F452707

General Info

Members Datasets Scaffolds Average Seq Length
483 236 966 411

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10000270|Ga0065704_1000027048
Length 433
Sequence MAGLPTKSNVPAAGSSHAMQQLYRLFESRGGEQSPHAHAHWQQVLRLGFPHAKLEDWKYTPVSSLLGNQFFAPQQQALTVEKIKSLALPLECYRLVFVDGRFDASLSDSDTGAFEIEKLSPSAQQTLPDPIQSEVFLHLTESLAQDSFSVRLPVGKHAEKPLYLLHLSSGRDQSREMNTVHHRYHLAIENGANAEVIEHYLSLNDQGHFTGARMTINVGDNAXXXHYKLAFESHASFHFSHNDLVIGRDARVSSHSFLLGAGLTRNNTSAQLNGENSNLDINSLVLPVDSEIADTRTYLEHNKGYCNSKQLHKVIVNDRAKAIFNGMIKVAQHALKTDGKXTNNNLLLGKHTEVDTKPQLEIYADDVKCSHGATVGRIDDEQLFYLRTRGISGQDAQQMIIFAFAAELTEAIKNETLREVVIARIAGRLNRGK

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
29 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
30 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
31 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
32 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
33 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
50 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
55 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
56 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
57 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
58 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
59 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
60 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
61 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
62 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
65 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
66 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
67 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
70 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
71 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
72 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
73 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
74 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
75 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
76 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
77 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
78 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
79 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
80 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
81 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
82 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
83 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
84 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
85 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
91 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
92 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
95 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
96 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
97 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
98 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
102 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
103 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
104 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
105 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
106 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
107 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
108 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
109 2547132181 Kosakonia sacchari SP1 Isolate Stem
110 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
111 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
112 2561511199 Enterobacter sp. R4-368 Isolate Nodule
113 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
114 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
115 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
116 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
117 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
118 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
119 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
120 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
121 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
122 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
123 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
124 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
125 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
126 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
127 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
128 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
129 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
130 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
131 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
132 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
133 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
134 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
135 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
136 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
137 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
138 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
139 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
140 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
141 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
142 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
143 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
144 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
145 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
146 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
147 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
148 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
149 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
150 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
151 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
152 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
153 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
154 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
155 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
156 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
157 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
158 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
159 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
160 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
161 2636415599 Klebsiella variicola DX120E Isolate Unclassified
162 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
163 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
164 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
165 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
166 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
167 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
168 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
169 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
170 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
171 2751185917 Enterobacter sp. HK169 Isolate Unclassified
172 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
173 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
174 2775507074 Klebsiella sp. D5A Isolate Unclassified
175 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
176 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
177 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
178 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
179 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
180 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
181 2821118458 Enterobacter asburiae 609 Isolate Unclassified
182 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
183 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
184 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
185 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
186 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
187 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
188 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
189 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
190 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
191 2865014394 Pantoea sp. R-71966 Isolate Unclassified
192 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
193 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
194 2876601092 Pantoea endophytica 596 Isolate Unclassified
195 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
196 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
197 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
198 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
199 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
200 2904504865 Serratia marcescens 1822 Isolate Unclassified
201 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
202 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
203 2919150387 Rahnella aceris 1817 Isolate Unclassified
204 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
205 2927143783 Rahnella sp. 2050 Isolate Unclassified
206 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
207 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
208 2937539931 Pantoea sp. LS15 Isolate Unclassified
209 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
210 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
211 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
212 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
213 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
214 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
215 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
216 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
217 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
218 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
219 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
220 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
221 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
222 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
223 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
224 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
225 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
226 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
227 8018221730 Enterobacter sp. CM29 Isolate Unclassified
228 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
229 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
230 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
231 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
232 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
233 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
234 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
235 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
236 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.88
Metatranscriptomes 0
Isolates 27.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.83
Bulb 0
Endosphere 5.18
Nodule 4.14
Rhizoplane 13.04
Rhizosphere 45.55
Stem 0.21
Stem Tuber 1.24
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10000270 3300005289 Bacteria 61602
2 SwRhRL2b_contig_1797070 2162886007 Bacteria 2622
3 SwRhRL2b_contig_182090 2162886007 Bacteria 9021
4 JGI25162J39368_1000112 3300002737 Bacteria 89231
5 JGI25163J39215_1000031 3300002771 Bacteria 65095
6 JGI25163J39215_1000055 3300002771 Bacteria 51174
7 JGI25164J39214_1000094 3300002772 Bacteria 89231
8 JGI25152J39213_1000343 3300002773 Bacteria 29576
9 rootH2_10031518 3300003320 Bacteria 30101
10 Ga0055538_1000076 3300003751 Bacteria 89231
11 Ga0055539_1000115 3300003752 Bacteria 89231
12 Ga0055533_1000121 3300003756 Bacteria 89231
13 Ga0055525_1000159 3300003759 Bacteria 89231
14 Ga0055541_1000077 3300003841 Bacteria 89231
15 Ga0058692_1000232 3300003856 Bacteria 32057
16 Ga0058692_1001974 3300003856 Bacteria 7144
17 Ga0058692_1002212 3300003856 Bacteria 6631
18 Ga0058692_1002227 3300003856 Bacteria 6592
19 Ga0058692_1002355 3300003856 Bacteria 6362
20 Ga0058692_1003743 3300003856 Bacteria 4641
21 Ga0058692_1006223 3300003856 Bacteria 3302
22 Ga0058692_1009242 3300003856 Bacteria 2497
23 Ga0058692_1011852 3300003856 Bacteria 2090
24 Ga0058692_1019985 3300003856 Bacteria 1416
25 Ga0065704_10001131 3300005289 Bacteria 9351
26 Ga0065704_10001222 3300005289 Bacteria 11254
27 Ga0065704_10106493 3300005289 Bacteria 2075
28 Ga0070668_100025488 3300005347 Bacteria 4483
29 Ga0070659_100037129 3300005366 Bacteria 3798
30 Ga0070665_100000595 3300005548 Bacteria 50263
31 Ga0070665_100070887 3300005548 Bacteria 3492
32 Ga0079104_1000535 3300006946 Bacteria 40052
33 Ga0079104_1000611 3300006946 Bacteria 35208
34 Ga0079104_1000775 3300006946 Bacteria 27286
35 Ga0079104_1001480 3300006946 Bacteria 15648
36 Ga0079104_1002634 3300006946 Bacteria 9364
37 Ga0079104_1005813 3300006946 Bacteria 4828
38 Ga0079104_1006112 3300006946 Bacteria 4647
39 Ga0079104_1006832 3300006946 Bacteria 4229
40 Ga0079104_1013219 3300006946 Bacteria 2555
41 Ga0105251_10000752 3300009011 Bacteria 29611
42 Ga0105251_10001038 3300009011 Bacteria 24371
43 Ga0105251_10008328 3300009011 Bacteria 6259
44 Ga0105251_10045863 3300009011 Bacteria 2106
45 Ga0105244_10000222 3300009036 Bacteria 58959
46 Ga0105244_10000330 3300009036 Bacteria 44986
47 Ga0105244_10000354 3300009036 Bacteria 42971
48 Ga0105244_10000586 3300009036 Bacteria 32689
49 Ga0105244_10000865 3300009036 Bacteria 25591
50 Ga0105244_10001499 3300009036 Bacteria 18722
51 Ga0105244_10010356 3300009036 Bacteria 5657
52 Ga0105244_10018889 3300009036 Bacteria 3860
53 Ga0105244_10020096 3300009036 Bacteria 3713
54 Ga0105244_10052901 3300009036 Bacteria 2066
55 Ga0105244_10097982 3300009036 Bacteria 1436
56 Ga0105250_10000001 3300009092 Bacteria 617357
57 Ga0105250_10000195 3300009092 Bacteria 51515
58 Ga0105250_10000253 3300009092 Bacteria 44276
59 Ga0105250_10000448 3300009092 Bacteria 29733
60 Ga0105250_10003065 3300009092 Bacteria 8061
61 Ga0105250_10007391 3300009092 Bacteria 4724
62 Ga0105250_10020296 3300009092 Bacteria 2687
63 Ga0105250_10068485 3300009092 Bacteria 1433
64 Ga0105246_10237582 3300011119 Bacteria 1439
65 Ga0157373_10000500 3300013100 Bacteria 30895
66 Ga0157371_10000099 3300013102 Bacteria 133829
67 Ga0157371_10001578 3300013102 Bacteria 23400
68 Ga0157371_10002572 3300013102 Bacteria 17215
69 Ga0157371_10016739 3300013102 Bacteria 5462
70 Ga0157371_10026882 3300013102 Bacteria 4178
71 Ga0157370_10000234 3300013104 Bacteria 70723
72 Ga0157370_10006551 3300013104 Bacteria 12824
73 Ga0157370_10015259 3300013104 Bacteria 7818
74 Ga0157369_10030301 3300013105 Bacteria 5967
75 Ga0157369_10032764 3300013105 Bacteria 5711
76 Ga0163162_10035335 3300013306 Bacteria 4977
77 Ga0163162_10061435 3300013306 Bacteria 3795
78 Ga0163162_10228190 3300013306 Bacteria 1992
79 Ga0157372_10007775 3300013307 Bacteria 11386
80 Ga0157372_10014588 3300013307 Bacteria 8406
81 Ga0157372_10023900 3300013307 Bacteria 6631
82 Ga0157372_10150426 3300013307 Bacteria 2686
83 Ga0157372_10490694 3300013307 Bacteria 1432
84 Ga0157372_10490806 3300013307 Bacteria 1432
85 Ga0182006_1000047 3300015261 Bacteria 187006
86 Ga0182006_1008119 3300015261 Bacteria 4764
87 Ga0182007_10004870 3300015262 Bacteria 5999
88 Ga0183366_1001 3300015679 Bacteria 2743932
89 Ga0183370_1001 3300015680 Bacteria 2743932
90 Ga0183369_1001 3300015685 Bacteria 2743932
91 Ga0183368_1001 3300015687 Bacteria 2743932
92 Ga0213876_10000055 3300021384 Bacteria 136037
93 Ga0209760_100104 3300025207 Bacteria 65129
94 Ga0209784_100001 3300025224 Bacteria 3600592
95 Ga0209566_100001 3300025225 Bacteria 3600765
96 Ga0209674_100002 3300025226 Bacteria 3600592
97 Ga0209563_100008 3300025230 Bacteria 1554545
98 Ga0207427_100135 3300025231 Bacteria 89851
99 Ga0209437_100007 3300025233 Bacteria 938377
100 Ga0209437_100109 3300025233 Bacteria 217031
101 Ga0209437_100111 3300025233 Bacteria 214944
102 Ga0209677_100004 3300025253 Bacteria 1554545
103 Ga0209129_1000004 3300025258 Bacteria 884499
104 Ga0209233_1002092 3300025261 Bacteria 7534
105 Ga0207696_1000028 3300025711 Bacteria 400424
106 Ga0207696_1000086 3300025711 Bacteria 194626
107 Ga0207696_1000116 3300025711 Bacteria 148125
108 Ga0207696_1000174 3300025711 Bacteria 102229
109 Ga0207696_1000235 3300025711 Bacteria 77526
110 Ga0207696_1000439 3300025711 Bacteria 37274
111 Ga0207696_1001155 3300025711 Bacteria 15182
112 Ga0207696_1018715 3300025711 Bacteria 2269
113 Ga0207655_1000001 3300025728 Bacteria 1866413
114 Ga0207655_1000004 3300025728 Bacteria 1021221
115 Ga0207655_1000009 3300025728 Bacteria 664676
116 Ga0207655_1000089 3300025728 Bacteria 204720
117 Ga0207655_1000426 3300025728 Bacteria 56714
118 Ga0207655_1000647 3300025728 Bacteria 41615
119 Ga0207655_1000741 3300025728 Bacteria 36714
120 Ga0207655_1003187 3300025728 Bacteria 12363
121 Ga0207655_1005530 3300025728 Bacteria 8571
122 Ga0207655_1021636 3300025728 Bacteria 3256
123 Ga0207655_1031705 3300025728 Bacteria 2430
124 Ga0207713_1000001 3300025735 Bacteria 2295391
125 Ga0207713_1000002 3300025735 Bacteria 1061749
126 Ga0207713_1000003 3300025735 Bacteria 860698
127 Ga0207713_1000012 3300025735 Bacteria 501860
128 Ga0207713_1010034 3300025735 Bacteria 5280
129 Ga0207713_1025865 3300025735 Bacteria 2701
130 Ga0207668_10005192 3300025972 Bacteria 7662
131 Ga0209281_1000001 3300027111 Bacteria 1933496
132 Ga0209281_1000130 3300027111 Bacteria 191756
133 Ga0209281_1000394 3300027111 Bacteria 68048
134 Ga0209281_1000428 3300027111 Bacteria 62540
135 Ga0209281_1000598 3300027111 Bacteria 41043
136 Ga0209281_1000713 3300027111 Bacteria 33360
137 Ga0209281_1001045 3300027111 Bacteria 20990
138 Ga0209281_1001234 3300027111 Bacteria 16952
139 Ga0209281_1002684 3300027111 Bacteria 6726
140 Ga0209281_1002778 3300027111 Bacteria 6484
141 Ga0209371_1000001 3300027312 Bacteria 2771503
142 Ga0209371_1000002 3300027312 Bacteria 1551985
143 Ga0209371_1000041 3300027312 Bacteria 340377
144 Ga0209371_1000122 3300027312 Bacteria 132545
145 Ga0209371_1000188 3300027312 Bacteria 90102
146 Ga0209371_1000492 3300027312 Bacteria 38527
147 Ga0209371_1000862 3300027312 Bacteria 24564
148 Ga0209371_1001378 3300027312 Bacteria 16753
149 Ga0209371_1001914 3300027312 Bacteria 12710
150 Ga0209371_1002701 3300027312 Bacteria 9581
151 Ga0209371_1003845 3300027312 Bacteria 6961
152 Ga0209371_1004166 3300027312 Bacteria 6457
153 Ga0209371_1006169 3300027312 Bacteria 4523
154 Ga0209371_1017870 3300027312 Bacteria 1821
155 Ga0268266_10001643 3300028379 Bacteria 25908
156 Ga0268266_10108169 3300028379 Bacteria 2460
157 Ga0268256_1000001 3300030500 Bacteria 2771065
158 Ga0268256_1000002 3300030500 Bacteria 1535763
159 Ga0268256_1000003 3300030500 Bacteria 1289401
160 Ga0268256_1000048 3300030500 Bacteria 312298
161 Ga0268256_1000051 3300030500 Bacteria 283626
162 Ga0268256_1000718 3300030500 Bacteria 24564
163 Ga0268256_1000844 3300030500 Bacteria 21767
164 Ga0268256_1001182 3300030500 Bacteria 16753
165 Ga0268256_1001381 3300030500 Bacteria 14764
166 Ga0268256_1003561 3300030500 Bacteria 6961
167 Ga0268256_1003795 3300030500 Bacteria 6609
168 Ga0268256_1003845 3300030500 Bacteria 6547
169 Ga0268256_1004889 3300030500 Bacteria 5409
170 Ga0436365_0971002 3300039437 Bacteria 167792
171 Ga0439438_000001 3300041405 Bacteria 1263568
172 Ga0439438_000780 3300041405 Bacteria 14167
173 Ga0439438_003644 3300041405 Bacteria 6161
174 Ga0439447_001075 3300041407 Bacteria 9908
175 Ga0439466_0000047 3300041411 Bacteria 48861
176 Ga0451853_3455637 3300041512 Bacteria 3223
177 Ga0439432_014950 3300042006 Bacteria 2623
178 Ga0439452_000001 3300042010 Bacteria 1725439
179 Ga0439452_000002 3300042010 Bacteria 1377577
180 Ga0439452_000008 3300042010 Bacteria 569877
181 Ga0439452_000142 3300042010 Bacteria 54077
182 Ga0439452_000298 3300042010 Bacteria 31875
183 Ga0439452_004971 3300042010 Bacteria 4353
184 Ga0450907_000190 3300042146 Bacteria 22431
185 Ga0466981_0000002 3300044669 Bacteria 313036
186 Ga0495591_000013 3300046458 Bacteria 268106
187 Ga0495591_000100 3300046458 Bacteria 99473
188 Ga0495591_008046 3300046458 Bacteria 4374
189 Ga0495638_0013681 3300046460 Bacteria 5513
190 Ga0495650_0000005 3300046471 Bacteria 766553
191 Ga0495650_0000090 3300046471 Bacteria 232897
192 Ga0495650_0000187 3300046471 Bacteria 136554
193 Ga0495650_0063478 3300046471 Bacteria 1472
194 Ga0495605_0082080 3300046474 Bacteria 1506
195 Ga0495585_0011587 3300046492 Bacteria 5213
196 Ga0495607_0017775 3300046501 Bacteria 4553
197 Ga0495606_0003762 3300046507 Bacteria 15779
198 Ga0495620_0008470 3300046515 Bacteria 5518
199 Ga0495637_0052144 3300046520 Bacteria 1709
200 Ga0495643_0034513 3300046522 Bacteria 2791
201 Ga0495643_0036865 3300046522 Bacteria 2684
202 Ga0495644_0000573 3300046523 Bacteria 15420
203 Ga0495648_0002343 3300046524 Bacteria 17587
204 Ga0495648_0009258 3300046524 Bacteria 7655
205 Ga0495654_0000041 3300046530 Bacteria 174733
206 Ga0495654_0000173 3300046530 Bacteria 63665
207 Ga0495654_0024026 3300046530 Bacteria 3152
208 Ga0495597_0001631 3300046542 Bacteria 15710
209 Ga0495668_0014499 3300046616 Bacteria 4620
210 Ga0495625_0016408 3300046660 Bacteria 5831
211 Ga0495588_0003244 3300046674 Bacteria 7055
212 Ga0495649_0001886 3300046694 Bacteria 15339
213 Ga0495649_0009622 3300046694 Bacteria 5729
214 Ga0495589_0005519 3300046794 Bacteria 6671
215 Ga0495660_0000028 3300046810 Bacteria 244534
216 Ga0495660_0000171 3300046810 Bacteria 70062
217 Ga0495660_0068039 3300046810 Bacteria 1895
218 Ga0495672_0000002 3300047320 Bacteria 740116
219 Ga0495672_0000020 3300047320 Bacteria 432845
220 Ga0495672_0000043 3300047320 Bacteria 266893
221 Ga0495679_000282 3300047446 Bacteria 42194
222 Ga0495679_016084 3300047446 Bacteria 2715
223 Ga0495679_032398 3300047446 Bacteria 1676
224 Ga0495679_034771 3300047446 Bacteria 1601
225 Ga0495673_0000070 3300047469 Bacteria 217453
226 Ga0495673_0000167 3300047469 Bacteria 111793
227 Ga0495681_0021707 3300047470 Bacteria 3452
228 Ga0496100_0004919 3300048903 Bacteria 7138
229 Ga0496100_0024451 3300048903 Bacteria 3685
230 Ga0496102_0049801 3300048905 Bacteria 3812
231 Ga0496104_0000555 3300048907 Bacteria 31796
232 Ga0496104_0048174 3300048907 Bacteria 4018
233 Ga0496105_0031796 3300048908 Bacteria 4328
234 Ga0496105_0091261 3300048908 Bacteria 2515
235 Ga0496105_0105271 3300048908 Bacteria 2329
236 Ga0496116_0000277 3300048919 Bacteria 89271
237 Ga0496116_0001125 3300048919 Bacteria 31904
238 Ga0496116_0008548 3300048919 Bacteria 8868
239 Ga0496116_0012630 3300048919 Bacteria 6879
240 Ga0496116_0015585 3300048919 Bacteria 6002
241 Ga0496116_0026100 3300048919 Bacteria 4279
242 Ga0496116_0049891 3300048919 Bacteria 2793
243 Ga0496116_0054111 3300048919 Bacteria 2646
244 Ga0496116_0067674 3300048919 Bacteria 2280
245 Ga0496117_0000004 3300048920 Bacteria 877131
246 Ga0496117_0000165 3300048920 Bacteria 139029
247 Ga0496117_0002525 3300048920 Bacteria 22922
248 Ga0496117_0003424 3300048920 Bacteria 18450
249 Ga0496117_0004066 3300048920 Bacteria 16424
250 Ga0496117_0020640 3300048920 Bacteria 5364
251 Ga0496117_0034148 3300048920 Bacteria 3837
252 Ga0496117_0034335 3300048920 Bacteria 3822
253 Ga0496117_0073597 3300048920 Bacteria 2278
254 Ga0496117_0099187 3300048920 Bacteria 1849
255 Ga0496118_0000007 3300048921 Bacteria 650986
256 Ga0496118_0000015 3300048921 Bacteria 551359
257 Ga0496118_0001126 3300048921 Bacteria 41304
258 Ga0496118_0002525 3300048921 Bacteria 24537
259 Ga0496118_0005269 3300048921 Bacteria 14761
260 Ga0496118_0012799 3300048921 Bacteria 8007
261 Ga0496118_0021142 3300048921 Bacteria 5738
262 Ga0496118_0026635 3300048921 Bacteria 4917
263 Ga0496118_0027827 3300048921 Bacteria 4775
264 Ga0496118_0036738 3300048921 Bacteria 3954
265 Ga0496118_0108478 3300048921 Bacteria 1850
266 Ga0496119_0000066 3300048922 Bacteria 162680
267 Ga0496119_0000095 3300048922 Bacteria 129683
268 Ga0496119_0001967 3300048922 Bacteria 23367
269 Ga0496119_0002594 3300048922 Bacteria 19628
270 Ga0496119_0012013 3300048922 Bacteria 7086
271 Ga0496119_0019406 3300048922 Bacteria 5009
272 Ga0496119_0024425 3300048922 Bacteria 4252
273 Ga0496119_0027666 3300048922 Bacteria 3890
274 Ga0496119_0037015 3300048922 Bacteria 3176
275 Ga0496119_0088247 3300048922 Bacteria 1768
276 Ga0496120_0000380 3300048923 Bacteria 71773
277 Ga0496120_0001267 3300048923 Bacteria 31661
278 Ga0496120_0001332 3300048923 Bacteria 30475
279 Ga0496120_0003408 3300048923 Bacteria 14539
280 Ga0496120_0003965 3300048923 Bacteria 12868
281 Ga0496120_0015425 3300048923 Bacteria 5041
282 Ga0496120_0025816 3300048923 Bacteria 3641
283 Ga0496120_0033071 3300048923 Bacteria 3110
284 Ga0496120_0050891 3300048923 Bacteria 2369
285 Ga0496121_0002250 3300048924 Bacteria 30081
286 Ga0496121_0003016 3300048924 Bacteria 24450
287 Ga0496121_0009694 3300048924 Bacteria 11027
288 Ga0496121_0025828 3300048924 Bacteria 5557
289 Ga0496121_0025872 3300048924 Bacteria 5552
290 Ga0496121_0035157 3300048924 Bacteria 4495
291 Ga0496121_0042151 3300048924 Bacteria 3976
292 Ga0496121_0084969 3300048924 Bacteria 2492
293 Ga0496122_0000005 3300048925 Bacteria 630659
294 Ga0496122_0000058 3300048925 Bacteria 248805
295 Ga0496122_0000738 3300048925 Bacteria 63772
296 Ga0496122_0004902 3300048925 Bacteria 16231
297 Ga0496122_0021615 3300048925 Bacteria 5751
298 Ga0496122_0025084 3300048925 Bacteria 5194
299 Ga0496122_0048348 3300048925 Bacteria 3272
300 Ga0496122_0057953 3300048925 Bacteria 2871
301 Ga0496122_0059356 3300048925 Bacteria 2824
302 Ga0496122_0074454 3300048925 Bacteria 2402
303 Ga0496122_0082194 3300048925 Bacteria 2238
304 Ga0496122_0103032 3300048925 Bacteria 1900
305 Ga0496123_0000008 3300048926 Bacteria 630628
306 Ga0496123_0000044 3300048926 Bacteria 253396
307 Ga0496123_0001322 3300048926 Bacteria 35015
308 Ga0496123_0002433 3300048926 Bacteria 23152
309 Ga0496123_0020012 3300048926 Bacteria 5253
310 Ga0496123_0022150 3300048926 Bacteria 4907
311 Ga0496123_0022151 3300048926 Bacteria 4907
312 Ga0496123_0032960 3300048926 Bacteria 3737
313 Ga0496123_0044729 3300048926 Bacteria 3024
314 Ga0496123_0111818 3300048926 Bacteria 1559
315 Ga0496124_0000105 3300048927 Bacteria 176783
316 Ga0496124_0000107 3300048927 Bacteria 168020
317 Ga0496124_0000564 3300048927 Bacteria 62677
318 Ga0496124_0001459 3300048927 Bacteria 34893
319 Ga0496124_0012635 3300048927 Bacteria 8309
320 Ga0496124_0023875 3300048927 Bacteria 5570
321 Ga0496124_0037522 3300048927 Bacteria 4213
322 Ga0496124_0039404 3300048927 Bacteria 4096
323 Ga0496124_0075693 3300048927 Bacteria 2780
324 Ga0496124_0092631 3300048927 Bacteria 2461
325 Ga0496124_0146862 3300048927 Bacteria 1854
326 Ga0496124_0148038 3300048927 Bacteria 1845
327 Ga0496124_0155607 3300048927 Bacteria 1788
328 Ga0496124_0173607 3300048927 Bacteria 1666
329 Ga0496124_0188723 3300048927 Bacteria 1579
330 Ga0496125_0000009 3300048928 Bacteria 677678
331 Ga0496125_0000103 3300048928 Bacteria 201675
332 Ga0496125_0001712 3300048928 Bacteria 30528
333 Ga0496125_0005660 3300048928 Bacteria 13790
334 Ga0496125_0007075 3300048928 Bacteria 11984
335 Ga0496125_0017105 3300048928 Bacteria 6928
336 Ga0496125_0024785 3300048928 Bacteria 5507
337 Ga0496125_0035149 3300048928 Bacteria 4402
338 Ga0496125_0040085 3300048928 Bacteria 4022
339 Ga0496125_0135826 3300048928 Bacteria 1720
340 Ga0496126_0000399 3300048929 Bacteria 89026
341 Ga0496126_0000779 3300048929 Bacteria 57561
342 Ga0496126_0002347 3300048929 Bacteria 25872
343 Ga0496126_0020256 3300048929 Bacteria 6528
344 Ga0496126_0093341 3300048929 Bacteria 2642
345 Ga0496126_0118871 3300048929 Bacteria 2294
346 Ga0496126_0274444 3300048929 Bacteria 1398
347 Ga0495678_000591 3300049459 Bacteria 34139
348 Ga0495678_014148 3300049459 Bacteria 3717
349 Ga0495682_0000001 3300049460 Bacteria 1559116
350 nmdc:mga00v17_63633_c1 3300050491 Bacteria 2272
351 nmdc:mga0k408_1666_c3 3300050493 Bacteria 3919
352 Ga0500621_000003 3300053126 Bacteria 596975
353 2511378922 2511231025 Bacteria 5324661
354 2511437155 2511231035 Bacteria 5341610
355 2538425772 2537561728 Bacteria 5149301
356 2547695173 2547132181 Bacteria 4945084
357 2548648353 2547132416 Bacteria 4633861
358 2555257427 2554235234 Bacteria 5762085
359 2562462965 2561511199 Bacteria 5155034
360 2585825448 2585427591 Bacteria 5482980
361 2585832070 2585427592 Bacteria 5370892
362 2599408928 2599185169 Bacteria 5441380
363 2599925466 2599185299 Bacteria 4854625
364 2601522555 2600255254 Bacteria 5281859
365 2601527582 2600255255 Bacteria 5282785
366 2601535281 2600255256 Bacteria 5597742
367 2601540844 2600255257 Bacteria 5597196
368 2601614413 2600255280 Bacteria 5292309
369 2601619133 2600255281 Bacteria 5288753
370 2601642247 2600255287 Bacteria 5210468
371 2601647109 2600255288 Bacteria 5282738
372 2601652560 2600255289 Bacteria 5281907
373 2601657886 2600255290 Bacteria 5282218
374 2601662070 2600255291 Bacteria 5217298
375 2601695028 2600255298 Bacteria 5215185
376 2601699700 2600255299 Bacteria 5218662
377 2601706405 2600255300 Bacteria 5287774
378 2601710711 2600255301 Bacteria 5280532
379 2601715725 2600255302 Bacteria 5288235
380 2601720051 2600255303 Bacteria 5219315
381 2601726131 2600255304 Bacteria 5283973
382 2601730672 2600255305 Bacteria 5282329
383 2601735688 2600255306 Bacteria 5281613
384 2601740956 2600255307 Bacteria 5439064
385 2601750886 2600255309 Bacteria 5431045
386 2601758463 2600255310 Bacteria 5600903
387 2601764573 2600255311 Bacteria 5598766
388 2602018140 2600255392 Bacteria 5437392
389 2603638184 2602042046 Bacteria 5483348
390 2603642692 2602042047 Bacteria 4697674
391 2603659432 2602042052 Bacteria 5215873
392 2603664707 2602042053 Bacteria 5214361
393 2603698264 2602042066 Bacteria 4423871
394 2603703282 2602042067 Bacteria 4863713
395 2603838064 2602042103 Bacteria 5284714
396 2603843142 2602042104 Bacteria 5281639
397 2603848215 2602042105 Bacteria 5282303
398 2603853290 2602042106 Bacteria 5282744
399 2603867234 2602042109 Bacteria 5152801
400 2603871341 2602042110 Bacteria 5283285
401 2603876272 2602042111 Bacteria 5212080
402 2606048534 2603880178 Bacteria 5283018
403 2606069134 2603880184 Bacteria 5217896
404 2606144956 2603880202 Bacteria 5284684
405 2606175935 2603880211 Bacteria 5284226
406 2608669281 2608642108 Bacteria 4104624
407 2609913476 2609459761 Bacteria 5513740
408 2637224799 2636415599 Bacteria 5718434
409 2650898801 2648501693 Bacteria 5069560
410 2671103219 2667528172 Bacteria 5170840
411 2671109827 2667528173 Bacteria 5375747
412 2671588314 2671180115 Bacteria 5353919
413 2676406068 2675903046 Bacteria 5451247
414 2681997634 2681812866 Bacteria 4552357
415 2682006844 2681812869 Bacteria 5014465
416 2686353185 2684622997 Bacteria 4624240
417 2712469817 2711768156 Bacteria 4471618
418 2753855712 2751185917 Bacteria 4551186
419 2765588705 2765235842 Bacteria 4799256
420 2775538712 2775506706 Bacteria 4873073
421 2777022176 2775507074 Bacteria 5532402
422 2791922471 2791354903 Bacteria 4937680
423 2792314817 2791355010 Bacteria 4864581
424 2793405752 2791355275 Bacteria 4429597
425 2809123764 2808606414 Bacteria 4917181
426 2813729160 2811995292 Bacteria 5303342
427 2814696726 2814123068 Bacteria 5687681
428 2821119518 2821118458 Bacteria 4714306
429 2823374494 2823373977 Bacteria 4779415
430 2844427264 2844425489 Bacteria 4854065
431 2844530818 2844528606 Bacteria 4733806
432 2846544408 2846540461 Bacteria 5471451
433 2847800036 2847797336 Bacteria 5176640
434 2852107780 2852103415 Bacteria 5193810
435 2854604468 2854601825 Bacteria 4797592
436 2855195970 2855195626 Bacteria 4927512
437 2858468944 2858466076 Bacteria 4722413
438 2865015107 2865014394 Bacteria 4764573
439 2871272755 2871272651 Bacteria 5042015
440 2871286325 2871282230 Bacteria 4917173
441 2876604394 2876601092 Bacteria 5114497
442 2881610076 2881609920 Bacteria 4405319
443 2884089083 2884086401 Bacteria 5005459
444 2891672934 2891670763 Bacteria 4967099
445 2900052696 2900051742 Bacteria 4985156
446 2904478176 2904474040 Bacteria 5504324
447 2904504984 2904504865 Bacteria 5152820
448 2904514313 2904513164 Bacteria 5476410
449 2919108623 2919108558 Bacteria 5897419
450 2919155306 2919150387 Bacteria 5500879
451 2923634585 2923634449 Bacteria 4753480
452 2927147984 2927143783 Bacteria 5504251
453 2927834366 2927833300 Bacteria 4923934
454 2935626899 2935625433 Bacteria 5042964
455 2937540291 2937539931 Bacteria 4639830
456 2939568909 2939568625 Bacteria 4542555
457 2939573835 2939573065 Bacteria 4926053
458 2939603465 2939602548 Bacteria 4950493
459 2939607715 2939607340 Bacteria 4719256
460 2939619358 2939617950 Bacteria 4820956
461 2939644044 2939642701 Bacteria 4475280
462 2945877465 2945874760 Bacteria 5527237
463 2969081779 2969079654 Bacteria 5439582
464 2971823191 2971820967 Bacteria 5823634
465 2974312376 2974310843 Bacteria 4947816
466 2974438235 2974435778 Bacteria 4876478
467 2978975673 2978975091 Bacteria 4704313
468 2984496470 2984494565 Bacteria 5000175
469 2984564204 2984559226 Bacteria 5683096
470 2984596939 2984595703 Bacteria 5682994
471 2990261891 2990261002 Bacteria 4919493
472 3000378723 3000376612 Bacteria 4705565
473 8016736078 8016733728 Bacteria 5274317
474 8018222312 8018221730 Bacteria 4616064
475 8018408405 8018405270 Bacteria 4978981
476 8019502823 8019499862 Bacteria 5169538
477 8019506242 8019504834 Bacteria 4819156
478 8054845641 8054844752 Bacteria 4450330
479 8054853019 8054849141 Bacteria 5232694
480 8055091036 8055087960 Bacteria 4784273
481 8055094459 8055092621 Bacteria 4873875
482 8055099872 8055097453 Bacteria 4865496
483 8057309463 8057304971 Bacteria 4649742
484 Ga0065704_10000270
485 SwRhRL2b_contig_1797070
486 SwRhRL2b_contig_182090
487 JGI25162J39368_1000112
488 JGI25163J39215_1000031
489 JGI25163J39215_1000055
490 JGI25164J39214_1000094
491 JGI25152J39213_1000343
492 rootH2_10031518
493 Ga0055538_1000076
494 Ga0055539_1000115
495 Ga0055533_1000121
496 Ga0055525_1000159
497 Ga0055541_1000077
498 Ga0058692_1000232
499 Ga0058692_1001974
500 Ga0058692_1002212
501 Ga0058692_1002227
502 Ga0058692_1002355
503 Ga0058692_1003743
504 Ga0058692_1006223
505 Ga0058692_1009242
506 Ga0058692_1011852
507 Ga0058692_1019985
508 Ga0065704_10001131
509 Ga0065704_10001222
510 Ga0065704_10106493
511 Ga0070668_100025488
512 Ga0070659_100037129
513 Ga0070665_100000595
514 Ga0070665_100070887
515 Ga0079104_1000535
516 Ga0079104_1000611
517 Ga0079104_1000775
518 Ga0079104_1001480
519 Ga0079104_1002634
520 Ga0079104_1005813
521 Ga0079104_1006112
522 Ga0079104_1006832
523 Ga0079104_1013219
524 Ga0105251_10000752
525 Ga0105251_10001038
526 Ga0105251_10008328
527 Ga0105251_10045863
528 Ga0105244_10000222
529 Ga0105244_10000330
530 Ga0105244_10000354
531 Ga0105244_10000586
532 Ga0105244_10000865
533 Ga0105244_10001499
534 Ga0105244_10010356
535 Ga0105244_10018889
536 Ga0105244_10020096
537 Ga0105244_10052901
538 Ga0105244_10097982
539 Ga0105250_10000001
540 Ga0105250_10000195
541 Ga0105250_10000253
542 Ga0105250_10000448
543 Ga0105250_10003065
544 Ga0105250_10007391
545 Ga0105250_10020296
546 Ga0105250_10068485
547 Ga0105246_10237582
548 Ga0157373_10000500
549 Ga0157371_10000099
550 Ga0157371_10001578
551 Ga0157371_10002572
552 Ga0157371_10016739
553 Ga0157371_10026882
554 Ga0157370_10000234
555 Ga0157370_10006551
556 Ga0157370_10015259
557 Ga0157369_10030301
558 Ga0157369_10032764
559 Ga0163162_10035335
560 Ga0163162_10061435
561 Ga0163162_10228190
562 Ga0157372_10007775
563 Ga0157372_10014588
564 Ga0157372_10023900
565 Ga0157372_10150426
566 Ga0157372_10490694
567 Ga0157372_10490806
568 Ga0182006_1000047
569 Ga0182006_1008119
570 Ga0182007_10004870
571 Ga0183366_1001
572 Ga0183370_1001
573 Ga0183369_1001
574 Ga0183368_1001
575 Ga0213876_10000055
576 Ga0209760_100104
577 Ga0209784_100001
578 Ga0209566_100001
579 Ga0209674_100002
580 Ga0209563_100008
581 Ga0207427_100135
582 Ga0209437_100007
583 Ga0209437_100109
584 Ga0209437_100111
585 Ga0209677_100004
586 Ga0209129_1000004
587 Ga0209233_1002092
588 Ga0207696_1000028
589 Ga0207696_1000086
590 Ga0207696_1000116
591 Ga0207696_1000174
592 Ga0207696_1000235
593 Ga0207696_1000439
594 Ga0207696_1001155
595 Ga0207696_1018715
596 Ga0207655_1000001
597 Ga0207655_1000004
598 Ga0207655_1000009
599 Ga0207655_1000089
600 Ga0207655_1000426
601 Ga0207655_1000647
602 Ga0207655_1000741
603 Ga0207655_1003187
604 Ga0207655_1005530
605 Ga0207655_1021636
606 Ga0207655_1031705
607 Ga0207713_1000001
608 Ga0207713_1000002
609 Ga0207713_1000003
610 Ga0207713_1000012
611 Ga0207713_1010034
612 Ga0207713_1025865
613 Ga0207668_10005192
614 Ga0209281_1000001
615 Ga0209281_1000130
616 Ga0209281_1000394
617 Ga0209281_1000428
618 Ga0209281_1000598
619 Ga0209281_1000713
620 Ga0209281_1001045
621 Ga0209281_1001234
622 Ga0209281_1002684
623 Ga0209281_1002778
624 Ga0209371_1000001
625 Ga0209371_1000002
626 Ga0209371_1000041
627 Ga0209371_1000122
628 Ga0209371_1000188
629 Ga0209371_1000492
630 Ga0209371_1000862
631 Ga0209371_1001378
632 Ga0209371_1001914
633 Ga0209371_1002701
634 Ga0209371_1003845
635 Ga0209371_1004166
636 Ga0209371_1006169
637 Ga0209371_1017870
638 Ga0268266_10001643
639 Ga0268266_10108169
640 Ga0268256_1000001
641 Ga0268256_1000002
642 Ga0268256_1000003
643 Ga0268256_1000048
644 Ga0268256_1000051
645 Ga0268256_1000718
646 Ga0268256_1000844
647 Ga0268256_1001182
648 Ga0268256_1001381
649 Ga0268256_1003561
650 Ga0268256_1003795
651 Ga0268256_1003845
652 Ga0268256_1004889
653 Ga0436365_0971002
654 Ga0439438_000001
655 Ga0439438_000780
656 Ga0439438_003644
657 Ga0439447_001075
658 Ga0439466_0000047
659 Ga0451853_3455637
660 Ga0439432_014950
661 Ga0439452_000001
662 Ga0439452_000002
663 Ga0439452_000008
664 Ga0439452_000142
665 Ga0439452_000298
666 Ga0439452_004971
667 Ga0450907_000190
668 Ga0466981_0000002
669 Ga0495591_000013
670 Ga0495591_000100
671 Ga0495591_008046
672 Ga0495638_0013681
673 Ga0495650_0000005
674 Ga0495650_0000090
675 Ga0495650_0000187
676 Ga0495650_0063478
677 Ga0495605_0082080
678 Ga0495585_0011587
679 Ga0495607_0017775
680 Ga0495606_0003762
681 Ga0495620_0008470
682 Ga0495637_0052144
683 Ga0495643_0034513
684 Ga0495643_0036865
685 Ga0495644_0000573
686 Ga0495648_0002343
687 Ga0495648_0009258
688 Ga0495654_0000041
689 Ga0495654_0000173
690 Ga0495654_0024026
691 Ga0495597_0001631
692 Ga0495668_0014499
693 Ga0495625_0016408
694 Ga0495588_0003244
695 Ga0495649_0001886
696 Ga0495649_0009622
697 Ga0495589_0005519
698 Ga0495660_0000028
699 Ga0495660_0000171
700 Ga0495660_0068039
701 Ga0495672_0000002
702 Ga0495672_0000020
703 Ga0495672_0000043
704 Ga0495679_000282
705 Ga0495679_016084
706 Ga0495679_032398
707 Ga0495679_034771
708 Ga0495673_0000070
709 Ga0495673_0000167
710 Ga0495681_0021707
711 Ga0496100_0004919
712 Ga0496100_0024451
713 Ga0496102_0049801
714 Ga0496104_0000555
715 Ga0496104_0048174
716 Ga0496105_0031796
717 Ga0496105_0091261
718 Ga0496105_0105271
719 Ga0496116_0000277
720 Ga0496116_0001125
721 Ga0496116_0008548
722 Ga0496116_0012630
723 Ga0496116_0015585
724 Ga0496116_0026100
725 Ga0496116_0049891
726 Ga0496116_0054111
727 Ga0496116_0067674
728 Ga0496117_0000004
729 Ga0496117_0000165
730 Ga0496117_0002525
731 Ga0496117_0003424
732 Ga0496117_0004066
733 Ga0496117_0020640
734 Ga0496117_0034148
735 Ga0496117_0034335
736 Ga0496117_0073597
737 Ga0496117_0099187
738 Ga0496118_0000007
739 Ga0496118_0000015
740 Ga0496118_0001126
741 Ga0496118_0002525
742 Ga0496118_0005269
743 Ga0496118_0012799
744 Ga0496118_0021142
745 Ga0496118_0026635
746 Ga0496118_0027827
747 Ga0496118_0036738
748 Ga0496118_0108478
749 Ga0496119_0000066
750 Ga0496119_0000095
751 Ga0496119_0001967
752 Ga0496119_0002594
753 Ga0496119_0012013
754 Ga0496119_0019406
755 Ga0496119_0024425
756 Ga0496119_0027666
757 Ga0496119_0037015
758 Ga0496119_0088247
759 Ga0496120_0000380
760 Ga0496120_0001267
761 Ga0496120_0001332
762 Ga0496120_0003408
763 Ga0496120_0003965
764 Ga0496120_0015425
765 Ga0496120_0025816
766 Ga0496120_0033071
767 Ga0496120_0050891
768 Ga0496121_0002250
769 Ga0496121_0003016
770 Ga0496121_0009694
771 Ga0496121_0025828
772 Ga0496121_0025872
773 Ga0496121_0035157
774 Ga0496121_0042151
775 Ga0496121_0084969
776 Ga0496122_0000005
777 Ga0496122_0000058
778 Ga0496122_0000738
779 Ga0496122_0004902
780 Ga0496122_0021615
781 Ga0496122_0025084
782 Ga0496122_0048348
783 Ga0496122_0057953
784 Ga0496122_0059356
785 Ga0496122_0074454
786 Ga0496122_0082194
787 Ga0496122_0103032
788 Ga0496123_0000008
789 Ga0496123_0000044
790 Ga0496123_0001322
791 Ga0496123_0002433
792 Ga0496123_0020012
793 Ga0496123_0022150
794 Ga0496123_0022151
795 Ga0496123_0032960
796 Ga0496123_0044729
797 Ga0496123_0111818
798 Ga0496124_0000105
799 Ga0496124_0000107
800 Ga0496124_0000564
801 Ga0496124_0001459
802 Ga0496124_0012635
803 Ga0496124_0023875
804 Ga0496124_0037522
805 Ga0496124_0039404
806 Ga0496124_0075693
807 Ga0496124_0092631
808 Ga0496124_0146862
809 Ga0496124_0148038
810 Ga0496124_0155607
811 Ga0496124_0173607
812 Ga0496124_0188723
813 Ga0496125_0000009
814 Ga0496125_0000103
815 Ga0496125_0001712
816 Ga0496125_0005660
817 Ga0496125_0007075
818 Ga0496125_0017105
819 Ga0496125_0024785
820 Ga0496125_0035149
821 Ga0496125_0040085
822 Ga0496125_0135826
823 Ga0496126_0000399
824 Ga0496126_0000779
825 Ga0496126_0002347
826 Ga0496126_0020256
827 Ga0496126_0093341
828 Ga0496126_0118871
829 Ga0496126_0274444
830 Ga0495678_000591
831 Ga0495678_014148
832 Ga0495682_0000001
833 nmdc:mga00v17_63633_c1
834 nmdc:mga0k408_1666_c3
835 Ga0500621_000003
836 2511378922
837 2511437155
838 2538425772
839 2547695173
840 2548648353
841 2555257427
842 2562462965
843 2585825448
844 2585832070
845 2599408928
846 2599925466
847 2601522555
848 2601527582
849 2601535281
850 2601540844
851 2601614413
852 2601619133
853 2601642247
854 2601647109
855 2601652560
856 2601657886
857 2601662070
858 2601695028
859 2601699700
860 2601706405
861 2601710711
862 2601715725
863 2601720051
864 2601726131
865 2601730672
866 2601735688
867 2601740956
868 2601750886
869 2601758463
870 2601764573
871 2602018140
872 2603638184
873 2603642692
874 2603659432
875 2603664707
876 2603698264
877 2603703282
878 2603838064
879 2603843142
880 2603848215
881 2603853290
882 2603867234
883 2603871341
884 2603876272
885 2606048534
886 2606069134
887 2606144956
888 2606175935
889 2608669281
890 2609913476
891 2637224799
892 2650898801
893 2671103219
894 2671109827
895 2671588314
896 2676406068
897 2681997634
898 2682006844
899 2686353185
900 2712469817
901 2753855712
902 2765588705
903 2775538712
904 2777022176
905 2791922471
906 2792314817
907 2793405752
908 2809123764
909 2813729160
910 2814696726
911 2821119518
912 2823374494
913 2844427264
914 2844530818
915 2846544408
916 2847800036
917 2852107780
918 2854604468
919 2855195970
920 2858468944
921 2865015107
922 2871272755
923 2871286325
924 2876604394
925 2881610076
926 2884089083
927 2891672934
928 2900052696
929 2904478176
930 2904504984
931 2904514313
932 2919108623
933 2919155306
934 2923634585
935 2927147984
936 2927834366
937 2935626899
938 2937540291
939 2939568909
940 2939573835
941 2939603465
942 2939607715
943 2939619358
944 2939644044
945 2945877465
946 2969081779
947 2971823191
948 2974312376
949 2974438235
950 2978975673
951 2984496470
952 2984564204
953 2984596939
954 2990261891
955 3000378723
956 8016736078
957 8018222312
958 8018408405
959 8019502823
960 8019506242
961 8054845641
962 8054853019
963 8055091036
964 8055094459
965 8055099872
966 8057309463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01458

SUFBD

SUF system FeS cluster assembly, SufBD

179

404

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5awf-assembly1.cif.gz_B crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9607 8 407
5awg-assembly2.cif.gz_F crystal structure of hg-bound sufb-sufc-sufd complex from escherichia coli 0.9471 67 407
5awf-assembly1.cif.gz_B crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9376 8 407
5awg-assembly2.cif.gz_F crystal structure of hg-bound sufb-sufc-sufd complex from escherichia coli 0.9081 67 407
4dn7-assembly1.cif.gz_B crystal structure of putative abc transporter, atp-binding protein from methanosarcina mazei go1 0.8997 153 401
ID Description Score Start End Superfamily
af_A0A1P8BCW1_1_144_3.80.20.20 Alpha Beta;Alpha-Beta Horseshoe;24 nucleotide stem-loop, u2 snrnp hairpin iv. U2 a'; Chain A;Receptor L-domain 0.3768 165 352 3.80.20.20
af_A0A1P8BCW1_1_144_3.80.20.20 Alpha Beta;Alpha-Beta Horseshoe;24 nucleotide stem-loop, u2 snrnp hairpin iv. U2 a'; Chain A;Receptor L-domain 0.367 165 352 3.80.20.20
af_A1Z6R4_12_375_3.30.497.10 Alpha Beta;2-Layer Sandwich;Antithrombin; Chain I, domain 2;Antithrombin, subunit I, domain 2 0.3513 8 52 3.30.497.10
af_Q7TQF2_412_577_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.3186 163 339 2.160.20.10
af_Q4CZP1_50_269_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.3123 161 352 2.160.20.10
ID Description Score Start End GO Terms
AF-M1WWM1-F1-model_v4 deleted 0.986 154 402
AF-A0A7C3MDX8-F1-model_v4 Fe-S cluster assembly protein SufD 0.9826 150 402 GO:0016226
AF-A0A523J6Q2-F1-model_v4 Fe-S cluster assembly protein SufD 0.982 154 403 GO:0016226
AF-A0A3M1AJQ1-F1-model_v4 Fe-S cluster assembly protein SufD 0.9819 154 403 GO:0016226
AF-A0A812TZT2-F1-model_v4 ABCI7 protein 0.9819 160 371 GO:0016226

Map