F452676
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 482 | 313 | 964 | 450 |
Family's Representative Sequence
| Representative Sequence | 3300049579|Ga0501043_0001452|Ga0501043_0001452_16105_17631 |
| Length | 496 |
| Sequence | LKSSGEPAAVRERARIFIGPAMQSPPVSAILPCNRFHAYPPRQATEPMSQPSEQYAFPMGFLWGAATAAHQIEGSPLADGAGPSIWTRFAHTPGMMLNGDTGDVACDHYNRWRDDVKLMRELGLQAYRFSVSWSRILPEGTGRVNQKGLDFYSRLVDELLNNGIEPLLTLYHWDLPAALDDRGGWLNRDIADWFAEYASVMYRELDGRVKKWVTLNEPWVVTDGGYLHGALAPGHRSKYEAPIASHNLMRAHGAAVKAYRDIGRHEIGLVVNIEPKYAATGSAEDAAAVKRAHAYMNEQYLHPALLGHYPPELKEIFGDAWPQWQDEDYALIKQKLDFVGINYYTRSVTKAAESYPLNTGVVKQPLGTYTETGWEVFPQGLTDLLVWFKQTYGDLPVYITENGAAFKRRVKDPLRTDYLRKHLRAIHDAIEAGVDVRGYMLWSLLDNLEWSLGYSKRFGMVHVNYVTQERTPKDSALWYSKVIGSHGRSLSEPLPY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 88 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 91 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 159 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 160 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 161 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 183 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 184 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 185 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 186 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 187 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 188 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 189 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 190 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 195 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 196 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 197 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 201 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 204 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 253 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 254 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 255 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 256 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 257 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 258 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 259 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 260 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 261 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 270 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 282 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 283 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 286 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 288 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 289 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 290 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 291 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 293 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 296 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 297 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 298 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 299 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 300 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 301 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 302 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 303 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 304 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 305 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 306 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 307 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 308 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 309 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 310 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 311 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 312 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 313 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.27 |
| Metatranscriptomes | 0 |
| Isolates | 3.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.67 |
| Nodule | 0 |
| Rhizoplane | 2.9 |
| Rhizosphere | 65.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501043_0001452 | 3300049579 | Bacteria | 20714 |
| 2 | JGI24740J21852_10014350 | 3300001979 | Bacteria | 2925 |
| 3 | JGI24740J21852_10027201 | 3300001979 | Bacteria | 1905 |
| 4 | JGI24739J22299_10006323 | 3300001989 | Bacteria | 4473 |
| 5 | JGI24737J22298_10000405 | 3300001990 | Bacteria | 14741 |
| 6 | JGI24737J22298_10015247 | 3300001990 | Bacteria | 2488 |
| 7 | JGI25156J39149_1005442 | 3300002705 | Bacteria | 3670 |
| 8 | JGI25156J39149_1009540 | 3300002705 | Bacteria | 2348 |
| 9 | JGI25162J39368_1000280 | 3300002737 | Bacteria | 48423 |
| 10 | JGI25162J39368_1000901 | 3300002737 | Bacteria | 19346 |
| 11 | JGI25162J39368_1001340 | 3300002737 | Bacteria | 13673 |
| 12 | JGI25157J39369_1000355 | 3300002741 | Bacteria | 32037 |
| 13 | JGI25157J39369_1001433 | 3300002741 | Bacteria | 9016 |
| 14 | JGI25163J39215_1002392 | 3300002771 | Bacteria | 1964 |
| 15 | JGI25164J39214_1000181 | 3300002772 | Bacteria | 56084 |
| 16 | JGI25164J39214_1000403 | 3300002772 | Bacteria | 24869 |
| 17 | JGI25164J39214_1000606 | 3300002772 | Bacteria | 15529 |
| 18 | JGI25151J46595_10000388 | 3300003187 | Bacteria | 45635 |
| 19 | JGI25165J46597_1000333 | 3300003214 | Bacteria | 56084 |
| 20 | JGI25165J46597_1000539 | 3300003214 | Bacteria | 34949 |
| 21 | JGI25165J46597_1004558 | 3300003214 | Bacteria | 2930 |
| 22 | JGI25153J46596_10000007 | 3300003215 | Bacteria | 377573 |
| 23 | rootH2_10055080 | 3300003320 | Bacteria | 3529 |
| 24 | Ga0055538_1001009 | 3300003751 | Bacteria | 6470 |
| 25 | Ga0055525_1000082 | 3300003759 | Bacteria | 159396 |
| 26 | Ga0055525_1000127 | 3300003759 | Bacteria | 113683 |
| 27 | Ga0055527_1000072 | 3300003760 | Bacteria | 83753 |
| 28 | Ga0055527_1000080 | 3300003760 | Bacteria | 78211 |
| 29 | Ga0055535_1000162 | 3300003761 | Bacteria | 71868 |
| 30 | Ga0055535_1000255 | 3300003761 | Bacteria | 56084 |
| 31 | Ga0055542_1000038 | 3300003762 | Bacteria | 224625 |
| 32 | Ga0055542_1000163 | 3300003762 | Bacteria | 83753 |
| 33 | Ga0055542_1000184 | 3300003762 | Bacteria | 77138 |
| 34 | Ga0055542_1000351 | 3300003762 | Bacteria | 48423 |
| 35 | Ga0055529_1000002 | 3300003763 | Bacteria | 537914 |
| 36 | Ga0055529_1000021 | 3300003763 | Bacteria | 321484 |
| 37 | Ga0055529_1000310 | 3300003763 | Bacteria | 56084 |
| 38 | Ga0055529_1000336 | 3300003763 | Bacteria | 52511 |
| 39 | Ga0055526_1005760 | 3300003771 | Bacteria | 6987 |
| 40 | Ga0055530_10001652 | 3300003791 | Bacteria | 15903 |
| 41 | Ga0055531_10006404 | 3300003794 | Bacteria | 6694 |
| 42 | Ga0055531_10006437 | 3300003794 | Bacteria | 6668 |
| 43 | Ga0070676_10003144 | 3300005328 | Bacteria | 8537 |
| 44 | Ga0070670_100097740 | 3300005331 | Bacteria | 2526 |
| 45 | Ga0070677_10000899 | 3300005333 | Bacteria | 9791 |
| 46 | Ga0070677_10054666 | 3300005333 | Bacteria | 1627 |
| 47 | Ga0068869_100004636 | 3300005334 | Bacteria | 8573 |
| 48 | Ga0068869_100116182 | 3300005334 | Bacteria | 2041 |
| 49 | Ga0070666_10003140 | 3300005335 | Bacteria | 10030 |
| 50 | Ga0070666_10007659 | 3300005335 | Bacteria | 6666 |
| 51 | Ga0070680_100066342 | 3300005336 | Bacteria | 2959 |
| 52 | Ga0070682_100000168 | 3300005337 | Bacteria | 50136 |
| 53 | Ga0068868_100002161 | 3300005338 | Bacteria | 13569 |
| 54 | Ga0068868_100104995 | 3300005338 | Bacteria | 2290 |
| 55 | Ga0070660_100073195 | 3300005339 | Bacteria | 2679 |
| 56 | Ga0070691_10037395 | 3300005341 | Bacteria | 2290 |
| 57 | Ga0070661_100042670 | 3300005344 | Bacteria | 3311 |
| 58 | Ga0070668_100004755 | 3300005347 | Bacteria | 10073 |
| 59 | Ga0070669_100069811 | 3300005353 | Bacteria | 2595 |
| 60 | Ga0070675_100000024 | 3300005354 | Bacteria | 117191 |
| 61 | Ga0070675_100001895 | 3300005354 | Bacteria | 15437 |
| 62 | Ga0070671_100006355 | 3300005355 | Bacteria | 9430 |
| 63 | Ga0070674_100001341 | 3300005356 | Bacteria | 12981 |
| 64 | Ga0070674_100027411 | 3300005356 | Bacteria | 3733 |
| 65 | Ga0070674_100046012 | 3300005356 | Bacteria | 2983 |
| 66 | Ga0070673_100002952 | 3300005364 | Bacteria | 10482 |
| 67 | Ga0070673_100263897 | 3300005364 | Bacteria | 1505 |
| 68 | Ga0070659_100040752 | 3300005366 | Bacteria | 3629 |
| 69 | Ga0070659_100231140 | 3300005366 | Bacteria | 1528 |
| 70 | Ga0070667_100013380 | 3300005367 | Bacteria | 6782 |
| 71 | Ga0070714_100012438 | 3300005435 | Bacteria | 6795 |
| 72 | Ga0070714_100238309 | 3300005435 | Bacteria | 1678 |
| 73 | Ga0070713_100003190 | 3300005436 | Bacteria | 10794 |
| 74 | Ga0070713_100005149 | 3300005436 | Bacteria | 8903 |
| 75 | Ga0070700_100000002 | 3300005441 | Bacteria | 261904 |
| 76 | Ga0070663_100004597 | 3300005455 | Bacteria | 8129 |
| 77 | Ga0070663_100029074 | 3300005455 | Bacteria | 3771 |
| 78 | Ga0070678_100000070 | 3300005456 | Bacteria | 38119 |
| 79 | Ga0070678_100020145 | 3300005456 | Bacteria | 4370 |
| 80 | Ga0070662_100004569 | 3300005457 | Bacteria | 8764 |
| 81 | Ga0070681_10000982 | 3300005458 | Bacteria | 24130 |
| 82 | Ga0070681_10003651 | 3300005458 | Bacteria | 14442 |
| 83 | Ga0070681_10006247 | 3300005458 | Bacteria | 11587 |
| 84 | Ga0070681_10116494 | 3300005458 | Bacteria | 2609 |
| 85 | Ga0068867_100002745 | 3300005459 | Bacteria | 12407 |
| 86 | Ga0070685_10000802 | 3300005466 | Bacteria | 17054 |
| 87 | Ga0070706_100122862 | 3300005467 | Bacteria | 2420 |
| 88 | Ga0070698_100009683 | 3300005471 | Bacteria | 10305 |
| 89 | Ga0070699_100082973 | 3300005518 | Bacteria | 2795 |
| 90 | Ga0070684_100202294 | 3300005535 | Bacteria | 1809 |
| 91 | Ga0068853_100047862 | 3300005539 | Bacteria | 3670 |
| 92 | Ga0068853_100052526 | 3300005539 | Bacteria | 3511 |
| 93 | Ga0068853_100078099 | 3300005539 | Bacteria | 2892 |
| 94 | Ga0068853_100167513 | 3300005539 | Bacteria | 1986 |
| 95 | Ga0068853_100216584 | 3300005539 | Bacteria | 1747 |
| 96 | Ga0070672_100000486 | 3300005543 | Bacteria | 23097 |
| 97 | Ga0070696_100012467 | 3300005546 | Bacteria | 5704 |
| 98 | Ga0070693_100000542 | 3300005547 | Bacteria | 16805 |
| 99 | Ga0070693_100014592 | 3300005547 | Bacteria | 4028 |
| 100 | Ga0070693_100111814 | 3300005547 | Bacteria | 1681 |
| 101 | Ga0070665_100000316 | 3300005548 | Bacteria | 75107 |
| 102 | Ga0070665_100154170 | 3300005548 | Bacteria | 2299 |
| 103 | Ga0070704_100014195 | 3300005549 | Bacteria | 4970 |
| 104 | Ga0068857_100084412 | 3300005577 | Bacteria | 2838 |
| 105 | Ga0068852_100027375 | 3300005616 | Bacteria | 4646 |
| 106 | Ga0068852_100050448 | 3300005616 | Bacteria | 3566 |
| 107 | Ga0068861_100009118 | 3300005719 | Bacteria | 6841 |
| 108 | Ga0068861_100073875 | 3300005719 | Bacteria | 2650 |
| 109 | Ga0068863_100033854 | 3300005841 | Bacteria | 4868 |
| 110 | Ga0070717_10000147 | 3300006028 | Bacteria | 52381 |
| 111 | Ga0070716_100003577 | 3300006173 | Bacteria | 7339 |
| 112 | Ga0075367_10053133 | 3300006178 | Bacteria | 2400 |
| 113 | Ga0068871_100032660 | 3300006358 | Bacteria | 4114 |
| 114 | Ga0075430_100153331 | 3300006846 | Bacteria | 1918 |
| 115 | Ga0075431_100067018 | 3300006847 | Bacteria | 3706 |
| 116 | Ga0075431_100180344 | 3300006847 | Bacteria | 2167 |
| 117 | Ga0075433_10032847 | 3300006852 | Bacteria | 4447 |
| 118 | Ga0068865_100037509 | 3300006881 | Bacteria | 3273 |
| 119 | Ga0105240_10015624 | 3300009093 | Bacteria | 10309 |
| 120 | Ga0105240_10024760 | 3300009093 | Bacteria | 7905 |
| 121 | Ga0111539_10033119 | 3300009094 | Bacteria | 6274 |
| 122 | Ga0111539_10111172 | 3300009094 | Bacteria | 3215 |
| 123 | Ga0105245_10000021 | 3300009098 | Bacteria | 181628 |
| 124 | Ga0105245_10000284 | 3300009098 | Bacteria | 48293 |
| 125 | Ga0114129_10000133 | 3300009147 | Bacteria | 76429 |
| 126 | Ga0114129_10343454 | 3300009147 | Bacteria | 1979 |
| 127 | Ga0105243_10000388 | 3300009148 | Bacteria | 46841 |
| 128 | Ga0105243_10031401 | 3300009148 | Bacteria | 4095 |
| 129 | Ga0105248_10003094 | 3300009177 | Bacteria | 18444 |
| 130 | Ga0105248_10136625 | 3300009177 | Bacteria | 2766 |
| 131 | Ga0105238_10152415 | 3300009551 | Bacteria | 2287 |
| 132 | Ga0105239_10000480 | 3300010375 | Bacteria | 58268 |
| 133 | Ga0105239_10106837 | 3300010375 | Bacteria | 3101 |
| 134 | Ga0157373_10012609 | 3300013100 | Bacteria | 6214 |
| 135 | Ga0157371_10000011 | 3300013102 | Bacteria | 377608 |
| 136 | Ga0157370_10168223 | 3300013104 | Bacteria | 2038 |
| 137 | Ga0157370_10219529 | 3300013104 | Bacteria | 1761 |
| 138 | Ga0157378_10000054 | 3300013297 | Bacteria | 99226 |
| 139 | Ga0157372_10126008 | 3300013307 | Bacteria | 2944 |
| 140 | Ga0157375_10006843 | 3300013308 | Bacteria | 9934 |
| 141 | Ga0183365_10003 | 3300015684 | Bacteria | 414944 |
| 142 | Ga0183369_1004 | 3300015685 | Bacteria | 539301 |
| 143 | Ga0163161_10027610 | 3300017792 | Bacteria | 4028 |
| 144 | Ga0163161_10059771 | 3300017792 | Bacteria | 2772 |
| 145 | Ga0213876_10006790 | 3300021384 | Bacteria | 6250 |
| 146 | Ga0213876_10026660 | 3300021384 | Bacteria | 3048 |
| 147 | Ga0209784_100143 | 3300025224 | Bacteria | 65902 |
| 148 | Ga0209566_102612 | 3300025225 | Bacteria | 3194 |
| 149 | Ga0209674_100522 | 3300025226 | Bacteria | 15616 |
| 150 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 151 | Ga0209563_100097 | 3300025230 | Bacteria | 159453 |
| 152 | Ga0209563_100125 | 3300025230 | Bacteria | 113854 |
| 153 | Ga0207427_100059 | 3300025231 | Bacteria | 186680 |
| 154 | Ga0207427_100119 | 3300025231 | Bacteria | 101986 |
| 155 | Ga0207427_100141 | 3300025231 | Bacteria | 83903 |
| 156 | Ga0207427_100583 | 3300025231 | Bacteria | 18427 |
| 157 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 158 | Ga0209437_100123 | 3300025233 | Bacteria | 200393 |
| 159 | Ga0209437_100253 | 3300025233 | Bacteria | 83916 |
| 160 | Ga0209437_100794 | 3300025233 | Bacteria | 14630 |
| 161 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 162 | Ga0209258_100281 | 3300025242 | Bacteria | 85049 |
| 163 | Ga0207425_1000866 | 3300025245 | Bacteria | 14778 |
| 164 | Ga0209646_1000461 | 3300025246 | Bacteria | 20727 |
| 165 | Ga0209026_1000113 | 3300025250 | Bacteria | 139047 |
| 166 | Ga0209026_1000174 | 3300025250 | Bacteria | 98063 |
| 167 | Ga0209026_1001885 | 3300025250 | Bacteria | 8531 |
| 168 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 169 | Ga0209148_1000016 | 3300025254 | Bacteria | 804369 |
| 170 | Ga0209148_1000121 | 3300025254 | Bacteria | 186730 |
| 171 | Ga0209148_1000252 | 3300025254 | Bacteria | 85199 |
| 172 | Ga0209759_1000216 | 3300025256 | Bacteria | 88494 |
| 173 | Ga0209759_1001274 | 3300025256 | Bacteria | 15101 |
| 174 | Ga0209759_1016533 | 3300025256 | Bacteria | 1858 |
| 175 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 176 | Ga0209233_1000046 | 3300025261 | Bacteria | 470971 |
| 177 | Ga0209233_1000136 | 3300025261 | Bacteria | 200393 |
| 178 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 179 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 180 | Ga0209455_1000120 | 3300025272 | Bacteria | 173966 |
| 181 | Ga0209455_1014781 | 3300025272 | Bacteria | 1748 |
| 182 | Ga0209130_1007023 | 3300025284 | Bacteria | 3548 |
| 183 | Ga0209675_1004927 | 3300025291 | Bacteria | 5762 |
| 184 | Ga0209676_1000886 | 3300025292 | Bacteria | 38327 |
| 185 | Ga0209676_1004714 | 3300025292 | Bacteria | 7470 |
| 186 | Ga0209676_1006378 | 3300025292 | Bacteria | 5838 |
| 187 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 188 | Ga0209025_1002525 | 3300025294 | Bacteria | 19140 |
| 189 | Ga0209025_1009121 | 3300025294 | Bacteria | 6979 |
| 190 | Ga0209564_1014739 | 3300025295 | Bacteria | 3227 |
| 191 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 192 | Ga0209758_1020532 | 3300025297 | Bacteria | 3120 |
| 193 | Ga0209050_1002042 | 3300025298 | Bacteria | 18608 |
| 194 | Ga0209256_1003671 | 3300025299 | Bacteria | 10465 |
| 195 | Ga0209256_1003714 | 3300025299 | Bacteria | 10354 |
| 196 | Ga0209051_1003562 | 3300025303 | Bacteria | 10129 |
| 197 | Ga0209257_1000693 | 3300025304 | Bacteria | 52279 |
| 198 | Ga0209257_1001098 | 3300025304 | Bacteria | 35264 |
| 199 | Ga0209257_1003368 | 3300025304 | Bacteria | 13805 |
| 200 | Ga0207656_10000979 | 3300025321 | Bacteria | 9307 |
| 201 | Ga0207682_10001163 | 3300025893 | Bacteria | 12207 |
| 202 | Ga0207682_10079923 | 3300025893 | Bacteria | 1400 |
| 203 | Ga0207692_10014345 | 3300025898 | Bacteria | 3461 |
| 204 | Ga0207680_10034922 | 3300025903 | Bacteria | 2881 |
| 205 | Ga0207647_10004114 | 3300025904 | Bacteria | 10793 |
| 206 | Ga0207647_10026223 | 3300025904 | Bacteria | 3816 |
| 207 | Ga0207645_10000982 | 3300025907 | Bacteria | 23565 |
| 208 | Ga0207705_10000335 | 3300025909 | Bacteria | 42589 |
| 209 | Ga0207705_10007245 | 3300025909 | Bacteria | 8163 |
| 210 | Ga0207707_10003532 | 3300025912 | Bacteria | 13845 |
| 211 | Ga0207707_10051419 | 3300025912 | Bacteria | 3588 |
| 212 | Ga0207707_10094968 | 3300025912 | Bacteria | 2606 |
| 213 | Ga0207695_10003927 | 3300025913 | Bacteria | 20570 |
| 214 | Ga0207695_10024612 | 3300025913 | Bacteria | 6766 |
| 215 | Ga0207671_10015746 | 3300025914 | Bacteria | 5907 |
| 216 | Ga0207660_10062062 | 3300025917 | Bacteria | 2692 |
| 217 | Ga0207657_10010295 | 3300025919 | Bacteria | 9336 |
| 218 | Ga0207657_10035354 | 3300025919 | Bacteria | 4481 |
| 219 | Ga0207649_10002163 | 3300025920 | Bacteria | 11118 |
| 220 | Ga0207649_10015597 | 3300025920 | Bacteria | 4268 |
| 221 | Ga0207652_10086337 | 3300025921 | Bacteria | 2751 |
| 222 | Ga0207652_10112715 | 3300025921 | Bacteria | 2414 |
| 223 | Ga0207694_10003484 | 3300025924 | Bacteria | 12513 |
| 224 | Ga0207694_10024771 | 3300025924 | Bacteria | 4558 |
| 225 | Ga0207694_10038076 | 3300025924 | Bacteria | 3697 |
| 226 | Ga0207659_10000029 | 3300025926 | Bacteria | 129487 |
| 227 | Ga0207659_10012753 | 3300025926 | Bacteria | 5365 |
| 228 | Ga0207687_10000002 | 3300025927 | Bacteria | 975489 |
| 229 | Ga0207687_10000927 | 3300025927 | Bacteria | 19983 |
| 230 | Ga0207700_10002420 | 3300025928 | Bacteria | 10717 |
| 231 | Ga0207700_10004250 | 3300025928 | Bacteria | 8415 |
| 232 | Ga0207664_10000777 | 3300025929 | Bacteria | 21549 |
| 233 | Ga0207664_10010604 | 3300025929 | Bacteria | 6512 |
| 234 | Ga0207690_10001859 | 3300025932 | Bacteria | 12970 |
| 235 | Ga0207690_10026464 | 3300025932 | Bacteria | 3652 |
| 236 | Ga0207690_10032263 | 3300025932 | Bacteria | 3359 |
| 237 | Ga0207690_10049581 | 3300025932 | Bacteria | 2800 |
| 238 | Ga0207706_10004573 | 3300025933 | Bacteria | 12985 |
| 239 | Ga0207709_10000116 | 3300025935 | Bacteria | 123061 |
| 240 | Ga0207709_10023288 | 3300025935 | Bacteria | 3523 |
| 241 | Ga0207670_10179325 | 3300025936 | Bacteria | 1594 |
| 242 | Ga0207669_10000022 | 3300025937 | Bacteria | 100002 |
| 243 | Ga0207669_10043852 | 3300025937 | Bacteria | 2622 |
| 244 | Ga0207665_10023735 | 3300025939 | Bacteria | 4039 |
| 245 | Ga0207691_10000040 | 3300025940 | Bacteria | 106561 |
| 246 | Ga0207691_10100282 | 3300025940 | Bacteria | 2585 |
| 247 | Ga0207691_10103059 | 3300025940 | Bacteria | 2545 |
| 248 | Ga0207661_10038415 | 3300025944 | Bacteria | 3752 |
| 249 | Ga0207679_10053242 | 3300025945 | Bacteria | 2973 |
| 250 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 251 | Ga0207667_10004720 | 3300025949 | Bacteria | 16684 |
| 252 | Ga0207667_10009264 | 3300025949 | Bacteria | 11624 |
| 253 | Ga0207667_10024284 | 3300025949 | Bacteria | 6657 |
| 254 | Ga0207668_10004479 | 3300025972 | Bacteria | 8214 |
| 255 | Ga0207668_10109439 | 3300025972 | Bacteria | 2070 |
| 256 | Ga0207677_10005792 | 3300026023 | Bacteria | 6722 |
| 257 | Ga0207639_10000696 | 3300026041 | Bacteria | 23097 |
| 258 | Ga0207639_10229238 | 3300026041 | Bacteria | 1609 |
| 259 | Ga0207678_10002184 | 3300026067 | Bacteria | 17670 |
| 260 | Ga0207678_10006003 | 3300026067 | Bacteria | 10808 |
| 261 | Ga0207708_10000137 | 3300026075 | Bacteria | 57745 |
| 262 | Ga0207702_10004312 | 3300026078 | Bacteria | 12685 |
| 263 | Ga0207641_10054503 | 3300026088 | Bacteria | 3393 |
| 264 | Ga0207648_10003734 | 3300026089 | Bacteria | 15928 |
| 265 | Ga0207674_10018531 | 3300026116 | Bacteria | 7563 |
| 266 | Ga0207674_10029891 | 3300026116 | Bacteria | 5733 |
| 267 | Ga0207674_10057706 | 3300026116 | Bacteria | 3935 |
| 268 | Ga0207674_10208619 | 3300026116 | Bacteria | 1903 |
| 269 | Ga0207675_100008676 | 3300026118 | Bacteria | 9555 |
| 270 | Ga0207675_100102808 | 3300026118 | Bacteria | 2692 |
| 271 | Ga0207683_10000059 | 3300026121 | Bacteria | 83666 |
| 272 | Ga0207683_10000891 | 3300026121 | Bacteria | 27449 |
| 273 | Ga0207698_10109848 | 3300026142 | Bacteria | 2308 |
| 274 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 275 | Ga0268266_10121942 | 3300028379 | Bacteria | 2320 |
| 276 | Ga0307517_10014622 | 3300028786 | Bacteria | 10520 |
| 277 | Ga0307517_10016865 | 3300028786 | Bacteria | 9568 |
| 278 | Ga0307511_10000992 | 3300030521 | Bacteria | 30166 |
| 279 | Ga0316177_1148466 | 3300030731 | Bacteria | 5229 |
| 280 | Ga0314311_1128705 | 3300030733 | Bacteria | 5994 |
| 281 | Ga0307513_10001996 | 3300031456 | Bacteria | 28859 |
| 282 | Ga0307509_10012290 | 3300031507 | Bacteria | 10260 |
| 283 | Ga0307509_10055265 | 3300031507 | Bacteria | 4220 |
| 284 | Ga0307408_100017259 | 3300031548 | Bacteria | 4829 |
| 285 | Ga0307408_100123846 | 3300031548 | Bacteria | 2007 |
| 286 | Ga0307508_10131773 | 3300031616 | Bacteria | 2104 |
| 287 | Ga0307405_10047341 | 3300031731 | Bacteria | 2647 |
| 288 | Ga0307410_10027328 | 3300031852 | Bacteria | 3605 |
| 289 | Ga0307410_10091212 | 3300031852 | Bacteria | 2163 |
| 290 | Ga0307407_10000106 | 3300031903 | Bacteria | 27091 |
| 291 | Ga0307412_10018205 | 3300031911 | Bacteria | 4222 |
| 292 | Ga0307409_100002488 | 3300031995 | Bacteria | 9658 |
| 293 | Ga0307416_100001242 | 3300032002 | Bacteria | 13767 |
| 294 | Ga0307411_10011112 | 3300032005 | Bacteria | 4839 |
| 295 | Ga0307415_100063485 | 3300032126 | Bacteria | 2566 |
| 296 | Ga0373959_0000311 | 3300034820 | Bacteria | 10125 |
| 297 | Ga0373924_0070978 | 3300035410 | Bacteria | 1469 |
| 298 | Ga0373935_0123070 | 3300035692 | Bacteria | 1735 |
| 299 | Ga0373933_0074891 | 3300035724 | Bacteria | 2066 |
| 300 | Ga0373937_0084862 | 3300036401 | Bacteria | 2930 |
| 301 | Ga0395905_0211762 | 3300037471 | Bacteria | 1816 |
| 302 | Ga0395901_0001119 | 3300038443 | Bacteria | 28462 |
| 303 | Ga0395901_0390980 | 3300038443 | Bacteria | 1430 |
| 304 | Ga0436365_0023370 | 3300039437 | Bacteria | 11186 |
| 305 | Ga0436365_0959136 | 3300039437 | Bacteria | 6273 |
| 306 | Ga0436365_1486542 | 3300039437 | Bacteria | 4898 |
| 307 | Ga0436365_1572769 | 3300039437 | Bacteria | 5691 |
| 308 | Ga0439436_0001177 | 3300041404 | Bacteria | 7429 |
| 309 | Ga0439439_0002085 | 3300041406 | Bacteria | 4167 |
| 310 | Ga0439447_001957 | 3300041407 | Bacteria | 7555 |
| 311 | Ga0439445_0009957 | 3300042004 | Bacteria | 2244 |
| 312 | Ga0439432_008578 | 3300042006 | Bacteria | 3588 |
| 313 | Ga0439432_010403 | 3300042006 | Bacteria | 3221 |
| 314 | Ga0439449_0010431 | 3300042007 | Bacteria | 3508 |
| 315 | Ga0451577_0038971 | 3300042876 | Bacteria | 4271 |
| 316 | Ga0466969_0000887 | 3300044656 | Bacteria | 16166 |
| 317 | Ga0466969_0026300 | 3300044656 | Bacteria | 2985 |
| 318 | Ga0466982_0000001 | 3300044672 | Bacteria | 514662 |
| 319 | Ga0466966_0000166 | 3300044684 | Bacteria | 43290 |
| 320 | Ga0466966_0036599 | 3300044684 | Bacteria | 3168 |
| 321 | Ga0466961_0036431 | 3300044693 | Bacteria | 3157 |
| 322 | Ga0466963_0230059 | 3300044694 | Bacteria | 1299 |
| 323 | Ga0466964_0004399 | 3300044706 | Bacteria | 5198 |
| 324 | Ga0453684_0011827 | 3300044712 | Bacteria | 14545 |
| 325 | Ga0453684_0043550 | 3300044712 | Bacteria | 6031 |
| 326 | Ga0453684_0106731 | 3300044712 | Bacteria | 3412 |
| 327 | Ga0466971_0001003 | 3300044719 | Bacteria | 11652 |
| 328 | Ga0466971_0002336 | 3300044719 | Bacteria | 8024 |
| 329 | Ga0466968_0002139 | 3300044735 | Bacteria | 7198 |
| 330 | Ga0466970_0012345 | 3300044765 | Bacteria | 4366 |
| 331 | Ga0466970_0031646 | 3300044765 | Bacteria | 2794 |
| 332 | Ga0466957_0024833 | 3300044842 | Bacteria | 3549 |
| 333 | Ga0466960_0010717 | 3300044901 | Bacteria | 3813 |
| 334 | Ga0466960_0108949 | 3300044901 | Bacteria | 1436 |
| 335 | Ga0466959_0000146 | 3300045049 | Bacteria | 46290 |
| 336 | Ga0466959_0028609 | 3300045049 | Bacteria | 4133 |
| 337 | Ga0466959_0101468 | 3300045049 | Bacteria | 2059 |
| 338 | Ga0451576_0144579 | 3300045051 | Bacteria | 2480 |
| 339 | Ga0466958_0011101 | 3300045836 | Bacteria | 5066 |
| 340 | Ga0466958_0031495 | 3300045836 | Bacteria | 3152 |
| 341 | Ga0466958_0035508 | 3300045836 | Bacteria | 2978 |
| 342 | Ga0495638_0000127 | 3300046460 | Bacteria | 123576 |
| 343 | Ga0495638_0180626 | 3300046460 | Bacteria | 1204 |
| 344 | Ga0495651_0043628 | 3300046462 | Bacteria | 3479 |
| 345 | Ga0495653_0151173 | 3300046463 | Bacteria | 1622 |
| 346 | Ga0495650_0000983 | 3300046471 | Bacteria | 32562 |
| 347 | Ga0495650_0047179 | 3300046471 | Bacteria | 1803 |
| 348 | Ga0495585_0027562 | 3300046492 | Bacteria | 3242 |
| 349 | Ga0495596_0008418 | 3300046500 | Bacteria | 4593 |
| 350 | Ga0495583_0003318 | 3300046506 | Bacteria | 12470 |
| 351 | Ga0495606_0000178 | 3300046507 | Bacteria | 112329 |
| 352 | Ga0495608_0003542 | 3300046511 | Bacteria | 11186 |
| 353 | Ga0495628_0124455 | 3300046516 | Bacteria | 1976 |
| 354 | Ga0495631_0011207 | 3300046518 | Bacteria | 4417 |
| 355 | Ga0495637_0009976 | 3300046520 | Bacteria | 4616 |
| 356 | Ga0495643_0015521 | 3300046522 | Bacteria | 4498 |
| 357 | Ga0495643_0086400 | 3300046522 | Bacteria | 1625 |
| 358 | Ga0495663_0004311 | 3300046525 | Bacteria | 4008 |
| 359 | Ga0495663_0014824 | 3300046525 | Bacteria | 2189 |
| 360 | Ga0495642_0006327 | 3300046528 | Bacteria | 4540 |
| 361 | Ga0495652_0061714 | 3300046529 | Bacteria | 3163 |
| 362 | Ga0495587_0038338 | 3300046536 | Bacteria | 2874 |
| 363 | Ga0495621_0012386 | 3300046539 | Bacteria | 2659 |
| 364 | Ga0495645_0022120 | 3300046543 | Bacteria | 4599 |
| 365 | Ga0495622_0003838 | 3300046557 | Bacteria | 7020 |
| 366 | Ga0495633_0000308 | 3300046558 | Bacteria | 55659 |
| 367 | Ga0495667_0021324 | 3300046559 | Bacteria | 4373 |
| 368 | Ga0495656_0094088 | 3300046615 | Bacteria | 1375 |
| 369 | Ga0495668_0000013 | 3300046616 | Bacteria | 452938 |
| 370 | Ga0495625_0000645 | 3300046660 | Bacteria | 50263 |
| 371 | Ga0495625_0023184 | 3300046660 | Bacteria | 4743 |
| 372 | Ga0495625_0084490 | 3300046660 | Bacteria | 2204 |
| 373 | Ga0495625_0134139 | 3300046660 | Bacteria | 1675 |
| 374 | Ga0495625_0143651 | 3300046660 | Bacteria | 1608 |
| 375 | Ga0495661_0059774 | 3300046665 | Bacteria | 2267 |
| 376 | Ga0495599_0026188 | 3300046678 | Bacteria | 3654 |
| 377 | Ga0495623_0011595 | 3300046679 | Bacteria | 5707 |
| 378 | Ga0495669_0000340 | 3300046684 | Bacteria | 24667 |
| 379 | Ga0495670_0015049 | 3300046691 | Bacteria | 3806 |
| 380 | Ga0495649_0014015 | 3300046694 | Bacteria | 4609 |
| 381 | Ga0495600_0095021 | 3300046809 | Bacteria | 1943 |
| 382 | Ga0495672_0115791 | 3300047320 | Bacteria | 1432 |
| 383 | Ga0495687_000250 | 3300047443 | Bacteria | 72797 |
| 384 | Ga0495687_001110 | 3300047443 | Bacteria | 26203 |
| 385 | Ga0495677_0002204 | 3300047445 | Bacteria | 7723 |
| 386 | Ga0495681_0002442 | 3300047470 | Bacteria | 13265 |
| 387 | Ga0495686_0000905 | 3300047472 | Bacteria | 37315 |
| 388 | Ga0496100_0061160 | 3300048903 | Bacteria | 2481 |
| 389 | Ga0496101_0239619 | 3300048904 | Bacteria | 1411 |
| 390 | Ga0496102_0000022 | 3300048905 | Bacteria | 246314 |
| 391 | Ga0496102_0053710 | 3300048905 | Bacteria | 3672 |
| 392 | Ga0496103_0000167 | 3300048906 | Bacteria | 68561 |
| 393 | Ga0496104_0000885 | 3300048907 | Bacteria | 25762 |
| 394 | Ga0496105_0000668 | 3300048908 | Bacteria | 23033 |
| 395 | Ga0496106_0010117 | 3300048909 | Bacteria | 6966 |
| 396 | Ga0496110_0004550 | 3300048913 | Bacteria | 10770 |
| 397 | Ga0496111_0000547 | 3300048914 | Bacteria | 19476 |
| 398 | Ga0496113_0114596 | 3300048916 | Bacteria | 2102 |
| 399 | Ga0496115_0000029 | 3300048918 | Bacteria | 141359 |
| 400 | Ga0496115_0000971 | 3300048918 | Bacteria | 20830 |
| 401 | Ga0496115_0009785 | 3300048918 | Bacteria | 7139 |
| 402 | Ga0496116_0003580 | 3300048919 | Bacteria | 15276 |
| 403 | Ga0496116_0057169 | 3300048919 | Bacteria | 2552 |
| 404 | Ga0496117_0000260 | 3300048920 | Bacteria | 99636 |
| 405 | Ga0496117_0044683 | 3300048920 | Bacteria | 3206 |
| 406 | Ga0496118_0000039 | 3300048921 | Bacteria | 305458 |
| 407 | Ga0496118_0004947 | 3300048921 | Bacteria | 15439 |
| 408 | Ga0496118_0008347 | 3300048921 | Bacteria | 10723 |
| 409 | Ga0496119_0000291 | 3300048922 | Bacteria | 70213 |
| 410 | Ga0496119_0004099 | 3300048922 | Bacteria | 14690 |
| 411 | Ga0496120_0000397 | 3300048923 | Bacteria | 70206 |
| 412 | Ga0496120_0002636 | 3300048923 | Bacteria | 17757 |
| 413 | Ga0496121_0000531 | 3300048924 | Bacteria | 72444 |
| 414 | Ga0496121_0000683 | 3300048924 | Bacteria | 63257 |
| 415 | Ga0496124_0000076 | 3300048927 | Bacteria | 215767 |
| 416 | Ga0496125_0001403 | 3300048928 | Bacteria | 35176 |
| 417 | Ga0496126_0000469 | 3300048929 | Bacteria | 80156 |
| 418 | Ga0496126_0002422 | 3300048929 | Bacteria | 25251 |
| 419 | Ga0496126_0011359 | 3300048929 | Bacteria | 9232 |
| 420 | Ga0496126_0224405 | 3300048929 | Bacteria | 1576 |
| 421 | Ga0495682_0004746 | 3300049460 | Bacteria | 5744 |
| 422 | Ga0501034_0000427 | 3300049571 | Bacteria | 70077 |
| 423 | Ga0501034_0117822 | 3300049571 | Bacteria | 2643 |
| 424 | Ga0501038_0061695 | 3300049574 | Bacteria | 3205 |
| 425 | Ga0501040_0090886 | 3300049576 | Bacteria | 2122 |
| 426 | Ga0501047_0108441 | 3300049581 | Bacteria | 2659 |
| 427 | Ga0501070_0035071 | 3300049586 | Bacteria | 4193 |
| 428 | Ga0501071_0317885 | 3300049587 | Bacteria | 1182 |
| 429 | Ga0501077_0075685 | 3300049593 | Bacteria | 2132 |
| 430 | Ga0501238_007818 | 3300049671 | Bacteria | 1397 |
| 431 | Ga0501083_0001902 | 3300049744 | Bacteria | 14338 |
| 432 | Ga0501035_0041290 | 3300049822 | Bacteria | 4166 |
| 433 | Ga0501044_0044936 | 3300049823 | Bacteria | 4580 |
| 434 | Ga0501044_0114192 | 3300049823 | Bacteria | 2707 |
| 435 | nmdc:mga05p37_1346_c1 | 3300050507 | Bacteria | 28561 |
| 436 | nmdc:mga05p37_55019_c1 | 3300050507 | Bacteria | 4896 |
| 437 | nmdc:mga05p37_85950_c1 | 3300050507 | Bacteria | 3876 |
| 438 | nmdc:mga09592_63952_c1 | 3300050508 | Bacteria | 3115 |
| 439 | nmdc:mga09592_92632_c1 | 3300050508 | Bacteria | 2583 |
| 440 | nmdc:mga0qj67_19802_c1 | 3300050509 | Bacteria | 5146 |
| 441 | nmdc:mga06r32_6684_c1 | 3300050510 | Bacteria | 10363 |
| 442 | nmdc:mga0n895_392355_c1 | 3300050512 | Bacteria | 1404 |
| 443 | nmdc:mga0rr50_2432_c1 | 3300050513 | Bacteria | 10497 |
| 444 | nmdc:mga0a205_47346_c1 | 3300050515 | Bacteria | 4148 |
| 445 | nmdc:mga0a205_63286_c1 | 3300050515 | Bacteria | 3574 |
| 446 | Ga0495601_0011167 | 3300053077 | Bacteria | 5364 |
| 447 | Ga0500610_0000189 | 3300053079 | Bacteria | 18595 |
| 448 | Ga0500635_0000442 | 3300053080 | Bacteria | 11984 |
| 449 | Ga0495655_0001092 | 3300053083 | Bacteria | 4195 |
| 450 | Ga0495619_0017405 | 3300053085 | Bacteria | 4550 |
| 451 | Ga0500643_009003 | 3300053087 | Bacteria | 3858 |
| 452 | Ga0500644_0002593 | 3300053088 | Bacteria | 4515 |
| 453 | Ga0500556_0000130 | 3300053104 | Bacteria | 63676 |
| 454 | Ga0500642_0000812 | 3300053130 | Bacteria | 9163 |
| 455 | Ga0500568_0007236 | 3300053139 | Bacteria | 5468 |
| 456 | Ga0500622_0052336 | 3300053156 | Unclassified | 2099 |
| 457 | Ga0500636_0001153 | 3300053177 | Bacteria | 14185 |
| 458 | Ga0500645_000024 | 3300053730 | Bacteria | 126024 |
| 459 | Ga0500645_003260 | 3300053730 | Bacteria | 6701 |
| 460 | Ga0500596_001541 | 3300053735 | Bacteria | 4668 |
| 461 | Ga0501082_0093345 | 3300060353 | Bacteria | 2600 |
| 462 | Ga0466962_0000955 | 3300061719 | Bacteria | 13115 |
| 463 | Ga0466962_0002939 | 3300061719 | Bacteria | 8127 |
| 464 | Ga0466962_0004711 | 3300061719 | Bacteria | 6554 |
| 465 | 2523102974 | 2522572158 | Bacteria | 6514390 |
| 466 | 2538835059 | 2537561836 | Bacteria | 3910579 |
| 467 | 2643817622 | 2643221559 | Bacteria | 4424915 |
| 468 | 2643828469 | 2643221562 | Bacteria | 4048635 |
| 469 | 2643878839 | 2643221573 | Bacteria | 4784121 |
| 470 | 2643940334 | 2643221586 | Bacteria | 4446529 |
| 471 | 2643976581 | 2643221593 | Bacteria | 6296053 |
| 472 | 2644079405 | 2643221612 | Bacteria | 4361984 |
| 473 | 2644660155 | 2643221720 | Bacteria | 4694283 |
| 474 | 2644694849 | 2643221727 | Bacteria | 4415595 |
| 475 | 2644697456 | 2643221728 | Bacteria | 4797149 |
| 476 | 2687584707 | 2687453130 | Bacteria | 4227172 |
| 477 | 2739733584 | 2739367700 | Bacteria | 4747630 |
| 478 | 2884416258 | 2884411467 | Bacteria | 5246714 |
| 479 | 2895397858 | 2895395659 | Bacteria | 3983269 |
| 480 | 2928966229 | 2928963466 | Bacteria | 5165703 |
| 481 | 2939613730 | 2939611941 | Bacteria | 3892017 |
| 482 | 8003014469 | 8003014200 | Bacteria | 4059994 |
| 483 | Ga0501043_0001452 | |||
| 484 | JGI24740J21852_10014350 | |||
| 485 | JGI24740J21852_10027201 | |||
| 486 | JGI24739J22299_10006323 | |||
| 487 | JGI24737J22298_10000405 | |||
| 488 | JGI24737J22298_10015247 | |||
| 489 | JGI25156J39149_1005442 | |||
| 490 | JGI25156J39149_1009540 | |||
| 491 | JGI25162J39368_1000280 | |||
| 492 | JGI25162J39368_1000901 | |||
| 493 | JGI25162J39368_1001340 | |||
| 494 | JGI25157J39369_1000355 | |||
| 495 | JGI25157J39369_1001433 | |||
| 496 | JGI25163J39215_1002392 | |||
| 497 | JGI25164J39214_1000181 | |||
| 498 | JGI25164J39214_1000403 | |||
| 499 | JGI25164J39214_1000606 | |||
| 500 | JGI25151J46595_10000388 | |||
| 501 | JGI25165J46597_1000333 | |||
| 502 | JGI25165J46597_1000539 | |||
| 503 | JGI25165J46597_1004558 | |||
| 504 | JGI25153J46596_10000007 | |||
| 505 | rootH2_10055080 | |||
| 506 | Ga0055538_1001009 | |||
| 507 | Ga0055525_1000082 | |||
| 508 | Ga0055525_1000127 | |||
| 509 | Ga0055527_1000072 | |||
| 510 | Ga0055527_1000080 | |||
| 511 | Ga0055535_1000162 | |||
| 512 | Ga0055535_1000255 | |||
| 513 | Ga0055542_1000038 | |||
| 514 | Ga0055542_1000163 | |||
| 515 | Ga0055542_1000184 | |||
| 516 | Ga0055542_1000351 | |||
| 517 | Ga0055529_1000002 | |||
| 518 | Ga0055529_1000021 | |||
| 519 | Ga0055529_1000310 | |||
| 520 | Ga0055529_1000336 | |||
| 521 | Ga0055526_1005760 | |||
| 522 | Ga0055530_10001652 | |||
| 523 | Ga0055531_10006404 | |||
| 524 | Ga0055531_10006437 | |||
| 525 | Ga0070676_10003144 | |||
| 526 | Ga0070670_100097740 | |||
| 527 | Ga0070677_10000899 | |||
| 528 | Ga0070677_10054666 | |||
| 529 | Ga0068869_100004636 | |||
| 530 | Ga0068869_100116182 | |||
| 531 | Ga0070666_10003140 | |||
| 532 | Ga0070666_10007659 | |||
| 533 | Ga0070680_100066342 | |||
| 534 | Ga0070682_100000168 | |||
| 535 | Ga0068868_100002161 | |||
| 536 | Ga0068868_100104995 | |||
| 537 | Ga0070660_100073195 | |||
| 538 | Ga0070691_10037395 | |||
| 539 | Ga0070661_100042670 | |||
| 540 | Ga0070668_100004755 | |||
| 541 | Ga0070669_100069811 | |||
| 542 | Ga0070675_100000024 | |||
| 543 | Ga0070675_100001895 | |||
| 544 | Ga0070671_100006355 | |||
| 545 | Ga0070674_100001341 | |||
| 546 | Ga0070674_100027411 | |||
| 547 | Ga0070674_100046012 | |||
| 548 | Ga0070673_100002952 | |||
| 549 | Ga0070673_100263897 | |||
| 550 | Ga0070659_100040752 | |||
| 551 | Ga0070659_100231140 | |||
| 552 | Ga0070667_100013380 | |||
| 553 | Ga0070714_100012438 | |||
| 554 | Ga0070714_100238309 | |||
| 555 | Ga0070713_100003190 | |||
| 556 | Ga0070713_100005149 | |||
| 557 | Ga0070700_100000002 | |||
| 558 | Ga0070663_100004597 | |||
| 559 | Ga0070663_100029074 | |||
| 560 | Ga0070678_100000070 | |||
| 561 | Ga0070678_100020145 | |||
| 562 | Ga0070662_100004569 | |||
| 563 | Ga0070681_10000982 | |||
| 564 | Ga0070681_10003651 | |||
| 565 | Ga0070681_10006247 | |||
| 566 | Ga0070681_10116494 | |||
| 567 | Ga0068867_100002745 | |||
| 568 | Ga0070685_10000802 | |||
| 569 | Ga0070706_100122862 | |||
| 570 | Ga0070698_100009683 | |||
| 571 | Ga0070699_100082973 | |||
| 572 | Ga0070684_100202294 | |||
| 573 | Ga0068853_100047862 | |||
| 574 | Ga0068853_100052526 | |||
| 575 | Ga0068853_100078099 | |||
| 576 | Ga0068853_100167513 | |||
| 577 | Ga0068853_100216584 | |||
| 578 | Ga0070672_100000486 | |||
| 579 | Ga0070696_100012467 | |||
| 580 | Ga0070693_100000542 | |||
| 581 | Ga0070693_100014592 | |||
| 582 | Ga0070693_100111814 | |||
| 583 | Ga0070665_100000316 | |||
| 584 | Ga0070665_100154170 | |||
| 585 | Ga0070704_100014195 | |||
| 586 | Ga0068857_100084412 | |||
| 587 | Ga0068852_100027375 | |||
| 588 | Ga0068852_100050448 | |||
| 589 | Ga0068861_100009118 | |||
| 590 | Ga0068861_100073875 | |||
| 591 | Ga0068863_100033854 | |||
| 592 | Ga0070717_10000147 | |||
| 593 | Ga0070716_100003577 | |||
| 594 | Ga0075367_10053133 | |||
| 595 | Ga0068871_100032660 | |||
| 596 | Ga0075430_100153331 | |||
| 597 | Ga0075431_100067018 | |||
| 598 | Ga0075431_100180344 | |||
| 599 | Ga0075433_10032847 | |||
| 600 | Ga0068865_100037509 | |||
| 601 | Ga0105240_10015624 | |||
| 602 | Ga0105240_10024760 | |||
| 603 | Ga0111539_10033119 | |||
| 604 | Ga0111539_10111172 | |||
| 605 | Ga0105245_10000021 | |||
| 606 | Ga0105245_10000284 | |||
| 607 | Ga0114129_10000133 | |||
| 608 | Ga0114129_10343454 | |||
| 609 | Ga0105243_10000388 | |||
| 610 | Ga0105243_10031401 | |||
| 611 | Ga0105248_10003094 | |||
| 612 | Ga0105248_10136625 | |||
| 613 | Ga0105238_10152415 | |||
| 614 | Ga0105239_10000480 | |||
| 615 | Ga0105239_10106837 | |||
| 616 | Ga0157373_10012609 | |||
| 617 | Ga0157371_10000011 | |||
| 618 | Ga0157370_10168223 | |||
| 619 | Ga0157370_10219529 | |||
| 620 | Ga0157378_10000054 | |||
| 621 | Ga0157372_10126008 | |||
| 622 | Ga0157375_10006843 | |||
| 623 | Ga0183365_10003 | |||
| 624 | Ga0183369_1004 | |||
| 625 | Ga0163161_10027610 | |||
| 626 | Ga0163161_10059771 | |||
| 627 | Ga0213876_10006790 | |||
| 628 | Ga0213876_10026660 | |||
| 629 | Ga0209784_100143 | |||
| 630 | Ga0209566_102612 | |||
| 631 | Ga0209674_100522 | |||
| 632 | Ga0209672_100004 | |||
| 633 | Ga0209563_100097 | |||
| 634 | Ga0209563_100125 | |||
| 635 | Ga0207427_100059 | |||
| 636 | Ga0207427_100119 | |||
| 637 | Ga0207427_100141 | |||
| 638 | Ga0207427_100583 | |||
| 639 | Ga0209437_100005 | |||
| 640 | Ga0209437_100123 | |||
| 641 | Ga0209437_100253 | |||
| 642 | Ga0209437_100794 | |||
| 643 | Ga0209258_100003 | |||
| 644 | Ga0209258_100281 | |||
| 645 | Ga0207425_1000866 | |||
| 646 | Ga0209646_1000461 | |||
| 647 | Ga0209026_1000113 | |||
| 648 | Ga0209026_1000174 | |||
| 649 | Ga0209026_1001885 | |||
| 650 | Ga0209148_1000008 | |||
| 651 | Ga0209148_1000016 | |||
| 652 | Ga0209148_1000121 | |||
| 653 | Ga0209148_1000252 | |||
| 654 | Ga0209759_1000216 | |||
| 655 | Ga0209759_1001274 | |||
| 656 | Ga0209759_1016533 | |||
| 657 | Ga0209233_1000011 | |||
| 658 | Ga0209233_1000046 | |||
| 659 | Ga0209233_1000136 | |||
| 660 | Ga0209455_1000002 | |||
| 661 | Ga0209455_1000004 | |||
| 662 | Ga0209455_1000120 | |||
| 663 | Ga0209455_1014781 | |||
| 664 | Ga0209130_1007023 | |||
| 665 | Ga0209675_1004927 | |||
| 666 | Ga0209676_1000886 | |||
| 667 | Ga0209676_1004714 | |||
| 668 | Ga0209676_1006378 | |||
| 669 | Ga0209025_1000005 | |||
| 670 | Ga0209025_1002525 | |||
| 671 | Ga0209025_1009121 | |||
| 672 | Ga0209564_1014739 | |||
| 673 | Ga0209758_1000017 | |||
| 674 | Ga0209758_1020532 | |||
| 675 | Ga0209050_1002042 | |||
| 676 | Ga0209256_1003671 | |||
| 677 | Ga0209256_1003714 | |||
| 678 | Ga0209051_1003562 | |||
| 679 | Ga0209257_1000693 | |||
| 680 | Ga0209257_1001098 | |||
| 681 | Ga0209257_1003368 | |||
| 682 | Ga0207656_10000979 | |||
| 683 | Ga0207682_10001163 | |||
| 684 | Ga0207682_10079923 | |||
| 685 | Ga0207692_10014345 | |||
| 686 | Ga0207680_10034922 | |||
| 687 | Ga0207647_10004114 | |||
| 688 | Ga0207647_10026223 | |||
| 689 | Ga0207645_10000982 | |||
| 690 | Ga0207705_10000335 | |||
| 691 | Ga0207705_10007245 | |||
| 692 | Ga0207707_10003532 | |||
| 693 | Ga0207707_10051419 | |||
| 694 | Ga0207707_10094968 | |||
| 695 | Ga0207695_10003927 | |||
| 696 | Ga0207695_10024612 | |||
| 697 | Ga0207671_10015746 | |||
| 698 | Ga0207660_10062062 | |||
| 699 | Ga0207657_10010295 | |||
| 700 | Ga0207657_10035354 | |||
| 701 | Ga0207649_10002163 | |||
| 702 | Ga0207649_10015597 | |||
| 703 | Ga0207652_10086337 | |||
| 704 | Ga0207652_10112715 | |||
| 705 | Ga0207694_10003484 | |||
| 706 | Ga0207694_10024771 | |||
| 707 | Ga0207694_10038076 | |||
| 708 | Ga0207659_10000029 | |||
| 709 | Ga0207659_10012753 | |||
| 710 | Ga0207687_10000002 | |||
| 711 | Ga0207687_10000927 | |||
| 712 | Ga0207700_10002420 | |||
| 713 | Ga0207700_10004250 | |||
| 714 | Ga0207664_10000777 | |||
| 715 | Ga0207664_10010604 | |||
| 716 | Ga0207690_10001859 | |||
| 717 | Ga0207690_10026464 | |||
| 718 | Ga0207690_10032263 | |||
| 719 | Ga0207690_10049581 | |||
| 720 | Ga0207706_10004573 | |||
| 721 | Ga0207709_10000116 | |||
| 722 | Ga0207709_10023288 | |||
| 723 | Ga0207670_10179325 | |||
| 724 | Ga0207669_10000022 | |||
| 725 | Ga0207669_10043852 | |||
| 726 | Ga0207665_10023735 | |||
| 727 | Ga0207691_10000040 | |||
| 728 | Ga0207691_10100282 | |||
| 729 | Ga0207691_10103059 | |||
| 730 | Ga0207661_10038415 | |||
| 731 | Ga0207679_10053242 | |||
| 732 | Ga0207667_10000001 | |||
| 733 | Ga0207667_10004720 | |||
| 734 | Ga0207667_10009264 | |||
| 735 | Ga0207667_10024284 | |||
| 736 | Ga0207668_10004479 | |||
| 737 | Ga0207668_10109439 | |||
| 738 | Ga0207677_10005792 | |||
| 739 | Ga0207639_10000696 | |||
| 740 | Ga0207639_10229238 | |||
| 741 | Ga0207678_10002184 | |||
| 742 | Ga0207678_10006003 | |||
| 743 | Ga0207708_10000137 | |||
| 744 | Ga0207702_10004312 | |||
| 745 | Ga0207641_10054503 | |||
| 746 | Ga0207648_10003734 | |||
| 747 | Ga0207674_10018531 | |||
| 748 | Ga0207674_10029891 | |||
| 749 | Ga0207674_10057706 | |||
| 750 | Ga0207674_10208619 | |||
| 751 | Ga0207675_100008676 | |||
| 752 | Ga0207675_100102808 | |||
| 753 | Ga0207683_10000059 | |||
| 754 | Ga0207683_10000891 | |||
| 755 | Ga0207698_10109848 | |||
| 756 | Ga0268266_10000002 | |||
| 757 | Ga0268266_10121942 | |||
| 758 | Ga0307517_10014622 | |||
| 759 | Ga0307517_10016865 | |||
| 760 | Ga0307511_10000992 | |||
| 761 | Ga0316177_1148466 | |||
| 762 | Ga0314311_1128705 | |||
| 763 | Ga0307513_10001996 | |||
| 764 | Ga0307509_10012290 | |||
| 765 | Ga0307509_10055265 | |||
| 766 | Ga0307408_100017259 | |||
| 767 | Ga0307408_100123846 | |||
| 768 | Ga0307508_10131773 | |||
| 769 | Ga0307405_10047341 | |||
| 770 | Ga0307410_10027328 | |||
| 771 | Ga0307410_10091212 | |||
| 772 | Ga0307407_10000106 | |||
| 773 | Ga0307412_10018205 | |||
| 774 | Ga0307409_100002488 | |||
| 775 | Ga0307416_100001242 | |||
| 776 | Ga0307411_10011112 | |||
| 777 | Ga0307415_100063485 | |||
| 778 | Ga0373959_0000311 | |||
| 779 | Ga0373924_0070978 | |||
| 780 | Ga0373935_0123070 | |||
| 781 | Ga0373933_0074891 | |||
| 782 | Ga0373937_0084862 | |||
| 783 | Ga0395905_0211762 | |||
| 784 | Ga0395901_0001119 | |||
| 785 | Ga0395901_0390980 | |||
| 786 | Ga0436365_0023370 | |||
| 787 | Ga0436365_0959136 | |||
| 788 | Ga0436365_1486542 | |||
| 789 | Ga0436365_1572769 | |||
| 790 | Ga0439436_0001177 | |||
| 791 | Ga0439439_0002085 | |||
| 792 | Ga0439447_001957 | |||
| 793 | Ga0439445_0009957 | |||
| 794 | Ga0439432_008578 | |||
| 795 | Ga0439432_010403 | |||
| 796 | Ga0439449_0010431 | |||
| 797 | Ga0451577_0038971 | |||
| 798 | Ga0466969_0000887 | |||
| 799 | Ga0466969_0026300 | |||
| 800 | Ga0466982_0000001 | |||
| 801 | Ga0466966_0000166 | |||
| 802 | Ga0466966_0036599 | |||
| 803 | Ga0466961_0036431 | |||
| 804 | Ga0466963_0230059 | |||
| 805 | Ga0466964_0004399 | |||
| 806 | Ga0453684_0011827 | |||
| 807 | Ga0453684_0043550 | |||
| 808 | Ga0453684_0106731 | |||
| 809 | Ga0466971_0001003 | |||
| 810 | Ga0466971_0002336 | |||
| 811 | Ga0466968_0002139 | |||
| 812 | Ga0466970_0012345 | |||
| 813 | Ga0466970_0031646 | |||
| 814 | Ga0466957_0024833 | |||
| 815 | Ga0466960_0010717 | |||
| 816 | Ga0466960_0108949 | |||
| 817 | Ga0466959_0000146 | |||
| 818 | Ga0466959_0028609 | |||
| 819 | Ga0466959_0101468 | |||
| 820 | Ga0451576_0144579 | |||
| 821 | Ga0466958_0011101 | |||
| 822 | Ga0466958_0031495 | |||
| 823 | Ga0466958_0035508 | |||
| 824 | Ga0495638_0000127 | |||
| 825 | Ga0495638_0180626 | |||
| 826 | Ga0495651_0043628 | |||
| 827 | Ga0495653_0151173 | |||
| 828 | Ga0495650_0000983 | |||
| 829 | Ga0495650_0047179 | |||
| 830 | Ga0495585_0027562 | |||
| 831 | Ga0495596_0008418 | |||
| 832 | Ga0495583_0003318 | |||
| 833 | Ga0495606_0000178 | |||
| 834 | Ga0495608_0003542 | |||
| 835 | Ga0495628_0124455 | |||
| 836 | Ga0495631_0011207 | |||
| 837 | Ga0495637_0009976 | |||
| 838 | Ga0495643_0015521 | |||
| 839 | Ga0495643_0086400 | |||
| 840 | Ga0495663_0004311 | |||
| 841 | Ga0495663_0014824 | |||
| 842 | Ga0495642_0006327 | |||
| 843 | Ga0495652_0061714 | |||
| 844 | Ga0495587_0038338 | |||
| 845 | Ga0495621_0012386 | |||
| 846 | Ga0495645_0022120 | |||
| 847 | Ga0495622_0003838 | |||
| 848 | Ga0495633_0000308 | |||
| 849 | Ga0495667_0021324 | |||
| 850 | Ga0495656_0094088 | |||
| 851 | Ga0495668_0000013 | |||
| 852 | Ga0495625_0000645 | |||
| 853 | Ga0495625_0023184 | |||
| 854 | Ga0495625_0084490 | |||
| 855 | Ga0495625_0134139 | |||
| 856 | Ga0495625_0143651 | |||
| 857 | Ga0495661_0059774 | |||
| 858 | Ga0495599_0026188 | |||
| 859 | Ga0495623_0011595 | |||
| 860 | Ga0495669_0000340 | |||
| 861 | Ga0495670_0015049 | |||
| 862 | Ga0495649_0014015 | |||
| 863 | Ga0495600_0095021 | |||
| 864 | Ga0495672_0115791 | |||
| 865 | Ga0495687_000250 | |||
| 866 | Ga0495687_001110 | |||
| 867 | Ga0495677_0002204 | |||
| 868 | Ga0495681_0002442 | |||
| 869 | Ga0495686_0000905 | |||
| 870 | Ga0496100_0061160 | |||
| 871 | Ga0496101_0239619 | |||
| 872 | Ga0496102_0000022 | |||
| 873 | Ga0496102_0053710 | |||
| 874 | Ga0496103_0000167 | |||
| 875 | Ga0496104_0000885 | |||
| 876 | Ga0496105_0000668 | |||
| 877 | Ga0496106_0010117 | |||
| 878 | Ga0496110_0004550 | |||
| 879 | Ga0496111_0000547 | |||
| 880 | Ga0496113_0114596 | |||
| 881 | Ga0496115_0000029 | |||
| 882 | Ga0496115_0000971 | |||
| 883 | Ga0496115_0009785 | |||
| 884 | Ga0496116_0003580 | |||
| 885 | Ga0496116_0057169 | |||
| 886 | Ga0496117_0000260 | |||
| 887 | Ga0496117_0044683 | |||
| 888 | Ga0496118_0000039 | |||
| 889 | Ga0496118_0004947 | |||
| 890 | Ga0496118_0008347 | |||
| 891 | Ga0496119_0000291 | |||
| 892 | Ga0496119_0004099 | |||
| 893 | Ga0496120_0000397 | |||
| 894 | Ga0496120_0002636 | |||
| 895 | Ga0496121_0000531 | |||
| 896 | Ga0496121_0000683 | |||
| 897 | Ga0496124_0000076 | |||
| 898 | Ga0496125_0001403 | |||
| 899 | Ga0496126_0000469 | |||
| 900 | Ga0496126_0002422 | |||
| 901 | Ga0496126_0011359 | |||
| 902 | Ga0496126_0224405 | |||
| 903 | Ga0495682_0004746 | |||
| 904 | Ga0501034_0000427 | |||
| 905 | Ga0501034_0117822 | |||
| 906 | Ga0501038_0061695 | |||
| 907 | Ga0501040_0090886 | |||
| 908 | Ga0501047_0108441 | |||
| 909 | Ga0501070_0035071 | |||
| 910 | Ga0501071_0317885 | |||
| 911 | Ga0501077_0075685 | |||
| 912 | Ga0501238_007818 | |||
| 913 | Ga0501083_0001902 | |||
| 914 | Ga0501035_0041290 | |||
| 915 | Ga0501044_0044936 | |||
| 916 | Ga0501044_0114192 | |||
| 917 | nmdc:mga05p37_1346_c1 | |||
| 918 | nmdc:mga05p37_55019_c1 | |||
| 919 | nmdc:mga05p37_85950_c1 | |||
| 920 | nmdc:mga09592_63952_c1 | |||
| 921 | nmdc:mga09592_92632_c1 | |||
| 922 | nmdc:mga0qj67_19802_c1 | |||
| 923 | nmdc:mga06r32_6684_c1 | |||
| 924 | nmdc:mga0n895_392355_c1 | |||
| 925 | nmdc:mga0rr50_2432_c1 | |||
| 926 | nmdc:mga0a205_47346_c1 | |||
| 927 | nmdc:mga0a205_63286_c1 | |||
| 928 | Ga0495601_0011167 | |||
| 929 | Ga0500610_0000189 | |||
| 930 | Ga0500635_0000442 | |||
| 931 | Ga0495655_0001092 | |||
| 932 | Ga0495619_0017405 | |||
| 933 | Ga0500643_009003 | |||
| 934 | Ga0500644_0002593 | |||
| 935 | Ga0500556_0000130 | |||
| 936 | Ga0500642_0000812 | |||
| 937 | Ga0500568_0007236 | |||
| 938 | Ga0500622_0052336 | |||
| 939 | Ga0500636_0001153 | |||
| 940 | Ga0500645_000024 | |||
| 941 | Ga0500645_003260 | |||
| 942 | Ga0500596_001541 | |||
| 943 | Ga0501082_0093345 | |||
| 944 | Ga0466962_0000955 | |||
| 945 | Ga0466962_0002939 | |||
| 946 | Ga0466962_0004711 | |||
| 947 | 2523102974 | |||
| 948 | 2538835059 | |||
| 949 | 2643817622 | |||
| 950 | 2643828469 | |||
| 951 | 2643878839 | |||
| 952 | 2643940334 | |||
| 953 | 2643976581 | |||
| 954 | 2644079405 | |||
| 955 | 2644660155 | |||
| 956 | 2644694849 | |||
| 957 | 2644697456 | |||
| 958 | 2687584707 | |||
| 959 | 2739733584 | |||
| 960 | 2884416258 | |||
| 961 | 2895397858 | |||
| 962 | 2928966229 | |||
| 963 | 2939613730 | |||
| 964 | 8003014469 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gny-assembly1.cif.gz_D | the structure of wt bgl6 | 0.9843 | 5 | 444 |
| 5gnx-assembly1.cif.gz_B | the e171q mutant structure of bgl6 | 0.9841 | 1 | 443 |
| 6jfp-assembly2.cif.gz_A | crystal structure of the beta-glucosidase bgl15 | 0.9835 | 5 | 442 |
| 5gnz-assembly1.cif.gz_K | the m3 mutant structure of bgl6 | 0.9834 | 5 | 444 |
| 5gnx-assembly1.cif.gz_B | the e171q mutant structure of bgl6 | 0.9798 | 1 | 443 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5gnzI00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9847 | 5 | 444 | 3.20.20.80 |
| 5aybA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9737 | 5 | 438 | 3.20.20.80 |
| 5gnzI00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9737 | 5 | 444 | 3.20.20.80 |
| 3ta9B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9655 | 5 | 438 | 3.20.20.80 |
| 3w53A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9612 | 4 | 439 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G4A2U6-F1-model_v4 | deleted | 0.9924 | 148 | 443 |
|
| AF-A0A838NKA3-F1-model_v4 | Family 1 glycosylhydrolase | 0.9908 | 348 | 444 |
GO:0005829
GO:0008422 GO:0016052 |
| AF-A0A536TSA0-F1-model_v4 | beta-glucosidase (EC 3.2.1.21) | 0.9887 | 40 | 443 |
GO:0004565
GO:0005829 GO:0008422 GO:0030245 |
| AF-A0A5S9MAI4-F1-model_v4 | Uncharacterized protein | 0.9827 | 68 | 209 |
GO:0005829
GO:0008422 GO:0016052 |
| AF-A0A2G5CFA3-F1-model_v4 | Beta-glucosidase | 0.9819 | 51 | 165 |
GO:0005975
GO:0008422 |