Bacteria | 1673 |
| 92 | Ga0068863_100096200 | 3300005841 | Bacteria | 2811 |
| 93 | Ga0068863_100370735 | 3300005841 | Bacteria | 1397 |
| 94 | Ga0068858_100002253 | 3300005842 | Bacteria | 19492 |
| 95 | Ga0068858_100475544 | 3300005842 | Bacteria | 1206 |
| 96 | Ga0068860_100092582 | 3300005843 | Bacteria | 2880 |
| 97 | Ga0068860_100224213 | 3300005843 | Bacteria | 1826 |
| 98 | Ga0075365_10022989 | 3300006038 | Bacteria | 3915 |
| 99 | Ga0075363_100057247 | 3300006048 | Bacteria | 2091 |
| 100 | Ga0075363_100571596 | 3300006048 | Bacteria | 676 |
| 101 | Ga0075364_10203428 | 3300006051 | Bacteria | 1342 |
| 102 | Ga0075432_10005092 | 3300006058 | Bacteria | 4477 |
| 103 | Ga0075432_10015791 | 3300006058 | Bacteria | 2576 |
| 104 | Ga0075362_10003552 | 3300006177 | Bacteria | 5470 |
| 105 | Ga0075362_10031837 | 3300006177 | Bacteria | 2285 |
| 106 | Ga0075362_10036633 | 3300006177 | Bacteria | 2147 |
| 107 | Ga0075362_10069389 | 3300006177 | Bacteria | 1607 |
| 108 | Ga0075362_10111245 | 3300006177 | Bacteria | 1289 |
| 109 | Ga0075366_10027067 | 3300006195 | Bacteria | 3363 |
| 110 | Ga0075366_10518364 | 3300006195 | Bacteria | 737 |
| 111 | Ga0097621_100006973 | 3300006237 | Bacteria | 8046 |
| 112 | Ga0075370_10032451 | 3300006353 | Bacteria | 2920 |
| 113 | Ga0075370_10093322 | 3300006353 | Bacteria | 1738 |
| 114 | Ga0075430_100068438 | 3300006846 | Bacteria | 2978 |
| 115 | Ga0075434_100215913 | 3300006871 | Bacteria | 1938 |
| 116 | Ga0075429_100089964 | 3300006880 | Bacteria | 2677 |
| 117 | Ga0097620_100073840 | 3300006931 | Bacteria | 3449 |
| 118 | Ga0079104_1000098 | 3300006946 | Bacteria | 129064 |
| 119 | Ga0079104_1027952 | 3300006946 | Bacteria | 1439 |
| 120 | Ga0099826_10045370 | 3300006948 | Bacteria | 3005 |
| 121 | Ga0099826_10130283 | 3300006948 | Bacteria | 1468 |
| 122 | Ga0075435_100672888 | 3300007076 | Unclassified | 899 |
| 123 | Ga0105250_10001374 | 3300009092 | Bacteria | 13189 |
| 124 | Ga0105240_10024979 | 3300009093 | Bacteria | 7864 |
| 125 | Ga0105240_10432472 | 3300009093 | Bacteria | 1476 |
| 126 | Ga0105245_10114476 | 3300009098 | Bacteria | 2512 |
| 127 | Ga0105245_10329170 | 3300009098 | Bacteria | 1507 |
| 128 | Ga0105247_10125752 | 3300009101 | Bacteria | 1666 |
| 129 | Ga0105243_10005223 | 3300009148 | Bacteria | 10159 |
| 130 | Ga0105241_10158159 | 3300009174 | Bacteria | 1860 |
| 131 | Ga0105242_10001377 | 3300009176 | Bacteria | 19163 |
| 132 | Ga0105248_10017706 | 3300009177 | Bacteria | 7859 |
| 133 | Ga0105237_10145618 | 3300009545 | Bacteria | 2364 |
| 134 | Ga0105238_10064347 | 3300009551 | Bacteria | 3667 |
| 135 | Ga0105238_10175560 | 3300009551 | Bacteria | 2119 |
| 136 | Ga0105238_10302225 | 3300009551 | Bacteria | 1584 |
| 137 | Ga0105249_11163174 | 3300009553 | Bacteria | 842 |
| 138 | Ga0105239_10034575 | 3300010375 | Bacteria | 5550 |
| 139 | Ga0105239_10339651 | 3300010375 | Bacteria | 1695 |
| 140 | Ga0157373_10360040 | 3300013100 | Bacteria | 1038 |
| 141 | Ga0157371_10143156 | 3300013102 | Bacteria | 1703 |
| 142 | Ga0157370_10433611 | 3300013104 | Bacteria | 1208 |
| 143 | Ga0157370_10521716 | 3300013104 | Bacteria | 1090 |
| 144 | Ga0157369_10029614 | 3300013105 | Bacteria | 6047 |
| 145 | Ga0157374_10009105 | 3300013296 | Bacteria | 8508 |
| 146 | Ga0157374_10793031 | 3300013296 | Bacteria | 963 |
| 147 | Ga0157378_10782372 | 3300013297 | Bacteria | 979 |
| 148 | Ga0163162_10024073 | 3300013306 | Bacteria | 6009 |
| 149 | Ga0157372_10004314 | 3300013307 | Bacteria | 15202 |
| 150 | Ga0157372_10037615 | 3300013307 | Bacteria | 5340 |
| 151 | Ga0157372_11148458 | 3300013307 | Bacteria | 898 |
| 152 | Ga0157375_10131342 | 3300013308 | Bacteria | 2624 |
| 153 | Ga0157375_10808909 | 3300013308 | Bacteria | 1085 |
| 154 | Ga0163163_10526958 | 3300014325 | Bacteria | 1244 |
| 155 | Ga0157380_10020185 | 3300014326 | Bacteria | 4979 |
| 156 | Ga0157377_10006609 | 3300014745 | Bacteria | 5541 |
| 157 | Ga0157379_10034474 | 3300014968 | Bacteria | 4513 |
| 158 | Ga0157379_10041922 | 3300014968 | Bacteria | 4086 |
| 159 | Ga0157376_10013225 | 3300014969 | Bacteria | 6151 |
| 160 | Ga0157376_10025416 | 3300014969 | Bacteria | 4663 |
| 161 | Ga0163161_10124081 | 3300017792 | Bacteria | 1943 |
| 162 | Ga0163161_10662355 | 3300017792 | Bacteria | 866 |
| 163 | Ga0213872_10026675 | 3300021361 | Bacteria | 2653 |
| 164 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 165 | Ga0207425_1001506 | 3300025245 | Bacteria | 9637 |
| 166 | Ga0207425_1015762 | 3300025245 | Bacteria | 1689 |
| 167 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 168 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 169 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 170 | Ga0209565_1000040 | 3300025263 | Bacteria | 266543 |
| 171 | Ga0209565_1000161 | 3300025263 | Bacteria | 90019 |
| 172 | Ga0209565_1003337 | 3300025263 | Bacteria | 5247 |
| 173 | Ga0209673_1000353 | 3300025273 | Bacteria | 83670 |
| 174 | Ga0209673_1000391 | 3300025273 | Bacteria | 78867 |
| 175 | Ga0209673_1034416 | 3300025273 | Bacteria | 1530 |
| 176 | Ga0209130_1000118 | 3300025284 | Bacteria | 129005 |
| 177 | Ga0209130_1000359 | 3300025284 | Bacteria | 52040 |
| 178 | Ga0209675_1000024 | 3300025291 | Bacteria | 312615 |
| 179 | Ga0209675_1003774 | 3300025291 | Bacteria | 7012 |
| 180 | Ga0209675_1008503 | 3300025291 | Bacteria | 3760 |
| 181 | Ga0209676_1000054 | 3300025292 | Bacteria | 365890 |
| 182 | Ga0209676_1004136 | 3300025292 | Bacteria | 8260 |
| 183 | Ga0209025_1003092 | 3300025294 | Bacteria | 16327 |
| 184 | Ga0209025_1006330 | 3300025294 | Bacteria | 9231 |
| 185 | Ga0209025_1025261 | 3300025294 | Bacteria | 3030 |
| 186 | Ga0209025_1043813 | 3300025294 | Bacteria | 1879 |
| 187 | Ga0209025_1068388 | 3300025294 | Bacteria | 1276 |
| 188 | Ga0209564_1000610 | 3300025295 | Bacteria | 55376 |
| 189 | Ga0209564_1000815 | 3300025295 | Bacteria | 42475 |
| 190 | Ga0209564_1024969 | 3300025295 | Bacteria | 2026 |
| 191 | Ga0209758_1053875 | 3300025297 | Bacteria | 1378 |
| 192 | Ga0209050_1000066 | 3300025298 | Bacteria | 305458 |
| 193 | Ga0209050_1018294 | 3300025298 | Bacteria | 2731 |
| 194 | Ga0209050_1046436 | 3300025298 | Bacteria | 1141 |
| 195 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 196 | Ga0209256_1057936 | 3300025299 | Bacteria | 912 |
| 197 | Ga0207426_1000197 | 3300025302 | Bacteria | 146366 |
| 198 | Ga0207426_1000997 | 3300025302 | Bacteria | 27622 |
| 199 | Ga0209051_1000044 | 3300025303 | Bacteria | 305458 |
| 200 | Ga0209051_1000115 | 3300025303 | Bacteria | 152010 |
| 201 | Ga0209051_1000831 | 3300025303 | Bacteria | 31813 |
| 202 | Ga0209051_1044273 | 3300025303 | Bacteria | 1552 |
| 203 | Ga0209257_1000055 | 3300025304 | Bacteria | 415534 |
| 204 | Ga0209257_1000082 | 3300025304 | Bacteria | 305458 |
| 205 | Ga0209257_1026481 | 3300025304 | Bacteria | 1953 |
| 206 | Ga0207656_10012545 | 3300025321 | Bacteria | 3225 |
| 207 | Ga0207656_10016388 | 3300025321 | Bacteria | 2884 |
| 208 | Ga0207682_10124003 | 3300025893 | Bacteria | 1148 |
| 209 | Ga0207688_10026102 | 3300025901 | Bacteria | 3210 |
| 210 | Ga0207688_10320068 | 3300025901 | Bacteria | 951 |
| 211 | Ga0207680_10328320 | 3300025903 | Bacteria | 1071 |
| 212 | Ga0207645_10006016 | 3300025907 | Bacteria | 8726 |
| 213 | Ga0207695_10082917 | 3300025913 | Bacteria | 3240 |
| 214 | Ga0207695_10252836 | 3300025913 | Bacteria | 1661 |
| 215 | Ga0207660_10141700 | 3300025917 | Bacteria | 1838 |
| 216 | Ga0207657_10021545 | 3300025919 | Bacteria | 6061 |
| 217 | Ga0207657_10079164 | 3300025919 | Bacteria | 2766 |
| 218 | Ga0207649_10148826 | 3300025920 | Bacteria | 1610 |
| 219 | Ga0207652_10089225 | 3300025921 | Bacteria | 2707 |
| 220 | Ga0207652_10209242 | 3300025921 | Bacteria | 1756 |
| 221 | Ga0207694_10062632 | 3300025924 | Bacteria | 2896 |
| 222 | Ga0207694_10187049 | 3300025924 | Bacteria | 1681 |
| 223 | Ga0207650_10127240 | 3300025925 | Bacteria | 1990 |
| 224 | Ga0207659_10003197 | 3300025926 | Bacteria | 9800 |
| 225 | Ga0207687_10069875 | 3300025927 | Bacteria | 2506 |
| 226 | Ga0207644_10541392 | 3300025931 | Bacteria | 963 |
| 227 | Ga0207690_10055884 | 3300025932 | Bacteria | 2660 |
| 228 | Ga0207706_10004428 | 3300025933 | Bacteria | 13206 |
| 229 | Ga0207686_10016566 | 3300025934 | Bacteria | 4137 |
| 230 | Ga0207709_10000105 | 3300025935 | Bacteria | 130495 |
| 231 | Ga0207704_10353745 | 3300025938 | Bacteria | 1144 |
| 232 | Ga0207691_10008646 | 3300025940 | Bacteria | 9771 |
| 233 | Ga0207711_10027114 | 3300025941 | Bacteria | 4810 |
| 234 | Ga0207689_10003092 | 3300025942 | Bacteria | 15316 |
| 235 | Ga0207689_10234027 | 3300025942 | Bacteria | 1518 |
| 236 | Ga0207689_10263738 | 3300025942 | Bacteria | 1425 |
| 237 | Ga0207689_10516306 | 3300025942 | Bacteria | 1002 |
| 238 | Ga0207661_10004291 | 3300025944 | Bacteria | 9981 |
| 239 | Ga0207679_10034240 | 3300025945 | Bacteria | 3581 |
| 240 | Ga0207667_10024701 | 3300025949 | Bacteria | 6591 |
| 241 | Ga0207667_10227878 | 3300025949 | Bacteria | 1909 |
| 242 | Ga0207712_10273557 | 3300025961 | Bacteria | 1375 |
| 243 | Ga0207640_10478577 | 3300025981 | Bacteria | 1032 |
| 244 | Ga0207658_10042663 | 3300025986 | Bacteria | 3292 |
| 245 | Ga0207677_10009530 | 3300026023 | Bacteria | 5466 |
| 246 | Ga0207677_10021519 | 3300026023 | Bacteria | 3943 |
| 247 | Ga0207677_10206676 | 3300026023 | Bacteria | 1565 |
| 248 | Ga0207703_10159883 | 3300026035 | Bacteria | 1972 |
| 249 | Ga0207703_10235357 | 3300026035 | Bacteria | 1644 |
| 250 | Ga0207639_10031714 | 3300026041 | Bacteria | 3886 |
| 251 | Ga0207639_10053823 | 3300026041 | Bacteria | 3073 |
| 252 | Ga0207678_10022377 | 3300026067 | Bacteria | 5537 |
| 253 | Ga0207702_10379199 | 3300026078 | Bacteria | 1360 |
| 254 | Ga0207702_10380550 | 3300026078 | Bacteria | 1357 |
| 255 | Ga0207702_10494915 | 3300026078 | Bacteria | 1191 |
| 256 | Ga0207641_10161186 | 3300026088 | Bacteria | 2039 |
| 257 | Ga0207641_11326308 | 3300026088 | Bacteria | 720 |
| 258 | Ga0207648_10264337 | 3300026089 | Bacteria | 1536 |
| 259 | Ga0207676_10002235 | 3300026095 | Bacteria | 13907 |
| 260 | Ga0207676_10372177 | 3300026095 | Bacteria | 1327 |
| 261 | Ga0207674_10038709 | 3300026116 | Bacteria | 4945 |
| 262 | Ga0207675_100004321 | 3300026118 | Bacteria | 13726 |
| 263 | Ga0207698_10248775 | 3300026142 | Bacteria | 1625 |
| 264 | Ga0207698_11111503 | 3300026142 | Bacteria | 803 |
| 265 | Ga0207698_12414408 | 3300026142 | Bacteria | 537 |
| 266 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 267 | Ga0209999_1067638 | 3300027543 | Bacteria | 683 |
| 268 | Ga0209970_1009693 | 3300027614 | Bacteria | 1574 |
| 269 | Ga0209282_1004487 | 3300027666 | Bacteria | 8416 |
| 270 | Ga0209974_10020353 | 3300027876 | Bacteria | 2199 |
| 271 | Ga0209974_10056310 | 3300027876 | Bacteria | 1327 |
| 272 | Ga0268264_10092330 | 3300028381 | Bacteria | 2613 |
| 273 | Ga0316177_1112436 | 3300030731 | Bacteria | 4990 |
| 274 | Ga0316176_1155200 | 3300030732 | Bacteria | 1982 |
| 275 | Ga0314311_1106220 | 3300030733 | Bacteria | 8350 |
| 276 | Ga0316178_1027875 | 3300030735 | Bacteria | 7930 |
| 277 | Ga0316180_1034070 | 3300030736 | Bacteria | 2104 |
| 278 | Ga0316183_1044344 | 3300030742 | Bacteria | 6871 |
| 279 | Ga0316182_1135240 | 3300030745 | Bacteria | 841 |
| 280 | Ga0265332_10000003 | 3300031238 | Bacteria | 482849 |
| 281 | Ga0265331_10161806 | 3300031250 | Bacteria | 1014 |
| 282 | Ga0307513_10000017 | 3300031456 | Bacteria | 282386 |
| 283 | Ga0307513_10000021 | 3300031456 | Bacteria | 228078 |
| 284 | Ga0307408_100000235 | 3300031548 | Bacteria | 58041 |
| 285 | Ga0307408_100000755 | 3300031548 | Bacteria | 26051 |
| 286 | Ga0307408_100096884 | 3300031548 | Bacteria | 2239 |
| 287 | Ga0307408_100219779 | 3300031548 | Bacteria | 1549 |
| 288 | Ga0307408_100580833 | 3300031548 | Bacteria | 993 |
| 289 | Ga0307408_101017731 | 3300031548 | Bacteria | 764 |
| 290 | Ga0307514_10032954 | 3300031649 | Bacteria | 4138 |
| 291 | Ga0307516_10150138 | 3300031730 | Bacteria | 2091 |
| 292 | Ga0307405_10035366 | 3300031731 | Bacteria | 2982 |
| 293 | Ga0307405_11067038 | 3300031731 | Bacteria | 692 |
| 294 | Ga0307413_11003489 | 3300031824 | Bacteria | 716 |
| 295 | Ga0307410_10749074 | 3300031852 | Bacteria | 827 |
| 296 | Ga0307406_10003103 | 3300031901 | Bacteria | 9028 |
| 297 | Ga0307406_10023921 | 3300031901 | Bacteria | 3642 |
| 298 | Ga0307406_10312285 | 3300031901 | Bacteria | 1212 |
| 299 | Ga0307407_10766874 | 3300031903 | Bacteria | 731 |
| 300 | Ga0307412_10021912 | 3300031911 | Bacteria | 3908 |
| 301 | Ga0307412_10099612 | 3300031911 | Bacteria | 2052 |
| 302 | Ga0307412_10121127 | 3300031911 | Bacteria | 1884 |
| 303 | Ga0307412_10199433 | 3300031911 | Bacteria | 1518 |
| 304 | Ga0307412_10540015 | 3300031911 | Bacteria | 977 |
| 305 | Ga0307409_100889328 | 3300031995 | Bacteria | 904 |
| 306 | Ga0307416_100126228 | 3300032002 | Bacteria | 2292 |
| 307 | Ga0307414_10812153 | 3300032004 | Bacteria | 853 |
| 308 | Ga0307411_10122204 | 3300032005 | Bacteria | 1886 |
| 309 | Ga0307411_10165168 | 3300032005 | Bacteria | 1663 |
| 310 | Ga0307411_10929535 | 3300032005 | Bacteria | 774 |
| 311 | Ga0307411_11840854 | 3300032005 | Bacteria | 562 |
| 312 | Ga0373938_0031310 | 3300034957 | Bacteria | 1140 |
| 313 | Ga0373940_0033952 | 3300035088 | Bacteria | 1374 |
| 314 | Ga0373952_0014815 | 3300035092 | Bacteria | 1565 |
| 315 | Ga0373939_0205457 | 3300035114 | Bacteria | 747 |
| 316 | Ga0373931_0002900 | 3300035691 | Bacteria | 7647 |
| 317 | Ga0373931_0352704 | 3300035691 | Bacteria | 921 |
| 318 | Ga0395900_0043174 | 3300037418 | Bacteria | 4646 |
| 319 | Ga0395900_0109421 | 3300037418 | Bacteria | 2839 |
| 320 | Ga0395900_0123229 | 3300037418 | Bacteria | 2659 |
| 321 | Ga0395898_0101573 | 3300037466 | Bacteria | 2761 |
| 322 | Ga0395898_0443756 | 3300037466 | Bacteria | 1236 |
| 323 | Ga0395905_0008622 | 3300037471 | Bacteria | 10044 |
| 324 | Ga0395905_0012926 | 3300037471 | Bacteria | 8025 |
| 325 | Ga0395905_0026012 | 3300037471 | Bacteria | 5518 |
| 326 | Ga0395901_0046555 | 3300038443 | Bacteria | 4506 |
| 327 | Ga0395901_0180108 | 3300038443 | Bacteria | 2216 |
| 328 | Ga0395901_0552072 | 3300038443 | Bacteria | 1167 |
| 329 | Ga0395901_0834041 | 3300038443 | Bacteria | 908 |
| 330 | Ga0395901_0998198 | 3300038443 | Bacteria | 813 |
| 331 | Ga0436361_0241328 | 3300039447 | Bacteria | 14795 |
| 332 | Ga0439436_0021298 | 3300041404 | Bacteria | 1927 |
| 333 | Ga0439439_0005447 | 3300041406 | Bacteria | 2906 |
| 334 | Ga0439439_0012075 | 3300041406 | Bacteria | 2084 |
| 335 | Ga0439447_022240 | 3300041407 | Bacteria | 1663 |
| 336 | Ga0439453_0055517 | 3300041408 | Bacteria | 809 |
| 337 | Ga0439465_0018847 | 3300041413 | Bacteria | 2156 |
| 338 | Ga0451791_0602409 | 3300041451 | Bacteria | 1108 |
| 339 | Ga0451807_2742432 | 3300041486 | Bacteria | 1192 |
| 340 | Ga0451853_3633780 | 3300041512 | Bacteria | 1093 |
| 341 | Ga0439431_0093714 | 3300041997 | Bacteria | 820 |
| 342 | Ga0439433_0012937 | 3300041999 | Bacteria | 1832 |
| 343 | Ga0439437_002334 | 3300042000 | Bacteria | 2028 |
| 344 | Ga0439442_025504 | 3300042002 | Bacteria | 1229 |
| 345 | Ga0439445_0065067 | 3300042004 | Bacteria | 1002 |
| 346 | Ga0439432_069571 | 3300042006 | Bacteria | 1075 |
| 347 | Ga0439432_148791 | 3300042006 | Bacteria | 687 |
| 348 | Ga0439449_0001824 | 3300042007 | Bacteria | 8379 |
| 349 | Ga0439449_0019753 | 3300042007 | Bacteria | 2525 |
| 350 | Ga0439449_0040710 | 3300042007 | Bacteria | 1728 |
| 351 | Ga0439452_007463 | 3300042010 | Bacteria | 3347 |
| 352 | Ga0439454_004903 | 3300042011 | Bacteria | 1572 |
| 353 | Ga0439457_055215 | 3300042014 | Bacteria | 895 |
| 354 | Ga0439462_0017839 | 3300042015 | Bacteria | 1840 |
| 355 | Ga0450912_021836 | 3300042116 | Bacteria | 623 |
| 356 | Ga0450919_003610 | 3300042121 | Bacteria | 1921 |
| 357 | Ga0450920_020209 | 3300042122 | Bacteria | 1282 |
| 358 | Ga0450923_004673 | 3300042125 | Bacteria | 2161 |
| 359 | Ga0450897_005291 | 3300042128 | Bacteria | 1113 |
| 360 | Ga0450894_011007 | 3300042131 | Bacteria | 1176 |
| 361 | Ga0450894_064682 | 3300042131 | Bacteria | 554 |
| 362 | Ga0450898_009138 | 3300042134 | Bacteria | 1579 |
| 363 | Ga0450898_018656 | 3300042134 | Bacteria | 1203 |
| 364 | Ga0450898_024020 | 3300042134 | Bacteria | 1087 |
| 365 | Ga0450898_090082 | 3300042134 | Bacteria | 632 |
| 366 | Ga0450902_026189 | 3300042137 | Bacteria | 975 |
| 367 | Ga0450903_008687 | 3300042138 | Bacteria | 1660 |
| 368 | Ga0450889_015778 | 3300042144 | Bacteria | 813 |
| 369 | Ga0450906_006172 | 3300042145 | Bacteria | 2427 |
| 370 | Ga0450906_016592 | 3300042145 | Bacteria | 1332 |
| 371 | Ga0450910_065780 | 3300042147 | Bacteria | 617 |
| 372 | Ga0439446_0020222 | 3300042156 | Bacteria | 1874 |
| 373 | Ga0439446_0217979 | 3300042156 | Bacteria | 649 |
| 374 | Ga0450908_001492 | 3300042184 | Bacteria | 4540 |
| 375 | Ga0439434_0009659 | 3300042435 | Bacteria | 2836 |
| 376 | Ga0439434_0014796 | 3300042435 | Bacteria | 2322 |
| 377 | Ga0439444_0018584 | 3300042437 | Bacteria | 1205 |
| 378 | Ga0439459_0135471 | 3300042438 | Bacteria | 633 |
| 379 | Ga0439464_0003599 | 3300042439 | Bacteria | 3925 |
| 380 | Ga0450918_000580 | 3300042531 | Bacteria | 7798 |
| 381 | Ga0450893_0006613 | 3300042532 | Bacteria | 1877 |
| 382 | Ga0450893_0011612 | 3300042532 | Bacteria | 1457 |
| 383 | Ga0451577_0000068 | 3300042876 | Bacteria | 241923 |
| 384 | Ga0466969_0070633 | 3300044656 | Bacteria | 1679 |
| 385 | Ga0453683_0079863 | 3300044673 | Bacteria | 2048 |
| 386 | Ga0466966_0035847 | 3300044684 | Bacteria | 3204 |
| 387 | Ga0466966_0557516 | 3300044684 | Bacteria | 689 |
| 388 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 389 | Ga0453684_0037089 | 3300044712 | Bacteria | 6696 |
| 390 | Ga0453684_0815032 | 3300044712 | Bacteria | 1006 |
| 391 | Ga0466971_0133523 | 3300044719 | Bacteria | 1153 |
| 392 | Ga0466970_0419320 | 3300044765 | Bacteria | 765 |
| 393 | Ga0466957_0658809 | 3300044842 | Bacteria | 736 |
| 394 | Ga0466960_0263155 | 3300044901 | Bacteria | 962 |
| 395 | Ga0451576_0006589 | 3300045051 | Bacteria | 14200 |
| 396 | Ga0451576_0007283 | 3300045051 | Bacteria | 13291 |
| 397 | Ga0451576_0107690 | 3300045051 | Bacteria | 2900 |
| 398 | Ga0451576_0195927 | 3300045051 | Bacteria | 2110 |
| 399 | Ga0451576_0365126 | 3300045051 | Bacteria | 1512 |
| 400 | Ga0451576_0703714 | 3300045051 | Bacteria | 1062 |
| 401 | Ga0466958_0650816 | 3300045836 | Bacteria | 686 |
| 402 | Ga0466967_0768896 | 3300045976 | Bacteria | 956 |
| 403 | Ga0466967_1063121 | 3300045976 | Bacteria | 806 |
| 404 | Ga0495580_0190335 | 3300046472 | Bacteria | 1415 |
| 405 | Ga0495654_0016403 | 3300046530 | Bacteria | 3918 |
| 406 | Ga0495598_0158886 | 3300046537 | Bacteria | 794 |
| 407 | Ga0495621_0421096 | 3300046539 | Bacteria | 568 |
| 408 | Ga0495656_0080898 | 3300046615 | Bacteria | 1466 |
| 409 | Ga0495625_0000572 | 3300046660 | Bacteria | 53759 |
| 410 | Ga0495615_0027367 | 3300048090 | Bacteria | 1338 |
| 411 | Ga0496100_0051262 | 3300048903 | Bacteria | 2678 |
| 412 | Ga0496101_0607615 | 3300048904 | Bacteria | 864 |
| 413 | Ga0496102_0230111 | 3300048905 | Bacteria | 1748 |
| 414 | Ga0496103_0554862 | 3300048906 | Bacteria | 733 |
| 415 | Ga0496106_0009429 | 3300048909 | Bacteria | 7215 |
| 416 | Ga0496107_0109703 | 3300048910 | Bacteria | 2027 |
| 417 | Ga0496108_0151883 | 3300048911 | Bacteria | 1999 |
| 418 | Ga0496109_0297149 | 3300048912 | Bacteria | 1523 |
| 419 | Ga0496109_0530024 | 3300048912 | Bacteria | 1111 |
| 420 | Ga0496110_0029144 | 3300048913 | Bacteria | 4747 |
| 421 | Ga0496111_0255589 | 3300048914 | Bacteria | 1300 |
| 422 | Ga0496112_0092678 | 3300048915 | Bacteria | 2991 |
| 423 | Ga0496113_0067088 | 3300048916 | Bacteria | 2719 |
| 424 | Ga0496114_0045423 | 3300048917 | Bacteria | 3649 |
| 425 | Ga0496122_0275168 | 3300048925 | Bacteria | 924 |
| 426 | Ga0501310_006301 | 3300049130 | Bacteria | 1242 |
| 427 | Ga0501319_021203 | 3300049535 | Bacteria | 584 |
| 428 | Ga0501034_0430142 | 3300049571 | Bacteria | 1240 |
| 429 | Ga0501047_0820809 | 3300049581 | Bacteria | 744 |
| 430 | Ga0501222_026662 | 3300049662 | Bacteria | 785 |
| 431 | Ga0501257_091861 | 3300049686 | Bacteria | 790 |
| 432 | Ga0501225_0015390 | 3300049705 | Bacteria | 2129 |
| 433 | Ga0501262_000558 | 3300049759 | Bacteria | 4446 |
| 434 | Ga0501273_004744 | 3300049770 | Bacteria | 1509 |
| 435 | nmdc:mga03683_4594_c1 | 3300050489 | Bacteria | 4596 |
| 436 | nmdc:mga03683_66103_c1 | 3300050489 | Bacteria | 1537 |
| 437 | nmdc:mga03n38_11568_c1 | 3300050490 | Bacteria | 3293 |
| 438 | nmdc:mga03n38_52386_c1 | 3300050490 | Bacteria | 1826 |
| 439 | nmdc:mga00v17_413115_c1 | 3300050491 | Bacteria | 877 |
| 440 | nmdc:mga00v17_839446_c1 | 3300050491 | Bacteria | 584 |
| 441 | nmdc:mga0yw44_61333_c1 | 3300050492 | Bacteria | 2307 |
| 442 | nmdc:mga0k408_14552_c1 | 3300050493 | Bacteria | 4338 |
| 443 | nmdc:mga07m45_12737_c2 | 3300050496 | Bacteria | 2370 |
| 444 | nmdc:mga07m45_286149_c1 | 3300050496 | Bacteria | 959 |
| 445 | nmdc:mga07m45_481906_c1 | 3300050496 | Bacteria | 719 |
| 446 | nmdc:mga07m45_84_c1 | 3300050496 | Bacteria | 35438 |
| 447 | nmdc:mga09592_150874_c1 | 3300050508 | Bacteria | 2005 |
| 448 | nmdc:mga0qj67_363149_c1 | 3300050509 | Bacteria | 1170 |
| 449 | nmdc:mga0n895_936373_c1 | 3300050512 | Bacteria | 850 |
| 450 | nmdc:mga0rr50_89535_c1 | 3300050513 | Bacteria | 2393 |
| 451 | Ga0500650_0212810 | 3300053098 | Bacteria | 877 |
| 452 | Ga0500593_044150 | 3300053117 | Bacteria | 1988 |
| 453 | Ga0500628_003530 | 3300053129 | Bacteria | 2583 |
| 454 | Ga0500628_091000 | 3300053129 | Bacteria | 795 |
| 455 | Ga0500634_0107301 | 3300053161 | Bacteria | 1385 |
| 456 | Ga0500645_000214 | 3300053730 | Bacteria | 44143 |
| 457 | Ga0500645_005598 | 3300053730 | Bacteria | 4594 |
| 458 | Ga0500661_078399 | 3300055283 | Bacteria | 610 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2932422444 | 2932423303 | 149 |
| 2 | iso_pu_bacteria | 2945945610 | 2945947183 | 149 |
| 3 | iso_pu_bacteria | 2511231002 | 2511246231 | 150 |
| 4 | iso_pu_bacteria | 2547132374 | 2548498116 | 150 |
| 5 | iso_pu_bacteria | 2643221570 | 2643867405 | 150 |
| 6 | iso_pu_bacteria | 2643221596 | 2643992096 | 150 |
| 7 | iso_pu_bacteria | 2643221609 | 2644063035 | 150 |
| 8 | iso_pu_bacteria | 2643221611 | 2644074334 | 150 |
| 9 | iso_pu_bacteria | 2643221628 | 2644163092 | 150 |
| 10 | iso_pu_bacteria | 2643221652 | 2644295157 | 150 |
| 11 | iso_pu_bacteria | 2643221717 | 2644648642 | 150 |
| 12 | iso_pu_bacteria | 2721755523 | 2722884849 | 150 |
| 13 | iso_pu_bacteria | 2738543012 | 2739246550 | 150 |
| 14 | iso_pu_bacteria | 2816332133 | 2816475935 | 150 |
| 15 | iso_pu_bacteria | 2839138175 | 2839143287 | 150 |
| 16 | iso_pu_bacteria | 2842677519 | 2842682621 | 150 |
| 17 | iso_pu_bacteria | 2842718218 | 2842719670 | 150 |
| 18 | iso_pu_bacteria | 2881101125 | 2881101642 | 150 |
| 19 | iso_pu_bacteria | 2919462493 | 2919464348 | 150 |
| 20 | iso_pu_bacteria | 2919704043 | 2919704462 | 150 |
| 21 | iso_pu_bacteria | 2929520902 | 2929524769 | 150 |
| 22 | iso_pu_bacteria | 2945972063 | 2945976871 | 150 |
| 23 | iso_pu_bacteria | 2974320154 | 2974323741 | 150 |
| 24 | iso_pu_bacteria | 2990710928 | 2990713341 | 150 |
| 25 | 3300006048 | Ga0075363_100057247 | Ga0075363_1000572472 | 152 |
| 26 | 3300006177 | Ga0075362_10003552 | Ga0075362_100035521 | 152 |
| 27 | 3300050489 | nmdc:mga03683_4594_c1 | nmdc:mga03683_4594_c1_3298_3756 | 152 |
| 28 | 3300050490 | nmdc:mga03n38_52386_c1 | nmdc:mga03n38_52386_c1_337_795 | 152 |
| 29 | 3300005327 | Ga0070658_10124413 | Ga0070658_101244132 | 153 |
| 30 | 3300005331 | Ga0070670_100136211 | Ga0070670_1001362112 | 153 |
| 31 | 3300005336 | Ga0070680_100335688 | Ga0070680_1003356882 | 153 |
| 32 | 3300005353 | Ga0070669_101029683 | Ga0070669_1010296832 | 153 |
| 33 | 3300005530 | Ga0070679_100013143 | Ga0070679_1000131436 | 153 |
| 34 | 3300005530 | Ga0070679_100087550 | Ga0070679_1000875504 | 153 |
| 35 | 3300005563 | Ga0068855_100008990 | Ga0068855_1000089903 | 153 |
| 36 | 3300005618 | Ga0068864_100467861 | Ga0068864_1004678613 | 153 |
| 37 | 3300005841 | Ga0068863_100370735 | Ga0068863_1003707352 | 153 |
| 38 | 3300009093 | Ga0105240_10024979 | Ga0105240_100249798 | 153 |
| 39 | 3300009551 | Ga0105238_10064347 | Ga0105238_100643475 | 153 |
| 40 | 3300025913 | Ga0207695_10082917 | Ga0207695_100829173 | 153 |
| 41 | 3300025917 | Ga0207660_10141700 | Ga0207660_101417003 | 153 |
| 42 | 3300025921 | Ga0207652_10089225 | Ga0207652_100892254 | 153 |
| 43 | 3300025921 | Ga0207652_10209242 | Ga0207652_102092422 | 153 |
| 44 | 3300025925 | Ga0207650_10127240 | Ga0207650_101272402 | 153 |
| 45 | 3300025949 | Ga0207667_10024701 | Ga0207667_100247018 | 153 |
| 46 | 3300026088 | Ga0207641_10161186 | Ga0207641_101611862 | 153 |
| 47 | 3300026095 | Ga0207676_10372177 | Ga0207676_103721771 | 153 |
| 48 | 3300031238 | Ga0265332_10000003 | Ga0265332_10000003162 | 153 |
| 49 | 3300031548 | Ga0307408_100096884 | Ga0307408_1000968843 | 153 |
| 50 | 3300031548 | Ga0307408_100580833 | Ga0307408_1005808332 | 153 |
| 51 | 3300031824 | Ga0307413_11003489 | Ga0307413_110034891 | 153 |
| 52 | 3300031911 | Ga0307412_10121127 | Ga0307412_101211273 | 153 |
| 53 | 3300031911 | Ga0307412_10540015 | Ga0307412_105400152 | 153 |
| 54 | 3300031995 | Ga0307409_100889328 | Ga0307409_1008893282 | 153 |
| 55 | 3300032002 | Ga0307416_100126228 | Ga0307416_1001262284 | 153 |
| 56 | 3300038443 | Ga0395901_0552072 | Ga0395901_0552072_100_561 | 153 |
| 57 | 3300041406 | Ga0439439_0005447 | Ga0439439_0005447_774_1235 | 153 |
| 58 | 3300042006 | Ga0439432_148791 | Ga0439432_148791_49_510 | 153 |
| 59 | 3300042007 | Ga0439449_0001824 | Ga0439449_0001824_5251_5712 | 153 |
| 60 | 3300042134 | Ga0450898_090082 | Ga0450898_090082_48_509 | 153 |
| 61 | 3300042156 | Ga0439446_0020222 | Ga0439446_0020222_153_614 | 153 |
| 62 | 3300044712 | Ga0453684_0037089 | Ga0453684_0037089_1918_2391 | 153 |
| 63 | 3300045051 | Ga0451576_0006589 | Ga0451576_0006589_1753_2226 | 153 |
| 64 | 3300048912 | Ga0496109_0297149 | Ga0496109_0297149_45_506 | 153 |
| 65 | 3300048925 | Ga0496122_0275168 | Ga0496122_0275168_404_865 | 153 |
| 66 | 3300049770 | Ga0501273_004744 | Ga0501273_004744_599_1060 | 153 |
| 67 | 3300002705 | JGI25156J39149_1000002 | JGI25156J39149_100000263 | 154 |
| 68 | 3300002738 | JGI25154J39366_1000010 | JGI25154J39366_1000010254 | 154 |
| 69 | 3300002741 | JGI25157J39369_1000001 | JGI25157J39369_100000184 | 154 |
| 70 | 3300002774 | JGI25150J39212_1006148 | JGI25150J39212_10061483 | 154 |
| 71 | 3300002987 | JGI25159J45721_1000336 | JGI25159J45721_10003369 | 154 |
| 72 | 3300002987 | JGI25159J45721_1000418 | JGI25159J45721_100041812 | 154 |
| 73 | 3300003187 | JGI25151J46595_10057677 | JGI25151J46595_100576771 | 154 |
| 74 | 3300003187 | JGI25151J46595_10069671 | JGI25151J46595_100696712 | 154 |
| 75 | 3300003187 | JGI25151J46595_10086449 | JGI25151J46595_100864492 | 154 |
| 76 | 3300003187 | JGI25151J46595_10127537 | JGI25151J46595_101275371 | 154 |
| 77 | 3300003354 | JGI25160J50197_1000342 | JGI25160J50197_100034222 | 154 |
| 78 | 3300003354 | JGI25160J50197_1038778 | JGI25160J50197_10387782 | 154 |
| 79 | 3300003374 | JGI25161J50226_1000259 | JGI25161J50226_100025922 | 154 |
| 80 | 3300003771 | Ga0055526_1004095 | Ga0055526_10040953 | 154 |
| 81 | 3300003771 | Ga0055526_1004623 | Ga0055526_10046238 | 154 |
| 82 | 3300003773 | Ga0055537_1000102 | Ga0055537_100010227 | 154 |
| 83 | 3300003775 | Ga0055524_1000093 | Ga0055524_100009377 | 154 |
| 84 | 3300003781 | Ga0055536_1002186 | Ga0055536_10021867 | 154 |
| 85 | 3300003784 | Ga0055534_1000251 | Ga0055534_10002518 | 154 |
| 86 | 3300003784 | Ga0055534_1003916 | Ga0055534_10039162 | 154 |
| 87 | 3300003790 | Ga0055528_1016931 | Ga0055528_10169311 | 154 |
| 88 | 3300003790 | Ga0055528_1017193 | Ga0055528_10171933 | 154 |
| 89 | 3300003791 | Ga0055530_10000285 | Ga0055530_100002859 | 154 |
| 90 | 3300003791 | Ga0055530_10055629 | Ga0055530_100556292 | 154 |
| 91 | 3300003792 | Ga0055540_1000196 | Ga0055540_100019619 | 154 |
| 92 | 3300003792 | Ga0055540_1014749 | Ga0055540_10147492 | 154 |
| 93 | 3300003794 | Ga0055531_10002290 | Ga0055531_100022907 | 154 |
| 94 | 3300004625 | Ga0055543_1000527 | Ga0055543_10005272 | 154 |
| 95 | 3300005262 | Ga0065165_1025946 | Ga0065165_10259463 | 154 |
| 96 | 3300005262 | Ga0065165_1038345 | Ga0065165_10383452 | 154 |
| 97 | 3300005288 | Ga0065714_10018834 | Ga0065714_100188343 | 154 |
| 98 | 3300005289 | Ga0065704_10182336 | Ga0065704_101823362 | 154 |
| 99 | 3300005329 | Ga0070683_100042597 | Ga0070683_1000425976 | 154 |
| 100 | 3300005329 | Ga0070683_100371353 | Ga0070683_1003713531 | 154 |
| 101 | 3300005331 | Ga0070670_100526810 | Ga0070670_1005268102 | 154 |
| 102 | 3300005333 | Ga0070677_10034493 | Ga0070677_100344932 | 154 |
| 103 | 3300005334 | Ga0068869_100003710 | Ga0068869_1000037106 | 154 |
| 104 | 3300005338 | Ga0068868_100000789 | Ga0068868_1000007898 | 154 |
| 105 | 3300005338 | Ga0068868_100109167 | Ga0068868_1001091672 | 154 |
| 106 | 3300005339 | Ga0070660_100183328 | Ga0070660_1001833283 | 154 |
| 107 | 3300005339 | Ga0070660_100239475 | Ga0070660_1002394752 | 154 |
| 108 | 3300005344 | Ga0070661_100294274 | Ga0070661_1002942742 | 154 |
| 109 | 3300005345 | Ga0070692_10362636 | Ga0070692_103626362 | 154 |
| 110 | 3300005347 | Ga0070668_100155939 | Ga0070668_1001559393 | 154 |
| 111 | 3300005353 | Ga0070669_100006970 | Ga0070669_1000069706 | 154 |
| 112 | 3300005354 | Ga0070675_100018861 | Ga0070675_1000188617 | 154 |
| 113 | 3300005355 | Ga0070671_100630318 | Ga0070671_1006303182 | 154 |
| 114 | 3300005366 | Ga0070659_100019568 | Ga0070659_1000195685 | 154 |
| 115 | 3300005366 | Ga0070659_100020112 | Ga0070659_1000201126 | 154 |
| 116 | 3300005366 | Ga0070659_100225753 | Ga0070659_1002257532 | 154 |
| 117 | 3300005367 | Ga0070667_100220914 | Ga0070667_1002209143 | 154 |
| 118 | 3300005367 | Ga0070667_100317415 | Ga0070667_1003174152 | 154 |
| 119 | 3300005455 | Ga0070663_100006757 | Ga0070663_10000675710 | 154 |
| 120 | 3300005456 | Ga0070678_100606356 | Ga0070678_1006063562 | 154 |
| 121 | 3300005457 | Ga0070662_100001468 | Ga0070662_1000014682 | 154 |
| 122 | 3300005459 | Ga0068867_100230807 | Ga0068867_1002308072 | 154 |
| 123 | 3300005535 | Ga0070684_100039911 | Ga0070684_1000399112 | 154 |
| 124 | 3300005535 | Ga0070684_100497085 | Ga0070684_1004970852 | 154 |
| 125 | 3300005539 | Ga0068853_100018272 | Ga0068853_1000182728 | 154 |
| 126 | 3300005539 | Ga0068853_100113610 | Ga0068853_1001136102 | 154 |
| 127 | 3300005539 | Ga0068853_100139793 | Ga0068853_1001397932 | 154 |
| 128 | 3300005543 | Ga0070672_100031643 | Ga0070672_1000316432 | 154 |
| 129 | 3300005543 | Ga0070672_100376898 | Ga0070672_1003768982 | 154 |
| 130 | 3300005547 | Ga0070693_100120805 | Ga0070693_1001208052 | 154 |
| 131 | 3300005563 | Ga0068855_100280933 | Ga0068855_1002809333 | 154 |
| 132 | 3300005563 | Ga0068855_100595386 | Ga0068855_1005953862 | 154 |
| 133 | 3300005564 | Ga0070664_100532253 | Ga0070664_1005322532 | 154 |
| 134 | 3300005564 | Ga0070664_101530149 | Ga0070664_1015301491 | 154 |
| 135 | 3300005577 | Ga0068857_100152614 | Ga0068857_1001526143 | 154 |
| 136 | 3300005578 | Ga0068854_100229598 | Ga0068854_1002295983 | 154 |
| 137 | 3300005578 | Ga0068854_101436301 | Ga0068854_1014363012 | 154 |
| 138 | 3300005614 | Ga0068856_100060104 | Ga0068856_1000601045 | 154 |
| 139 | 3300005615 | Ga0070702_100350437 | Ga0070702_1003504372 | 154 |
| 140 | 3300005615 | Ga0070702_100641976 | Ga0070702_1006419761 | 154 |
| 141 | 3300005616 | Ga0068852_100014734 | Ga0068852_1000147343 | 154 |
| 142 | 3300005616 | Ga0068852_100015149 | Ga0068852_1000151498 | 154 |
| 143 | 3300005616 | Ga0068852_100099663 | Ga0068852_1000996633 | 154 |
| 144 | 3300005617 | Ga0068859_100073840 | Ga0068859_1000738402 | 154 |
| 145 | 3300005618 | Ga0068864_100011079 | Ga0068864_1000110792 | 154 |
| 146 | 3300005618 | Ga0068864_102171262 | Ga0068864_1021712621 | 154 |
| 147 | 3300005719 | Ga0068861_100008404 | Ga0068861_1000084042 | 154 |
| 148 | 3300005834 | Ga0068851_10019111 | Ga0068851_100191111 | 154 |
| 149 | 3300005834 | Ga0068851_10083282 | Ga0068851_100832822 | 154 |
| 150 | 3300005841 | Ga0068863_100096200 | Ga0068863_1000962002 | 154 |
| 151 | 3300005842 | Ga0068858_100002253 | Ga0068858_10000225315 | 154 |
| 152 | 3300005842 | Ga0068858_100475544 | Ga0068858_1004755442 | 154 |
| 153 | 3300005843 | Ga0068860_100092582 | Ga0068860_1000925822 | 154 |
| 154 | 3300005843 | Ga0068860_100224213 | Ga0068860_1002242132 | 154 |
| 155 | 3300006038 | Ga0075365_10022989 | Ga0075365_100229895 | 154 |
| 156 | 3300006048 | Ga0075363_100571596 | Ga0075363_1005715961 | 154 |
| 157 | 3300006051 | Ga0075364_10203428 | Ga0075364_102034282 | 154 |
| 158 | 3300006058 | Ga0075432_10005092 | Ga0075432_100050925 | 154 |
| 159 | 3300006058 | Ga0075432_10015791 | Ga0075432_100157913 | 154 |
| 160 | 3300006177 | Ga0075362_10031837 | Ga0075362_100318373 | 154 |
| 161 | 3300006177 | Ga0075362_10036633 | Ga0075362_100366333 | 154 |
| 162 | 3300006177 | Ga0075362_10069389 | Ga0075362_100693892 | 154 |
| 163 | 3300006177 | Ga0075362_10111245 | Ga0075362_101112453 | 154 |
| 164 | 3300006195 | Ga0075366_10027067 | Ga0075366_100270675 | 154 |
| 165 | 3300006195 | Ga0075366_10518364 | Ga0075366_105183642 | 154 |
| 166 | 3300006237 | Ga0097621_100006973 | Ga0097621_1000069733 | 154 |
| 167 | 3300006353 | Ga0075370_10032451 | Ga0075370_100324512 | 154 |
| 168 | 3300006353 | Ga0075370_10093322 | Ga0075370_100933222 | 154 |
| 169 | 3300006846 | Ga0075430_100068438 | Ga0075430_1000684383 | 154 |
| 170 | 3300006871 | Ga0075434_100215913 | Ga0075434_1002159132 | 154 |
| 171 | 3300006880 | Ga0075429_100089964 | Ga0075429_1000899643 | 154 |
| 172 | 3300006931 | Ga0097620_100073840 | Ga0097620_1000738402 | 154 |
| 173 | 3300006946 | Ga0079104_1000098 | Ga0079104_100009871 | 154 |
| 174 | 3300006946 | Ga0079104_1027952 | Ga0079104_10279523 | 154 |
| 175 | 3300006948 | Ga0099826_10045370 | Ga0099826_100453705 | 154 |
| 176 | 3300006948 | Ga0099826_10130283 | Ga0099826_101302833 | 154 |
| 177 | 3300007076 | Ga0075435_100672888 | Ga0075435_1006728882 | 154 |
| 178 | 3300009092 | Ga0105250_10001374 | Ga0105250_100013749 | 154 |
| 179 | 3300009093 | Ga0105240_10432472 | Ga0105240_104324722 | 154 |
| 180 | 3300009098 | Ga0105245_10114476 | Ga0105245_101144763 | 154 |
| 181 | 3300009098 | Ga0105245_10329170 | Ga0105245_103291702 | 154 |
| 182 | 3300009101 | Ga0105247_10125752 | Ga0105247_101257522 | 154 |
| 183 | 3300009148 | Ga0105243_10005223 | Ga0105243_100052234 | 154 |
| 184 | 3300009174 | Ga0105241_10158159 | Ga0105241_101581592 | 154 |
| 185 | 3300009176 | Ga0105242_10001377 | Ga0105242_100013779 | 154 |
| 186 | 3300009177 | Ga0105248_10017706 | Ga0105248_100177063 | 154 |
| 187 | 3300009545 | Ga0105237_10145618 | Ga0105237_101456183 | 154 |
| 188 | 3300009551 | Ga0105238_10175560 | Ga0105238_101755603 | 154 |
| 189 | 3300009551 | Ga0105238_10302225 | Ga0105238_103022252 | 154 |
| 190 | 3300009553 | Ga0105249_11163174 | Ga0105249_111631742 | 154 |
| 191 | 3300010375 | Ga0105239_10034575 | Ga0105239_100345752 | 154 |
| 192 | 3300010375 | Ga0105239_10339651 | Ga0105239_103396512 | 154 |
| 193 | 3300013100 | Ga0157373_10360040 | Ga0157373_103600402 | 154 |
| 194 | 3300013102 | Ga0157371_10143156 | Ga0157371_101431562 | 154 |
| 195 | 3300013104 | Ga0157370_10433611 | Ga0157370_104336112 | 154 |
| 196 | 3300013104 | Ga0157370_10521716 | Ga0157370_105217162 | 154 |
| 197 | 3300013105 | Ga0157369_10029614 | Ga0157369_100296148 | 154 |
| 198 | 3300013296 | Ga0157374_10009105 | Ga0157374_100091052 | 154 |
| 199 | 3300013296 | Ga0157374_10793031 | Ga0157374_107930312 | 154 |
| 200 | 3300013297 | Ga0157378_10782372 | Ga0157378_107823722 | 154 |
| 201 | 3300013306 | Ga0163162_10024073 | Ga0163162_100240738 | 154 |
| 202 | 3300013307 | Ga0157372_10004314 | Ga0157372_1000431410 | 154 |
| 203 | 3300013307 | Ga0157372_10037615 | Ga0157372_100376155 | 154 |
| 204 | 3300013307 | Ga0157372_11148458 | Ga0157372_111484582 | 154 |
| 205 | 3300013308 | Ga0157375_10131342 | Ga0157375_101313423 | 154 |
| 206 | 3300013308 | Ga0157375_10808909 | Ga0157375_108089092 | 154 |
| 207 | 3300014325 | Ga0163163_10526958 | Ga0163163_105269582 | 154 |
| 208 | 3300014326 | Ga0157380_10020185 | Ga0157380_100201855 | 154 |
| 209 | 3300014745 | Ga0157377_10006609 | Ga0157377_100066095 | 154 |
| 210 | 3300014968 | Ga0157379_10034474 | Ga0157379_100344746 | 154 |
| 211 | 3300014968 | Ga0157379_10041922 | Ga0157379_100419224 | 154 |
| 212 | 3300014969 | Ga0157376_10013225 | Ga0157376_100132258 | 154 |
| 213 | 3300014969 | Ga0157376_10025416 | Ga0157376_100254164 | 154 |
| 214 | 3300017792 | Ga0163161_10124081 | Ga0163161_101240813 | 154 |
| 215 | 3300017792 | Ga0163161_10662355 | Ga0163161_106623552 | 154 |
| 216 | 3300021361 | Ga0213872_10026675 | Ga0213872_100266752 | 154 |
| 217 | 3300025206 | Ga0209435_100001 | Ga0209435_1000011232 | 154 |
| 218 | 3300025245 | Ga0207425_1001506 | Ga0207425_10015064 | 154 |
| 219 | 3300025245 | Ga0207425_1015762 | Ga0207425_10157623 | 154 |
| 220 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011601 | 154 |
| 221 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001254 | 154 |
| 222 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011232 | 154 |
| 223 | 3300025263 | Ga0209565_1000040 | Ga0209565_1000040169 | 154 |
| 224 | 3300025263 | Ga0209565_1000161 | Ga0209565_100016157 | 154 |
| 225 | 3300025263 | Ga0209565_1003337 | Ga0209565_10033372 | 154 |
| 226 | 3300025273 | Ga0209673_1000353 | Ga0209673_10003538 | 154 |
| 227 | 3300025273 | Ga0209673_1000391 | Ga0209673_100039132 | 154 |
| 228 | 3300025273 | Ga0209673_1034416 | Ga0209673_10344162 | 154 |
| 229 | 3300025284 | Ga0209130_1000118 | Ga0209130_100011818 | 154 |
| 230 | 3300025284 | Ga0209130_1000359 | Ga0209130_100035930 | 154 |
| 231 | 3300025291 | Ga0209675_1000024 | Ga0209675_100002499 | 154 |
| 232 | 3300025291 | Ga0209675_1003774 | Ga0209675_10037743 | 154 |
| 233 | 3300025291 | Ga0209675_1008503 | Ga0209675_10085034 | 154 |
| 234 | 3300025292 | Ga0209676_1000054 | Ga0209676_1000054104 | 154 |
| 235 | 3300025292 | Ga0209676_1004136 | Ga0209676_10041363 | 154 |
| 236 | 3300025294 | Ga0209025_1003092 | Ga0209025_10030923 | 154 |
| 237 | 3300025294 | Ga0209025_1006330 | Ga0209025_10063303 | 154 |
| 238 | 3300025294 | Ga0209025_1025261 | Ga0209025_10252612 | 154 |
| 239 | 3300025294 | Ga0209025_1043813 | Ga0209025_10438132 | 154 |
| 240 | 3300025294 | Ga0209025_1068388 | Ga0209025_10683882 | 154 |
| 241 | 3300025295 | Ga0209564_1000610 | Ga0209564_100061039 | 154 |
| 242 | 3300025295 | Ga0209564_1000815 | Ga0209564_100081540 | 154 |
| 243 | 3300025295 | Ga0209564_1024969 | Ga0209564_10249693 | 154 |
| 244 | 3300025297 | Ga0209758_1053875 | Ga0209758_10538752 | 154 |
| 245 | 3300025298 | Ga0209050_1000066 | Ga0209050_1000066104 | 154 |
| 246 | 3300025298 | Ga0209050_1018294 | Ga0209050_10182942 | 154 |
| 247 | 3300025298 | Ga0209050_1046436 | Ga0209050_10464362 | 154 |
| 248 | 3300025299 | Ga0209256_1000003 | Ga0209256_10000031377 | 154 |
| 249 | 3300025299 | Ga0209256_1057936 | Ga0209256_10579362 | 154 |
| 250 | 3300025302 | Ga0207426_1000197 | Ga0207426_100019740 | 154 |
| 251 | 3300025302 | Ga0207426_1000997 | Ga0207426_100099718 | 154 |
| 252 | 3300025303 | Ga0209051_1000044 | Ga0209051_1000044104 | 154 |
| 253 | 3300025303 | Ga0209051_1000115 | Ga0209051_100011568 | 154 |
| 254 | 3300025303 | Ga0209051_1000831 | Ga0209051_100083122 | 154 |
| 255 | 3300025303 | Ga0209051_1044273 | Ga0209051_10442733 | 154 |
| 256 | 3300025304 | Ga0209257_1000055 | Ga0209257_1000055103 | 154 |
| 257 | 3300025304 | Ga0209257_1000082 | Ga0209257_1000082104 | 154 |
| 258 | 3300025304 | Ga0209257_1026481 | Ga0209257_10264812 | 154 |
| 259 | 3300025321 | Ga0207656_10012545 | Ga0207656_100125451 | 154 |
| 260 | 3300025321 | Ga0207656_10016388 | Ga0207656_100163883 | 154 |
| 261 | 3300025893 | Ga0207682_10124003 | Ga0207682_101240032 | 154 |
| 262 | 3300025901 | Ga0207688_10026102 | Ga0207688_100261023 | 154 |
| 263 | 3300025901 | Ga0207688_10320068 | Ga0207688_103200682 | 154 |
| 264 | 3300025903 | Ga0207680_10328320 | Ga0207680_103283202 | 154 |
| 265 | 3300025907 | Ga0207645_10006016 | Ga0207645_100060168 | 154 |
| 266 | 3300025913 | Ga0207695_10252836 | Ga0207695_102528362 | 154 |
| 267 | 3300025919 | Ga0207657_10021545 | Ga0207657_100215452 | 154 |
| 268 | 3300025919 | Ga0207657_10079164 | Ga0207657_100791642 | 154 |
| 269 | 3300025920 | Ga0207649_10148826 | Ga0207649_101488261 | 154 |
| 270 | 3300025924 | Ga0207694_10062632 | Ga0207694_100626322 | 154 |
| 271 | 3300025924 | Ga0207694_10187049 | Ga0207694_101870492 | 154 |
| 272 | 3300025926 | Ga0207659_10003197 | Ga0207659_100031976 | 154 |
| 273 | 3300025927 | Ga0207687_10069875 | Ga0207687_100698753 | 154 |
| 274 | 3300025931 | Ga0207644_10541392 | Ga0207644_105413922 | 154 |
| 275 | 3300025932 | Ga0207690_10055884 | Ga0207690_100558842 | 154 |
| 276 | 3300025933 | Ga0207706_10004428 | Ga0207706_1000442812 | 154 |
| 277 | 3300025934 | Ga0207686_10016566 | Ga0207686_100165663 | 154 |
| 278 | 3300025935 | Ga0207709_10000105 | Ga0207709_1000010549 | 154 |
| 279 | 3300025938 | Ga0207704_10353745 | Ga0207704_103537452 | 154 |
| 280 | 3300025940 | Ga0207691_10008646 | Ga0207691_1000864611 | 154 |
| 281 | 3300025941 | Ga0207711_10027114 | Ga0207711_100271147 | 154 |
| 282 | 3300025942 | Ga0207689_10003092 | Ga0207689_1000309211 | 154 |
| 283 | 3300025942 | Ga0207689_10234027 | Ga0207689_102340272 | 154 |
| 284 | 3300025942 | Ga0207689_10263738 | Ga0207689_102637382 | 154 |
| 285 | 3300025942 | Ga0207689_10516306 | Ga0207689_105163062 | 154 |
| 286 | 3300025944 | Ga0207661_10004291 | Ga0207661_1000429110 | 154 |
| 287 | 3300025945 | Ga0207679_10034240 | Ga0207679_100342403 | 154 |
| 288 | 3300025949 | Ga0207667_10227878 | Ga0207667_102278782 | 154 |
| 289 | 3300025961 | Ga0207712_10273557 | Ga0207712_102735573 | 154 |
| 290 | 3300025981 | Ga0207640_10478577 | Ga0207640_104785772 | 154 |
| 291 | 3300025986 | Ga0207658_10042663 | Ga0207658_100426634 | 154 |
| 292 | 3300026023 | Ga0207677_10009530 | Ga0207677_100095308 | 154 |
| 293 | 3300026023 | Ga0207677_10021519 | Ga0207677_100215194 | 154 |
| 294 | 3300026023 | Ga0207677_10206676 | Ga0207677_102066763 | 154 |
| 295 | 3300026035 | Ga0207703_10159883 | Ga0207703_101598832 | 154 |
| 296 | 3300026035 | Ga0207703_10235357 | Ga0207703_102353572 | 154 |
| 297 | 3300026041 | Ga0207639_10031714 | Ga0207639_100317142 | 154 |
| 298 | 3300026041 | Ga0207639_10053823 | Ga0207639_100538233 | 154 |
| 299 | 3300026067 | Ga0207678_10022377 | Ga0207678_100223772 | 154 |
| 300 | 3300026078 | Ga0207702_10379199 | Ga0207702_103791992 | 154 |
| 301 | 3300026078 | Ga0207702_10380550 | Ga0207702_103805502 | 154 |
| 302 | 3300026078 | Ga0207702_10494915 | Ga0207702_104949152 | 154 |
| 303 | 3300026088 | Ga0207641_11326308 | Ga0207641_113263081 | 154 |
| 304 | 3300026089 | Ga0207648_10264337 | Ga0207648_102643372 | 154 |
| 305 | 3300026095 | Ga0207676_10002235 | Ga0207676_1000223514 | 154 |
| 306 | 3300026116 | Ga0207674_10038709 | Ga0207674_100387093 | 154 |
| 307 | 3300026118 | Ga0207675_100004321 | Ga0207675_10000432111 | 154 |
| 308 | 3300026142 | Ga0207698_10248775 | Ga0207698_102487753 | 154 |
| 309 | 3300026142 | Ga0207698_11111503 | Ga0207698_111115032 | 154 |
| 310 | 3300026142 | Ga0207698_12414408 | Ga0207698_124144081 | 154 |
| 311 | 3300027111 | Ga0209281_1000002 | Ga0209281_10000021715 | 154 |
| 312 | 3300027543 | Ga0209999_1067638 | Ga0209999_10676381 | 154 |
| 313 | 3300027614 | Ga0209970_1009693 | Ga0209970_10096931 | 154 |
| 314 | 3300027666 | Ga0209282_1004487 | Ga0209282_10044878 | 154 |
| 315 | 3300027876 | Ga0209974_10020353 | Ga0209974_100203533 | 154 |
| 316 | 3300027876 | Ga0209974_10056310 | Ga0209974_100563103 | 154 |
| 317 | 3300028381 | Ga0268264_10092330 | Ga0268264_100923303 | 154 |
| 318 | 3300030731 | Ga0316177_1112436 | Ga0316177_11124362 | 154 |
| 319 | 3300030732 | Ga0316176_1155200 | Ga0316176_11552003 | 154 |
| 320 | 3300030733 | Ga0314311_1106220 | Ga0314311_11062202 | 154 |
| 321 | 3300030735 | Ga0316178_1027875 | Ga0316178_10278758 | 154 |
| 322 | 3300030736 | Ga0316180_1034070 | Ga0316180_10340702 | 154 |
| 323 | 3300030742 | Ga0316183_1044344 | Ga0316183_10443447 | 154 |
| 324 | 3300030745 | Ga0316182_1135240 | Ga0316182_11352402 | 154 |
| 325 | 3300031250 | Ga0265331_10161806 | Ga0265331_101618062 | 154 |
| 326 | 3300031456 | Ga0307513_10000017 | Ga0307513_10000017282 | 154 |
| 327 | 3300031456 | Ga0307513_10000021 | Ga0307513_10000021185 | 154 |
| 328 | 3300031548 | Ga0307408_100000235 | Ga0307408_10000023510 | 154 |
| 329 | 3300031548 | Ga0307408_100000755 | Ga0307408_10000075514 | 154 |
| 330 | 3300031548 | Ga0307408_100219779 | Ga0307408_1002197793 | 154 |
| 331 | 3300031548 | Ga0307408_101017731 | Ga0307408_1010177311 | 154 |
| 332 | 3300031649 | Ga0307514_10032954 | Ga0307514_100329547 | 154 |
| 333 | 3300031730 | Ga0307516_10150138 | Ga0307516_101501383 | 154 |
| 334 | 3300031731 | Ga0307405_10035366 | Ga0307405_100353662 | 154 |
| 335 | 3300031731 | Ga0307405_11067038 | Ga0307405_110670382 | 154 |
| 336 | 3300031852 | Ga0307410_10749074 | Ga0307410_107490742 | 154 |
| 337 | 3300031901 | Ga0307406_10003103 | Ga0307406_100031038 | 154 |
| 338 | 3300031901 | Ga0307406_10023921 | Ga0307406_100239214 | 154 |
| 339 | 3300031901 | Ga0307406_10312285 | Ga0307406_103122852 | 154 |
| 340 | 3300031903 | Ga0307407_10766874 | Ga0307407_107668741 | 154 |
| 341 | 3300031911 | Ga0307412_10021912 | Ga0307412_100219123 | 154 |
| 342 | 3300031911 | Ga0307412_10099612 | Ga0307412_100996122 | 154 |
| 343 | 3300031911 | Ga0307412_10199433 | Ga0307412_101994331 | 154 |
| 344 | 3300032004 | Ga0307414_10812153 | Ga0307414_108121532 | 154 |
| 345 | 3300032005 | Ga0307411_10122204 | Ga0307411_101222043 | 154 |
| 346 | 3300032005 | Ga0307411_10165168 | Ga0307411_101651682 | 154 |
| 347 | 3300032005 | Ga0307411_10929535 | Ga0307411_109295352 | 154 |
| 348 | 3300032005 | Ga0307411_11840854 | Ga0307411_118408541 | 154 |
| 349 | 3300034957 | Ga0373938_0031310 | Ga0373938_0031310_557_1021 | 154 |
| 350 | 3300035088 | Ga0373940_0033952 | Ga0373940_0033952_797_1261 | 154 |
| 351 | 3300035092 | Ga0373952_0014815 | Ga0373952_0014815_1091_1555 | 154 |
| 352 | 3300035114 | Ga0373939_0205457 | Ga0373939_0205457_41_505 | 154 |
| 353 | 3300035691 | Ga0373931_0002900 | Ga0373931_0002900_4781_5245 | 154 |
| 354 | 3300035691 | Ga0373931_0352704 | Ga0373931_0352704_425_889 | 154 |
| 355 | 3300037418 | Ga0395900_0043174 | Ga0395900_0043174_2512_2976 | 154 |
| 356 | 3300037418 | Ga0395900_0109421 | Ga0395900_0109421_649_1113 | 154 |
| 357 | 3300037418 | Ga0395900_0123229 | Ga0395900_0123229_38_502 | 154 |
| 358 | 3300037466 | Ga0395898_0101573 | Ga0395898_0101573_524_988 | 154 |
| 359 | 3300037466 | Ga0395898_0443756 | Ga0395898_0443756_565_1029 | 154 |
| 360 | 3300037471 | Ga0395905_0008622 | Ga0395905_0008622_2464_2928 | 154 |
| 361 | 3300037471 | Ga0395905_0012926 | Ga0395905_0012926_935_1399 | 154 |
| 362 | 3300037471 | Ga0395905_0026012 | Ga0395905_0026012_4898_5362 | 154 |
| 363 | 3300038443 | Ga0395901_0046555 | Ga0395901_0046555_2476_2940 | 154 |
| 364 | 3300038443 | Ga0395901_0180108 | Ga0395901_0180108_174_638 | 154 |
| 365 | 3300038443 | Ga0395901_0834041 | Ga0395901_0834041_313_777 | 154 |
| 366 | 3300038443 | Ga0395901_0998198 | Ga0395901_0998198_232_696 | 154 |
| 367 | 3300039447 | Ga0436361_0241328 | Ga0436361_0241328_11656_12120 | 154 |
| 368 | 3300041404 | Ga0439436_0021298 | Ga0439436_0021298_32_502 | 154 |
| 369 | 3300041406 | Ga0439439_0012075 | Ga0439439_0012075_983_1453 | 154 |
| 370 | 3300041407 | Ga0439447_022240 | Ga0439447_022240_473_943 | 154 |
| 371 | 3300041408 | Ga0439453_0055517 | Ga0439453_0055517_190_654 | 154 |
| 372 | 3300041413 | Ga0439465_0018847 | Ga0439465_0018847_669_1136 | 154 |
| 373 | 3300041451 | Ga0451791_0602409 | Ga0451791_0602409_319_783 | 154 |
| 374 | 3300041486 | Ga0451807_2742432 | Ga0451807_2742432_97_561 | 154 |
| 375 | 3300041512 | Ga0451853_3633780 | Ga0451853_3633780_561_1034 | 154 |
| 376 | 3300041997 | Ga0439431_0093714 | Ga0439431_0093714_52_519 | 154 |
| 377 | 3300041999 | Ga0439433_0012937 | Ga0439433_0012937_844_1314 | 154 |
| 378 | 3300042000 | Ga0439437_002334 | Ga0439437_002334_909_1373 | 154 |
| 379 | 3300042002 | Ga0439442_025504 | Ga0439442_025504_62_532 | 154 |
| 380 | 3300042004 | Ga0439445_0065067 | Ga0439445_0065067_357_824 | 154 |
| 381 | 3300042006 | Ga0439432_069571 | Ga0439432_069571_496_966 | 154 |
| 382 | 3300042007 | Ga0439449_0019753 | Ga0439449_0019753_1653_2123 | 154 |
| 383 | 3300042007 | Ga0439449_0040710 | Ga0439449_0040710_587_1054 | 154 |
| 384 | 3300042010 | Ga0439452_007463 | Ga0439452_007463_2804_3274 | 154 |
| 385 | 3300042011 | Ga0439454_004903 | Ga0439454_004903_846_1310 | 154 |
| 386 | 3300042014 | Ga0439457_055215 | Ga0439457_055215_258_728 | 154 |
| 387 | 3300042015 | Ga0439462_0017839 | Ga0439462_0017839_195_665 | 154 |
| 388 | 3300042116 | Ga0450912_021836 | Ga0450912_021836_57_521 | 154 |
| 389 | 3300042121 | Ga0450919_003610 | Ga0450919_003610_673_1140 | 154 |
| 390 | 3300042122 | Ga0450920_020209 | Ga0450920_020209_428_895 | 154 |
| 391 | 3300042125 | Ga0450923_004673 | Ga0450923_004673_737_1207 | 154 |
| 392 | 3300042128 | Ga0450897_005291 | Ga0450897_005291_210_680 | 154 |
| 393 | 3300042131 | Ga0450894_011007 | Ga0450894_011007_613_1083 | 154 |
| 394 | 3300042131 | Ga0450894_064682 | Ga0450894_064682_67_531 | 154 |
| 395 | 3300042134 | Ga0450898_009138 | Ga0450898_009138_875_1339 | 154 |
| 396 | 3300042134 | Ga0450898_018656 | Ga0450898_018656_641_1108 | 154 |
| 397 | 3300042134 | Ga0450898_024020 | Ga0450898_024020_193_663 | 154 |
| 398 | 3300042137 | Ga0450902_026189 | Ga0450902_026189_373_837 | 154 |
| 399 | 3300042138 | Ga0450903_008687 | Ga0450903_008687_264_728 | 154 |
| 400 | 3300042144 | Ga0450889_015778 | Ga0450889_015778_325_792 | 154 |
| 401 | 3300042145 | Ga0450906_006172 | Ga0450906_006172_1051_1518 | 154 |
| 402 | 3300042145 | Ga0450906_016592 | Ga0450906_016592_770_1240 | 154 |
| 403 | 3300042147 | Ga0450910_065780 | Ga0450910_065780_22_492 | 154 |
| 404 | 3300042156 | Ga0439446_0217979 | Ga0439446_0217979_128_592 | 154 |
| 405 | 3300042184 | Ga0450908_001492 | Ga0450908_001492_2586_3053 | 154 |
| 406 | 3300042435 | Ga0439434_0009659 | Ga0439434_0009659_661_1128 | 154 |
| 407 | 3300042435 | Ga0439434_0014796 | Ga0439434_0014796_1082_1552 | 154 |
| 408 | 3300042437 | Ga0439444_0018584 | Ga0439444_0018584_66_530 | 154 |
| 409 | 3300042438 | Ga0439459_0135471 | Ga0439459_0135471_37_501 | 154 |
| 410 | 3300042439 | Ga0439464_0003599 | Ga0439464_0003599_2722_3186 | 154 |
| 411 | 3300042531 | Ga0450918_000580 | Ga0450918_000580_1783_2250 | 154 |
| 412 | 3300042532 | Ga0450893_0006613 | Ga0450893_0006613_1231_1695 | 154 |
| 413 | 3300042532 | Ga0450893_0011612 | Ga0450893_0011612_783_1247 | 154 |
| 414 | 3300042876 | Ga0451577_0000068 | Ga0451577_0000068_150554_151018 | 154 |
| 415 | 3300044656 | Ga0466969_0070633 | Ga0466969_0070633_111_575 | 154 |
| 416 | 3300044673 | Ga0453683_0079863 | Ga0453683_0079863_474_938 | 154 |
| 417 | 3300044684 | Ga0466966_0035847 | Ga0466966_0035847_2570_3034 | 154 |
| 418 | 3300044684 | Ga0466966_0557516 | Ga0466966_0557516_209_673 | 154 |
| 419 | 3300044712 | Ga0453684_0000126 | Ga0453684_0000126_60505_60969 | 154 |
| 420 | 3300044712 | Ga0453684_0815032 | Ga0453684_0815032_426_890 | 154 |
| 421 | 3300044719 | Ga0466971_0133523 | Ga0466971_0133523_591_1055 | 154 |
| 422 | 3300044765 | Ga0466970_0419320 | Ga0466970_0419320_233_697 | 154 |
| 423 | 3300044842 | Ga0466957_0658809 | Ga0466957_0658809_184_648 | 154 |
| 424 | 3300044901 | Ga0466960_0263155 | Ga0466960_0263155_413_877 | 154 |
| 425 | 3300045051 | Ga0451576_0007283 | Ga0451576_0007283_1263_1727 | 154 |
| 426 | 3300045051 | Ga0451576_0107690 | Ga0451576_0107690_917_1381 | 154 |
| 427 | 3300045051 | Ga0451576_0195927 | Ga0451576_0195927_902_1366 | 154 |
| 428 | 3300045051 | Ga0451576_0365126 | Ga0451576_0365126_769_1233 | 154 |
| 429 | 3300045051 | Ga0451576_0703714 | Ga0451576_0703714_313_789 | 154 |
| 430 | 3300045836 | Ga0466958_0650816 | Ga0466958_0650816_56_520 | 154 |
| 431 | 3300045976 | Ga0466967_0768896 | Ga0466967_0768896_32_496 | 154 |
| 432 | 3300045976 | Ga0466967_1063121 | Ga0466967_1063121_18_482 | 154 |
| 433 | 3300046472 | Ga0495580_0190335 | Ga0495580_0190335_42_506 | 154 |
| 434 | 3300046530 | Ga0495654_0016403 | Ga0495654_0016403_712_1188 | 154 |
| 435 | 3300046537 | Ga0495598_0158886 | Ga0495598_0158886_228_692 | 154 |
| 436 | 3300046539 | Ga0495621_0421096 | Ga0495621_0421096_22_486 | 154 |
| 437 | 3300046615 | Ga0495656_0080898 | Ga0495656_0080898_221_685 | 154 |
| 438 | 3300046660 | Ga0495625_0000572 | Ga0495625_0000572_42012_42479 | 154 |
| 439 | 3300048090 | Ga0495615_0027367 | Ga0495615_0027367_235_699 | 154 |
| 440 | 3300048903 | Ga0496100_0051262 | Ga0496100_0051262_1916_2380 | 154 |
| 441 | 3300048904 | Ga0496101_0607615 | Ga0496101_0607615_279_743 | 154 |
| 442 | 3300048905 | Ga0496102_0230111 | Ga0496102_0230111_268_732 | 154 |
| 443 | 3300048906 | Ga0496103_0554862 | Ga0496103_0554862_215_679 | 154 |
| 444 | 3300048909 | Ga0496106_0009429 | Ga0496106_0009429_468_932 | 154 |
| 445 | 3300048910 | Ga0496107_0109703 | Ga0496107_0109703_1439_1903 | 154 |
| 446 | 3300048911 | Ga0496108_0151883 | Ga0496108_0151883_219_683 | 154 |
| 447 | 3300048912 | Ga0496109_0530024 | Ga0496109_0530024_264_728 | 154 |
| 448 | 3300048913 | Ga0496110_0029144 | Ga0496110_0029144_514_978 | 154 |
| 449 | 3300048914 | Ga0496111_0255589 | Ga0496111_0255589_514_978 | 154 |
| 450 | 3300048915 | Ga0496112_0092678 | Ga0496112_0092678_919_1383 | 154 |
| 451 | 3300048916 | Ga0496113_0067088 | Ga0496113_0067088_172_636 | 154 |
| 452 | 3300048917 | Ga0496114_0045423 | Ga0496114_0045423_1372_1836 | 154 |
| 453 | 3300049130 | Ga0501310_006301 | Ga0501310_006301_452_919 | 154 |
| 454 | 3300049535 | Ga0501319_021203 | Ga0501319_021203_28_495 | 154 |
| 455 | 3300049571 | Ga0501034_0430142 | Ga0501034_0430142_389_865 | 154 |
| 456 | 3300049581 | Ga0501047_0820809 | Ga0501047_0820809_32_496 | 154 |
| 457 | 3300049662 | Ga0501222_026662 | Ga0501222_026662_287_751 | 154 |
| 458 | 3300049686 | Ga0501257_091861 | Ga0501257_091861_287_751 | 154 |
| 459 | 3300049705 | Ga0501225_0015390 | Ga0501225_0015390_788_1255 | 154 |
| 460 | 3300049759 | Ga0501262_000558 | Ga0501262_000558_543_1010 | 154 |
| 461 | 3300050489 | nmdc:mga03683_66103_c1 | nmdc:mga03683_66103_c1_216_686 | 154 |
| 462 | 3300050490 | nmdc:mga03n38_11568_c1 | nmdc:mga03n38_11568_c1_1375_1842 | 154 |
| 463 | 3300050491 | nmdc:mga00v17_413115_c1 | nmdc:mga00v17_413115_c1_102_569 | 154 |
| 464 | 3300050491 | nmdc:mga00v17_839446_c1 | nmdc:mga00v17_839446_c1_68_532 | 154 |
| 465 | 3300050492 | nmdc:mga0yw44_61333_c1 | nmdc:mga0yw44_61333_c1_438_905 | 154 |
| 466 | 3300050493 | nmdc:mga0k408_14552_c1 | nmdc:mga0k408_14552_c1_209_676 | 154 |
| 467 | 3300050496 | nmdc:mga07m45_12737_c2 | nmdc:mga07m45_12737_c2_734_1201 | 154 |
| 468 | 3300050496 | nmdc:mga07m45_286149_c1 | nmdc:mga07m45_286149_c1_226_696 | 154 |
| 469 | 3300050496 | nmdc:mga07m45_481906_c1 | nmdc:mga07m45_481906_c1_66_530 | 154 |
| 470 | 3300050496 | nmdc:mga07m45_84_c1 | nmdc:mga07m45_84_c1_3888_4355 | 154 |
| 471 | 3300050508 | nmdc:mga09592_150874_c1 | nmdc:mga09592_150874_c1_551_1015 | 154 |
| 472 | 3300050509 | nmdc:mga0qj67_363149_c1 | nmdc:mga0qj67_363149_c1_388_852 | 154 |
| 473 | 3300050512 | nmdc:mga0n895_936373_c1 | nmdc:mga0n895_936373_c1_140_604 | 154 |
| 474 | 3300050513 | nmdc:mga0rr50_89535_c1 | nmdc:mga0rr50_89535_c1_149_613 | 154 |
| 475 | 3300053098 | Ga0500650_0212810 | Ga0500650_0212810_187_651 | 154 |
| 476 | 3300053117 | Ga0500593_044150 | Ga0500593_044150_1326_1790 | 154 |
| 477 | 3300053129 | Ga0500628_003530 | Ga0500628_003530_1299_1763 | 154 |
| 478 | 3300053129 | Ga0500628_091000 | Ga0500628_091000_317_781 | 154 |
| 479 | 3300053161 | Ga0500634_0107301 | Ga0500634_0107301_142_606 | 154 |
| 480 | 3300053730 | Ga0500645_000214 | Ga0500645_000214_15029_15493 | 154 |
| 481 | 3300053730 | Ga0500645_005598 | Ga0500645_005598_3375_3839 | 154 |
| 482 | 3300055283 | Ga0500661_078399 | Ga0500661_078399_10_474 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7a4f-assembly1.cif.gz_AI | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) | 0.9926 | 15 | 83 |
| 7a4h-assembly1.cif.gz_BI | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) | 0.9781 | 15 | 81 |
| 7a4f-assembly1.cif.gz_AC | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) | 0.974 | 11 | 83 |
| 7a4h-assembly1.cif.gz_BB | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) | 0.9726 | 11 | 81 |
| 7a4h-assembly1.cif.gz_BK | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) | 0.9717 | 11 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nqwC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9617 | 11 | 154 | 3.40.50.960 |
| af_Q57751_4_141_3.40.50.960 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9468 | 17 | 153 | 3.40.50.960 |
| 2vi5I00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9335 | 12 | 154 | 3.40.50.960 |
| 3mk3100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9318 | 5 | 152 | 3.40.50.960 |
| 4kq6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9288 | 11 | 154 | 3.40.50.960 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519F3S4-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) | 0.9889 | 14 | 154 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A415CIA9-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9886 | 12 | 153 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A6N0ZF49-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9842 | 11 | 153 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A519F3S4-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) | 0.9819 | 14 | 154 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A537D277-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) | 0.9816 | 23 | 153 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar