F452767

General Info

Members Datasets Scaffolds Average Seq Length
483 284 966 445

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10000041|Ga0157371_10000041181
Length 480
Sequence MVYRLWGMYPKPSAFYLSAFNLKKMLDSLKKMFSGNEADIPVNTGSKPDISRVKSAELYEKSKTYFPGGVNSPVRAFKSVYGTPLFIEKGDGCYIWDADGNQFIDFCGSWGPLILGHNNPKIREKVTEVMQNGMSFGAPTALENELAELIIKNNRFVEKIRFTSSGTEAVMSAIRLARGFTGRDKILKFEGCYHGHSDSLLVKAGSGLVTFGETSSAGVPKSFAEETIVVPLNDKTAIEQAFAQFKDQIAAVIIEGIPANNGLIMQDEEYIHFLRKICTDNGSLLIFDEVITGFRIGFEGAAAHYGIIPDIVTYGKIIGGGLPVGMYGARAEIMEHISPDGGVYQAGTLSGNPVAMAAGIATLTELNKSGFYKDLNNKAQEFVASIQRFATARNYKFKVFTIGSIFWFAFTDKDKIQSADDIDASSMEKFKVMHRELLNRGIYLGPSGYEVGFVSSAHTKIELEKAKRAIFEALDLVFKK

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
140 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
141 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
232 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
238 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
239 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
240 2738541283 Pedobacter sp. OK701 Isolate Unclassified
241 2738541284 Pedobacter sp. YR016 Isolate Unclassified
242 2738541302 Pedobacter sp. CF074 Isolate Unclassified
243 2738543023 Pedobacter sp. OK628 Isolate Unclassified
244 2739367651 Pedobacter sp. OK291 Isolate Unclassified
245 2739367656 Pedobacter sp. CF523 Isolate Unclassified
246 2739367663 Pedobacter sp. YR510 Isolate Unclassified
247 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
248 2818991437 Pedobacter terrae 518 Isolate Unclassified
249 2818991441 Niallia circulans 3243 Isolate Rhizosphere
250 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
251 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
252 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
253 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
254 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
255 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
256 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
257 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
258 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
259 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
260 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
261 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
262 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
263 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
264 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
265 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
266 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
267 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
268 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
269 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
270 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
271 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
272 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
273 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
274 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
275 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
276 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
277 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
278 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
279 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
280 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
281 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
282 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
283 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
284 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.65
Metatranscriptomes 0.41
Isolates 9.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.45
Nodule 0
Rhizoplane 1.45
Rhizosphere 81.99
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10000041 3300013102 Bacteria 203957
2 SwRhRL2b_contig_1166171 2162886007 Bacteria 3229
3 JGI24737J22298_10004613 3300001990 Bacteria 4794
4 JGI24737J22298_10007890 3300001990 Bacteria 3584
5 JGI24737J22298_10013231 3300001990 Bacteria 2687
6 JGI24735J21928_10000009 3300002067 Bacteria 247425
7 JGI24735J21928_10000036 3300002067 Bacteria 65596
8 JGI24735J21928_10007144 3300002067 Bacteria 3647
9 JGI25162J39368_1000123 3300002737 Bacteria 85062
10 JGI25162J39368_1000306 3300002737 Bacteria 44891
11 JGI25152J39213_1000047 3300002773 Bacteria 84434
12 JGI25150J39212_1000001 3300002774 Bacteria 1318726
13 JGI25151J46595_10000001 3300003187 Bacteria 887211
14 JGI25151J46595_10000060 3300003187 Bacteria 146867
15 JGI25151J46595_10021862 3300003187 Bacteria 2667
16 JGI25165J46597_1000983 3300003214 Bacteria 19102
17 JGI25153J46596_10000001 3300003215 Bacteria 748985
18 rootH1_10113611 3300003316 Bacteria 2739
19 rootH2_10000336 3300003320 Bacteria 69852
20 rootH2_10194668 3300003320 Bacteria 2213
21 rootH2_10198877 3300003320 Bacteria 3557
22 rootH1_10011684 3300003323 Bacteria 42276
23 Ga0055536_1000004 3300003781 Bacteria 411108
24 Ga0055530_10005284 3300003791 Bacteria 6205
25 Ga0058863_10041784 3300004799 Bacteria 7673
26 Ga0058862_11288598 3300004803 Unclassified 1676
27 Ga0065714_10002286 3300005288 Bacteria 28187
28 Ga0065714_10007892 3300005288 Bacteria 3930
29 Ga0065714_10011309 3300005288 Bacteria 2119
30 Ga0065714_10013017 3300005288 Bacteria 3063
31 Ga0065714_10013455 3300005288 Bacteria 2288
32 Ga0065714_10076017 3300005288 Bacteria 2823
33 Ga0065704_10000263 3300005289 Bacteria 48992
34 Ga0065704_10080358 3300005289 Bacteria 3961
35 Ga0065707_10118584 3300005295 Bacteria 2181
36 Ga0070658_10000099 3300005327 Bacteria 76585
37 Ga0070683_100018563 3300005329 Bacteria 6164
38 Ga0068868_100009296 3300005338 Bacteria 7066
39 Ga0068868_100017383 3300005338 Bacteria 5358
40 Ga0068868_100041830 3300005338 Bacteria 3572
41 Ga0068868_100204940 3300005338 Bacteria 1646
42 Ga0070660_100175322 3300005339 Bacteria 1734
43 Ga0070661_100125111 3300005344 Bacteria 1928
44 Ga0070673_100038055 3300005364 Bacteria 3671
45 Ga0070688_100178064 3300005365 Bacteria 1473
46 Ga0070659_100000824 3300005366 Bacteria 22594
47 Ga0070667_100000809 3300005367 Bacteria 29230
48 Ga0070703_10000002 3300005406 Bacteria 167332
49 Ga0070708_100000212 3300005445 Bacteria 43245
50 Ga0070708_100007479 3300005445 Bacteria 8747
51 Ga0070663_100015786 3300005455 Bacteria 4886
52 Ga0070678_100019638 3300005456 Bacteria 4414
53 Ga0070662_100000013 3300005457 Bacteria 125019
54 Ga0070681_10005212 3300005458 Bacteria 12550
55 Ga0068867_100000852 3300005459 Bacteria 20584
56 Ga0070706_100011276 3300005467 Bacteria 8302
57 Ga0070707_100014787 3300005468 Bacteria 7315
58 Ga0070679_100018413 3300005530 Bacteria 6777
59 Ga0070679_100022509 3300005530 Bacteria 6160
60 Ga0070679_100273660 3300005530 Bacteria 1642
61 Ga0068853_100007576 3300005539 Bacteria 8692
62 Ga0070696_100011483 3300005546 Bacteria 5933
63 Ga0070665_100000010 3300005548 Bacteria 529545
64 Ga0070665_100084628 3300005548 Bacteria 3176
65 Ga0070704_100008443 3300005549 Bacteria 6177
66 Ga0068855_100000631 3300005563 Bacteria 43172
67 Ga0068855_100001701 3300005563 Bacteria 27524
68 Ga0068855_100013731 3300005563 Bacteria 9764
69 Ga0068855_100024159 3300005563 Bacteria 7275
70 Ga0068857_100014194 3300005577 Bacteria 6937
71 Ga0068856_100000030 3300005614 Bacteria 128494
72 Ga0068856_100002703 3300005614 Bacteria 18181
73 Ga0068856_100037042 3300005614 Bacteria 4785
74 Ga0068864_100032786 3300005618 Bacteria 4415
75 Ga0068866_10012303 3300005718 Bacteria 3727
76 Ga0068866_10050649 3300005718 Bacteria 2110
77 Ga0068863_100026789 3300005841 Bacteria 5497
78 Ga0068858_100074153 3300005842 Bacteria 3159
79 Ga0068860_100008525 3300005843 Bacteria 10214
80 Ga0075366_10002946 3300006195 Bacteria 8859
81 Ga0097621_100001053 3300006237 Bacteria 19313
82 Ga0097621_100001956 3300006237 Bacteria 14050
83 Ga0068871_100000109 3300006358 Bacteria 49767
84 Ga0068865_100000079 3300006881 Bacteria 51370
85 Ga0068865_100057333 3300006881 Bacteria 2717
86 Ga0099795_10000034 3300007788 Bacteria 36525
87 Ga0105240_10000128 3300009093 Bacteria 156107
88 Ga0105240_10001477 3300009093 Bacteria 40056
89 Ga0105240_10027264 3300009093 Bacteria 7481
90 Ga0105240_10033682 3300009093 Bacteria 6615
91 Ga0105240_10143513 3300009093 Bacteria 2852
92 Ga0105245_10007223 3300009098 Bacteria 9735
93 Ga0105247_10029255 3300009101 Bacteria 3338
94 Ga0105243_10000009 3300009148 Bacteria 354419
95 Ga0105243_10019690 3300009148 Bacteria 5117
96 Ga0105243_10035109 3300009148 Bacteria 3886
97 Ga0105243_10165720 3300009148 Bacteria 1909
98 Ga0105241_10001015 3300009174 Bacteria 21354
99 Ga0105241_10014824 3300009174 Bacteria 5707
100 Ga0105241_10133858 3300009174 Bacteria 2010
101 Ga0105242_10018964 3300009176 Bacteria 5388
102 Ga0105242_10020601 3300009176 Bacteria 5172
103 Ga0105242_10065006 3300009176 Bacteria 3008
104 Ga0105242_10077525 3300009176 Bacteria 2773
105 Ga0105242_10104699 3300009176 Unclassified 2402
106 Ga0105248_10036920 3300009177 Bacteria 5465
107 Ga0105237_10000713 3300009545 Bacteria 45969
108 Ga0105237_10001681 3300009545 Bacteria 28643
109 Ga0105237_10003226 3300009545 Bacteria 19533
110 Ga0105237_10010902 3300009545 Bacteria 9645
111 Ga0105237_10027313 3300009545 Bacteria 5828
112 Ga0105237_10032126 3300009545 Bacteria 5315
113 Ga0105237_10041568 3300009545 Bacteria 4636
114 Ga0105238_10007790 3300009551 Bacteria 10714
115 Ga0105238_10203895 3300009551 Bacteria 1954
116 Ga0099796_10000049 3300010159 Bacteria 22581
117 Ga0105239_10000011 3300010375 Bacteria 337500
118 Ga0105239_10000392 3300010375 Bacteria 64144
119 Ga0105239_10001249 3300010375 Bacteria 34548
120 Ga0105239_10003944 3300010375 Bacteria 17976
121 Ga0105239_10004273 3300010375 Bacteria 17138
122 Ga0105239_10005554 3300010375 Bacteria 14758
123 Ga0105239_10214347 3300010375 Bacteria 2158
124 Ga0157373_10000115 3300013100 Bacteria 63326
125 Ga0157373_10003087 3300013100 Bacteria 12582
126 Ga0157373_10003093 3300013100 Bacteria 12572
127 Ga0157373_10018401 3300013100 Bacteria 5086
128 Ga0157373_10138790 3300013100 Bacteria 1709
129 Ga0157371_10001176 3300013102 Bacteria 28083
130 Ga0157371_10005754 3300013102 Bacteria 10387
131 Ga0157371_10008441 3300013102 Bacteria 8202
132 Ga0157371_10013384 3300013102 Bacteria 6232
133 Ga0157371_10013891 3300013102 Bacteria 6099
134 Ga0157370_10002405 3300013104 Bacteria 22561
135 Ga0157370_10003392 3300013104 Bacteria 18728
136 Ga0157370_10019162 3300013104 Bacteria 6876
137 Ga0157370_10022798 3300013104 Bacteria 6227
138 Ga0157370_10024814 3300013104 Bacteria 5936
139 Ga0157370_10035113 3300013104 Bacteria 4877
140 Ga0157370_10037895 3300013104 Bacteria 4667
141 Ga0157370_10104762 3300013104 Bacteria 2648
142 Ga0157370_10112109 3300013104 Bacteria 2549
143 Ga0157369_10000016 3300013105 Bacteria 257827
144 Ga0157369_10005273 3300013105 Bacteria 15070
145 Ga0157369_10144705 3300013105 Bacteria 2514
146 Ga0157374_10000258 3300013296 Bacteria 48926
147 Ga0157374_10003809 3300013296 Bacteria 12674
148 Ga0157374_10008551 3300013296 Bacteria 8754
149 Ga0157378_10002371 3300013297 Bacteria 16734
150 Ga0157378_10003207 3300013297 Bacteria 14537
151 Ga0157378_10039852 3300013297 Bacteria 4166
152 Ga0157378_10049370 3300013297 Bacteria 3743
153 Ga0157378_10329949 3300013297 Bacteria 1485
154 Ga0163162_10000005 3300013306 Bacteria 447195
155 Ga0163162_10013733 3300013306 Bacteria 7910
156 Ga0163162_10057754 3300013306 Bacteria 3908
157 Ga0157372_10000026 3300013307 Bacteria 195407
158 Ga0157372_10001115 3300013307 Bacteria 29190
159 Ga0157372_10001737 3300013307 Bacteria 23642
160 Ga0157372_10004698 3300013307 Bacteria 14503
161 Ga0157372_10087795 3300013307 Bacteria 3530
162 Ga0157372_10143188 3300013307 Bacteria 2756
163 Ga0157375_10019342 3300013308 Bacteria 6193
164 Ga0163163_10012355 3300014325 Bacteria 7780
165 Ga0182008_10000014 3300014497 Bacteria 263844
166 Ga0182008_10000932 3300014497 Bacteria 20364
167 Ga0182008_10001241 3300014497 Bacteria 17515
168 Ga0182008_10006343 3300014497 Bacteria 6621
169 Ga0182008_10024565 3300014497 Bacteria 3067
170 Ga0157376_10004563 3300014969 Bacteria 9641
171 Ga0182006_1000258 3300015261 Bacteria 48657
172 Ga0182006_1001127 3300015261 Bacteria 16984
173 Ga0182006_1007803 3300015261 Bacteria 4878
174 Ga0182007_10000002 3300015262 Bacteria 564661
175 Ga0182007_10003077 3300015262 Bacteria 8031
176 Ga0182007_10012583 3300015262 Bacteria 3250
177 Ga0182007_10013350 3300015262 Bacteria 3134
178 Ga0183373_1004 3300015682 Bacteria 537398
179 Ga0163161_10000347 3300017792 Bacteria 39178
180 Ga0163161_10001290 3300017792 Bacteria 18682
181 Ga0163161_10002101 3300017792 Bacteria 14424
182 Ga0163161_10003196 3300017792 Bacteria 11522
183 Ga0163161_10038624 3300017792 Bacteria 3424
184 Ga0163161_10054942 3300017792 Bacteria 2890
185 Ga0207427_100210 3300025231 Bacteria 53314
186 Ga0209437_100021 3300025233 Bacteria 646400
187 Ga0209437_100251 3300025233 Bacteria 85135
188 Ga0207425_1000002 3300025245 Bacteria 1362590
189 Ga0209026_1000943 3300025250 Bacteria 14626
190 Ga0209026_1001240 3300025250 Bacteria 11679
191 Ga0209129_1000002 3300025258 Bacteria 1359086
192 Ga0209233_1000035 3300025261 Bacteria 568478
193 Ga0209233_1000482 3300025261 Bacteria 24375
194 Ga0209455_1000741 3300025272 Bacteria 18689
195 Ga0209675_1020495 3300025291 Bacteria 1790
196 Ga0209676_1000009 3300025292 Bacteria 981719
197 Ga0209025_1000004 3300025294 Bacteria 1361782
198 Ga0209758_1000006 3300025297 Bacteria 1359562
199 Ga0209050_1000048 3300025298 Bacteria 371553
200 Ga0207653_10000285 3300025885 Bacteria 29669
201 Ga0207642_10032183 3300025899 Bacteria 2205
202 Ga0207710_10046824 3300025900 Bacteria 1931
203 Ga0207680_10004601 3300025903 Bacteria 6548
204 Ga0207647_10000044 3300025904 Bacteria 90491
205 Ga0207647_10000431 3300025904 Bacteria 34359
206 Ga0207645_10000135 3300025907 Bacteria 56584
207 Ga0207705_10000142 3300025909 Bacteria 76788
208 Ga0207684_10000078 3300025910 Bacteria 181899
209 Ga0207654_10000191 3300025911 Bacteria 37892
210 Ga0207654_10004366 3300025911 Bacteria 7126
211 Ga0207654_10007426 3300025911 Bacteria 5521
212 Ga0207707_10010880 3300025912 Bacteria 7908
213 Ga0207695_10000179 3300025913 Bacteria 185564
214 Ga0207695_10002745 3300025913 Bacteria 25680
215 Ga0207695_10043825 3300025913 Bacteria 4763
216 Ga0207695_10048667 3300025913 Bacteria 4476
217 Ga0207671_10000948 3300025914 Bacteria 36011
218 Ga0207671_10002949 3300025914 Bacteria 17525
219 Ga0207671_10004197 3300025914 Bacteria 13900
220 Ga0207671_10014945 3300025914 Bacteria 6102
221 Ga0207671_10022468 3300025914 Bacteria 4769
222 Ga0207693_10039863 3300025915 Bacteria 3699
223 Ga0207657_10165407 3300025919 Bacteria 1795
224 Ga0207649_10035242 3300025920 Bacteria 3006
225 Ga0207652_10015818 3300025921 Bacteria 6148
226 Ga0207652_10039708 3300025921 Bacteria 3994
227 Ga0207646_10001252 3300025922 Bacteria 31826
228 Ga0207646_10200777 3300025922 Bacteria 1801
229 Ga0207694_10025702 3300025924 Bacteria 4476
230 Ga0207694_10147051 3300025924 Bacteria 1897
231 Ga0207644_10009772 3300025931 Bacteria 6307
232 Ga0207690_10000351 3300025932 Bacteria 30727
233 Ga0207706_10000173 3300025933 Bacteria 71958
234 Ga0207686_10059636 3300025934 Unclassified 2412
235 Ga0207709_10000026 3300025935 Bacteria 354467
236 Ga0207709_10009698 3300025935 Bacteria 5306
237 Ga0207704_10000019 3300025938 Bacteria 152734
238 Ga0207711_10003881 3300025941 Bacteria 12864
239 Ga0207689_10188890 3300025942 Bacteria 1699
240 Ga0207661_10202345 3300025944 Bacteria 1746
241 Ga0207667_10000030 3300025949 Bacteria 327226
242 Ga0207667_10000218 3300025949 Bacteria 80364
243 Ga0207667_10011112 3300025949 Bacteria 10483
244 Ga0207667_10013873 3300025949 Bacteria 9205
245 Ga0207667_10015128 3300025949 Bacteria 8774
246 Ga0207667_10028328 3300025949 Bacteria 6084
247 Ga0207667_10033359 3300025949 Bacteria 5535
248 Ga0207667_10069079 3300025949 Bacteria 3678
249 Ga0207651_10003044 3300025960 Bacteria 8132
250 Ga0207640_10003804 3300025981 Bacteria 8132
251 Ga0207677_10015964 3300026023 Bacteria 4434
252 Ga0207677_10027281 3300026023 Bacteria 3594
253 Ga0207703_10002324 3300026035 Bacteria 16603
254 Ga0207639_10042961 3300026041 Bacteria 3390
255 Ga0207639_10113084 3300026041 Bacteria 2217
256 Ga0207639_10135609 3300026041 Bacteria 2043
257 Ga0207678_10021189 3300026067 Bacteria 5698
258 Ga0207702_10001383 3300026078 Bacteria 24198
259 Ga0207702_10028200 3300026078 Bacteria 4665
260 Ga0207641_10209351 3300026088 Bacteria 1803
261 Ga0207648_10000061 3300026089 Bacteria 101034
262 Ga0207676_10053061 3300026095 Bacteria 3172
263 Ga0207683_10002822 3300026121 Bacteria 15178
264 Ga0209179_1000027 3300027512 Bacteria 35217
265 Ga0268266_10000032 3300028379 Bacteria 395079
266 Ga0307517_10000640 3300028786 Bacteria 59989
267 Ga0307515_10002716 3300028794 Bacteria 37857
268 Ga0307515_10017577 3300028794 Bacteria 13009
269 Ga0307515_10018541 3300028794 Bacteria 12580
270 Ga0307515_10191099 3300028794 Bacteria 1957
271 Ga0265338_10006311 3300028800 Bacteria 15153
272 Ga0265338_10024117 3300028800 Bacteria 6226
273 Ga0265338_10063557 3300028800 Bacteria 3218
274 Ga0265338_10069960 3300028800 Bacteria 3012
275 Ga0268256_1004720 3300030500 Bacteria 5553
276 Ga0316183_1046861 3300030742 Bacteria 13742
277 Ga0316181_1079882 3300030744 Bacteria 8228
278 Ga0265340_10029943 3300031247 Bacteria 2732
279 Ga0265327_10003330 3300031251 Bacteria 15537
280 Ga0265327_10008974 3300031251 Bacteria 7325
281 Ga0265327_10042075 3300031251 Bacteria 2455
282 Ga0307509_10031891 3300031507 Bacteria 5811
283 Ga0307408_100000324 3300031548 Bacteria 45798
284 Ga0307408_100020325 3300031548 Unclassified 4479
285 Ga0307408_100049562 3300031548 Bacteria 3017
286 Ga0307405_10000006 3300031731 Bacteria 361477
287 Ga0307407_10000075 3300031903 Bacteria 35183
288 Ga0307412_10000827 3300031911 Bacteria 17835
289 Ga0307412_10033931 3300031911 Bacteria 3248
290 Ga0307412_10041772 3300031911 Bacteria 2974
291 Ga0307409_100011023 3300031995 Bacteria 5668
292 Ga0307416_100000002 3300032002 Bacteria 509907
293 Ga0307414_10004624 3300032004 Bacteria 7489
294 Ga0307414_10010138 3300032004 Bacteria 5450
295 Ga0307414_10014891 3300032004 Bacteria 4680
296 Ga0307414_10039826 3300032004 Bacteria 3169
297 Ga0307414_10205637 3300032004 Bacteria 1605
298 Ga0307507_10000034 3300033179 Bacteria 188697
299 Ga0307510_10005665 3300033180 Bacteria 14888
300 Ga0373937_0068517 3300036401 Bacteria 3272
301 Ga0373937_0250212 3300036401 Bacteria 1671
302 Ga0395899_0000011 3300037312 Bacteria 521331
303 Ga0395899_0000025 3300037312 Bacteria 350927
304 Ga0395899_0000055 3300037312 Bacteria 220579
305 Ga0395899_0000563 3300037312 Bacteria 39619
306 Ga0395900_0000173 3300037418 Bacteria 103767
307 Ga0395900_0001545 3300037418 Bacteria 27359
308 Ga0395900_0035437 3300037418 Bacteria 5140
309 Ga0395900_0103932 3300037418 Unclassified 2918
310 Ga0395900_0413957 3300037418 Unclassified 1310
311 Ga0395898_0005193 3300037466 Bacteria 14084
312 Ga0395905_0000001 3300037471 Bacteria 2037079
313 Ga0395905_0000779 3300037471 Bacteria 41889
314 Ga0395905_0001821 3300037471 Bacteria 24671
315 Ga0395905_0003424 3300037471 Bacteria 16975
316 Ga0395905_0004928 3300037471 Bacteria 13744
317 Ga0395905_0039675 3300037471 Bacteria 4418
318 Ga0395905_0048862 3300037471 Bacteria 3963
319 Ga0395901_0006218 3300038443 Bacteria 12101
320 Ga0395901_0020679 3300038443 Bacteria 6737
321 Ga0395901_0043624 3300038443 Bacteria 4651
322 Ga0395901_0111729 3300038443 Bacteria 2870
323 Ga0395901_0128587 3300038443 Bacteria 2663
324 Ga0439448_0003865 3300042005 Bacteria 4193
325 Ga0451577_0000213 3300042876 Bacteria 121176
326 Ga0451577_0028735 3300042876 Bacteria 5027
327 Ga0451577_0081370 3300042876 Bacteria 2888
328 Ga0451577_0109743 3300042876 Bacteria 2467
329 Ga0453683_0011991 3300044673 Bacteria 5692
330 Ga0453683_0120503 3300044673 Bacteria 1651
331 Ga0466966_0058270 3300044684 Bacteria 2441
332 Ga0453684_0002500 3300044712 Bacteria 44341
333 Ga0453684_0091888 3300044712 Bacteria 3744
334 Ga0453684_0248173 3300044712 Bacteria 2045
335 Ga0453684_0280650 3300044712 Unclassified 1900
336 Ga0451576_0000002 3300045051 Bacteria 1670975
337 Ga0451576_0033134 3300045051 Bacteria 5492
338 Ga0451576_0294584 3300045051 Bacteria 1696
339 Ga0466958_0014767 3300045836 Bacteria 4462
340 Ga0495603_0003242 3300046455 Bacteria 9696
341 Ga0495603_0055292 3300046455 Bacteria 2352
342 Ga0495591_022492 3300046458 Bacteria 2036
343 Ga0495629_0117416 3300046459 Bacteria 1854
344 Ga0495650_0000447 3300046471 Bacteria 65735
345 Ga0495580_0075136 3300046472 Bacteria 2358
346 Ga0495585_0000116 3300046492 Bacteria 86272
347 Ga0495585_0000596 3300046492 Bacteria 33838
348 Ga0495594_0107800 3300046499 Bacteria 1569
349 Ga0495596_0007857 3300046500 Bacteria 4780
350 Ga0495583_0016097 3300046506 Bacteria 4037
351 Ga0495606_0000844 3300046507 Bacteria 46120
352 Ga0495606_0030120 3300046507 Bacteria 3796
353 Ga0495610_0000099 3300046512 Bacteria 101553
354 Ga0495610_0002563 3300046512 Bacteria 15114
355 Ga0495610_0002995 3300046512 Bacteria 13606
356 Ga0495616_0006153 3300046513 Bacteria 7308
357 Ga0495644_0044246 3300046523 Bacteria 1675
358 Ga0495609_0007074 3300046538 Bacteria 5648
359 Ga0495609_0026385 3300046538 Bacteria 2661
360 Ga0495621_0000057 3300046539 Bacteria 21332
361 Ga0495633_0000021 3300046558 Bacteria 227171
362 Ga0495633_0003971 3300046558 Bacteria 9602
363 Ga0495668_0000165 3300046616 Bacteria 98016
364 Ga0495625_0000907 3300046660 Bacteria 39912
365 Ga0495625_0000972 3300046660 Bacteria 38083
366 Ga0495625_0027806 3300046660 Bacteria 4250
367 Ga0495661_0000341 3300046665 Bacteria 51001
368 Ga0495588_0035791 3300046674 Bacteria 2517
369 Ga0495647_0001761 3300046681 Bacteria 6709
370 Ga0495658_0005011 3300046683 Bacteria 6504
371 Ga0495649_0000014 3300046694 Bacteria 287408
372 Ga0495649_0014284 3300046694 Bacteria 4560
373 Ga0495683_0025426 3300047323 Bacteria 3035
374 Ga0495687_001057 3300047443 Bacteria 27242
375 Ga0495687_005260 3300047443 Bacteria 8315
376 Ga0495673_0053516 3300047469 Bacteria 1759
377 Ga0495681_0045705 3300047470 Bacteria 2093
378 Ga0495686_0000913 3300047472 Bacteria 37043
379 Ga0495686_0001318 3300047472 Bacteria 27838
380 Ga0495686_0015517 3300047472 Bacteria 5196
381 Ga0495686_0037993 3300047472 Bacteria 3082
382 Ga0495686_0042805 3300047472 Bacteria 2876
383 Ga0495614_0060498 3300048089 Bacteria 1627
384 Ga0496101_0007581 3300048904 Bacteria 7043
385 Ga0496104_0034585 3300048907 Bacteria 4713
386 Ga0496105_0002145 3300048908 Bacteria 14294
387 Ga0496106_0002978 3300048909 Bacteria 12613
388 Ga0496108_0021926 3300048911 Bacteria 5250
389 Ga0496109_0055722 3300048912 Bacteria 3606
390 Ga0496116_0022816 3300048919 Bacteria 4677
391 Ga0496116_0022843 3300048919 Bacteria 4673
392 Ga0496117_0011076 3300048920 Bacteria 8114
393 Ga0496122_0002491 3300048925 Bacteria 26020
394 Ga0496122_0092725 3300048925 Bacteria 2051
395 Ga0496123_0005145 3300048926 Bacteria 13323
396 Ga0496123_0102798 3300048926 Bacteria 1657
397 Ga0496124_0102864 3300048927 Bacteria 2311
398 Ga0496125_0237768 3300048928 Bacteria 1159
399 Ga0496126_0055631 3300048929 Unclassified 3579
400 Ga0495678_006175 3300049459 Bacteria 6420
401 Ga0495682_0072652 3300049460 Bacteria 1238
402 Ga0501032_0026240 3300049569 Bacteria 4010
403 Ga0501037_0000732 3300049573 Bacteria 24915
404 Ga0501037_0055451 3300049573 Bacteria 2897
405 Ga0501038_0001222 3300049574 Bacteria 23298
406 Ga0501038_0239254 3300049574 Bacteria 1442
407 Ga0501042_0080292 3300049578 Bacteria 2337
408 Ga0501046_0073727 3300049580 Bacteria 2649
409 Ga0501046_0079017 3300049580 Bacteria 2544
410 Ga0501047_0190045 3300049581 Bacteria 1917
411 Ga0501070_0002248 3300049586 Bacteria 16967
412 Ga0501070_0026653 3300049586 Bacteria 4848
413 Ga0501070_0082398 3300049586 Bacteria 2663
414 Ga0501071_0021897 3300049587 Bacteria 4455
415 Ga0501074_0000076 3300049590 Bacteria 47882
416 Ga0501075_0049670 3300049591 Bacteria 3153
417 Ga0501076_0035959 3300049592 Bacteria 3878
418 Ga0501223_002508 3300049663 Bacteria 4065
419 Ga0501080_0012965 3300049742 Bacteria 7652
420 Ga0501081_0018433 3300049743 Bacteria 4636
421 Ga0501241_005478 3300049758 Bacteria 2365
422 nmdc:mga0k408_237_c1 3300050493 Bacteria 29636
423 nmdc:mga0k408_49719_c1 3300050493 Bacteria 2427
424 nmdc:mga0a205_92552_c1 3300050515 Bacteria 2921
425 Ga0500635_0001928 3300053080 Bacteria 5062
426 Ga0500643_000810 3300053087 Bacteria 20155
427 Ga0500651_0000182 3300053093 Bacteria 40910
428 Ga0500608_000555 3300053122 Bacteria 13973
429 Ga0500608_008573 3300053122 Bacteria 4307
430 Ga0500618_000027 3300053125 Bacteria 142903
431 Ga0500642_0002544 3300053130 Bacteria 5375
432 Ga0500579_096933 3300053143 Bacteria 1558
433 Ga0500622_0000440 3300053156 Bacteria 39478
434 Ga0530510_0028705 3300061734 Bacteria 3989
435 Ga0530510_0038128 3300061734 Bacteria 3469
436 2586208089 2585427687 Bacteria 5544917
437 2599479322 2599185184 Bacteria 6430550
438 2722726247 2721755487 Bacteria 6357185
439 2738756866 2738541283 Bacteria 7222293
440 2738760124 2738541284 Bacteria 5199923
441 2738856575 2738541302 Bacteria 5944758
442 2739304992 2738543023 Bacteria 6767879
443 2739588119 2739367651 Bacteria 6359826
444 2739616213 2739367656 Bacteria 5152243
445 2739646874 2739367663 Bacteria 5040914
446 2776612108 2775506987 Bacteria 5373360
447 2819546018 2818991437 Bacteria 5805520
448 2819568656 2818991441 Bacteria 5062707
449 2831906619 2831905167 Bacteria 3319172
450 2842724085 2842722452 Bacteria 6263924
451 2842908822 2842903701 Bacteria 6986368
452 2842912183 2842909656 Bacteria 6185908
453 2849282400 2849281842 Bacteria 6065644
454 2852625364 2852623160 Bacteria 4376875
455 2852631728 2852627209 Bacteria 5896285
456 2857631315 2857627736 Bacteria 5625397
457 2881645078 2881644220 Bacteria 5302661
458 2884934376 2884933994 Bacteria 4535041
459 2890739311 2890737413 Bacteria 4269751
460 2890806768 2890804823 Bacteria 3717572
461 2895501544 2895498888 Bacteria 5283788
462 2896320770 2896317667 Bacteria 4606601
463 2896346846 2896344016 Bacteria 3811746
464 2898713478 2898713307 Bacteria 4110805
465 2902052387 2902048731 Bacteria 4976191
466 2904446276 2904445276 Bacteria 5310396
467 2904782851 2904780799 Bacteria 5840761
468 2919180462 2919177583 Bacteria 5641607
469 2919191430 2919186247 Bacteria 6244071
470 2919418229 2919414237 Bacteria 5429133
471 2919438039 2919437846 Bacteria 6199444
472 2928082368 2928078545 Bacteria 6534839
473 2928149051 2928147474 Bacteria 6512076
474 2932088406 2932082852 Bacteria 6563563
475 2936362019 2936361878 Bacteria 5632809
476 2939669651 2939664404 Bacteria 6364494
477 2945999102 2945997725 Bacteria 6404843
478 2954021551 2954016120 Bacteria 6446024
479 2964379234 2964375228 Bacteria 4909004
480 2977233888 2977232053 Bacteria 5485925
481 2977256396 2977254563 Bacteria 4828420
482 3003234849 3003233435 Bacteria 4458031
483 8055591252 8055588893 Bacteria 3619545
484 Ga0157371_10000041
485 SwRhRL2b_contig_1166171
486 JGI24737J22298_10004613
487 JGI24737J22298_10007890
488 JGI24737J22298_10013231
489 JGI24735J21928_10000009
490 JGI24735J21928_10000036
491 JGI24735J21928_10007144
492 JGI25162J39368_1000123
493 JGI25162J39368_1000306
494 JGI25152J39213_1000047
495 JGI25150J39212_1000001
496 JGI25151J46595_10000001
497 JGI25151J46595_10000060
498 JGI25151J46595_10021862
499 JGI25165J46597_1000983
500 JGI25153J46596_10000001
501 rootH1_10113611
502 rootH2_10000336
503 rootH2_10194668
504 rootH2_10198877
505 rootH1_10011684
506 Ga0055536_1000004
507 Ga0055530_10005284
508 Ga0058863_10041784
509 Ga0058862_11288598
510 Ga0065714_10002286
511 Ga0065714_10007892
512 Ga0065714_10011309
513 Ga0065714_10013017
514 Ga0065714_10013455
515 Ga0065714_10076017
516 Ga0065704_10000263
517 Ga0065704_10080358
518 Ga0065707_10118584
519 Ga0070658_10000099
520 Ga0070683_100018563
521 Ga0068868_100009296
522 Ga0068868_100017383
523 Ga0068868_100041830
524 Ga0068868_100204940
525 Ga0070660_100175322
526 Ga0070661_100125111
527 Ga0070673_100038055
528 Ga0070688_100178064
529 Ga0070659_100000824
530 Ga0070667_100000809
531 Ga0070703_10000002
532 Ga0070708_100000212
533 Ga0070708_100007479
534 Ga0070663_100015786
535 Ga0070678_100019638
536 Ga0070662_100000013
537 Ga0070681_10005212
538 Ga0068867_100000852
539 Ga0070706_100011276
540 Ga0070707_100014787
541 Ga0070679_100018413
542 Ga0070679_100022509
543 Ga0070679_100273660
544 Ga0068853_100007576
545 Ga0070696_100011483
546 Ga0070665_100000010
547 Ga0070665_100084628
548 Ga0070704_100008443
549 Ga0068855_100000631
550 Ga0068855_100001701
551 Ga0068855_100013731
552 Ga0068855_100024159
553 Ga0068857_100014194
554 Ga0068856_100000030
555 Ga0068856_100002703
556 Ga0068856_100037042
557 Ga0068864_100032786
558 Ga0068866_10012303
559 Ga0068866_10050649
560 Ga0068863_100026789
561 Ga0068858_100074153
562 Ga0068860_100008525
563 Ga0075366_10002946
564 Ga0097621_100001053
565 Ga0097621_100001956
566 Ga0068871_100000109
567 Ga0068865_100000079
568 Ga0068865_100057333
569 Ga0099795_10000034
570 Ga0105240_10000128
571 Ga0105240_10001477
572 Ga0105240_10027264
573 Ga0105240_10033682
574 Ga0105240_10143513
575 Ga0105245_10007223
576 Ga0105247_10029255
577 Ga0105243_10000009
578 Ga0105243_10019690
579 Ga0105243_10035109
580 Ga0105243_10165720
581 Ga0105241_10001015
582 Ga0105241_10014824
583 Ga0105241_10133858
584 Ga0105242_10018964
585 Ga0105242_10020601
586 Ga0105242_10065006
587 Ga0105242_10077525
588 Ga0105242_10104699
589 Ga0105248_10036920
590 Ga0105237_10000713
591 Ga0105237_10001681
592 Ga0105237_10003226
593 Ga0105237_10010902
594 Ga0105237_10027313
595 Ga0105237_10032126
596 Ga0105237_10041568
597 Ga0105238_10007790
598 Ga0105238_10203895
599 Ga0099796_10000049
600 Ga0105239_10000011
601 Ga0105239_10000392
602 Ga0105239_10001249
603 Ga0105239_10003944
604 Ga0105239_10004273
605 Ga0105239_10005554
606 Ga0105239_10214347
607 Ga0157373_10000115
608 Ga0157373_10003087
609 Ga0157373_10003093
610 Ga0157373_10018401
611 Ga0157373_10138790
612 Ga0157371_10001176
613 Ga0157371_10005754
614 Ga0157371_10008441
615 Ga0157371_10013384
616 Ga0157371_10013891
617 Ga0157370_10002405
618 Ga0157370_10003392
619 Ga0157370_10019162
620 Ga0157370_10022798
621 Ga0157370_10024814
622 Ga0157370_10035113
623 Ga0157370_10037895
624 Ga0157370_10104762
625 Ga0157370_10112109
626 Ga0157369_10000016
627 Ga0157369_10005273
628 Ga0157369_10144705
629 Ga0157374_10000258
630 Ga0157374_10003809
631 Ga0157374_10008551
632 Ga0157378_10002371
633 Ga0157378_10003207
634 Ga0157378_10039852
635 Ga0157378_10049370
636 Ga0157378_10329949
637 Ga0163162_10000005
638 Ga0163162_10013733
639 Ga0163162_10057754
640 Ga0157372_10000026
641 Ga0157372_10001115
642 Ga0157372_10001737
643 Ga0157372_10004698
644 Ga0157372_10087795
645 Ga0157372_10143188
646 Ga0157375_10019342
647 Ga0163163_10012355
648 Ga0182008_10000014
649 Ga0182008_10000932
650 Ga0182008_10001241
651 Ga0182008_10006343
652 Ga0182008_10024565
653 Ga0157376_10004563
654 Ga0182006_1000258
655 Ga0182006_1001127
656 Ga0182006_1007803
657 Ga0182007_10000002
658 Ga0182007_10003077
659 Ga0182007_10012583
660 Ga0182007_10013350
661 Ga0183373_1004
662 Ga0163161_10000347
663 Ga0163161_10001290
664 Ga0163161_10002101
665 Ga0163161_10003196
666 Ga0163161_10038624
667 Ga0163161_10054942
668 Ga0207427_100210
669 Ga0209437_100021
670 Ga0209437_100251
671 Ga0207425_1000002
672 Ga0209026_1000943
673 Ga0209026_1001240
674 Ga0209129_1000002
675 Ga0209233_1000035
676 Ga0209233_1000482
677 Ga0209455_1000741
678 Ga0209675_1020495
679 Ga0209676_1000009
680 Ga0209025_1000004
681 Ga0209758_1000006
682 Ga0209050_1000048
683 Ga0207653_10000285
684 Ga0207642_10032183
685 Ga0207710_10046824
686 Ga0207680_10004601
687 Ga0207647_10000044
688 Ga0207647_10000431
689 Ga0207645_10000135
690 Ga0207705_10000142
691 Ga0207684_10000078
692 Ga0207654_10000191
693 Ga0207654_10004366
694 Ga0207654_10007426
695 Ga0207707_10010880
696 Ga0207695_10000179
697 Ga0207695_10002745
698 Ga0207695_10043825
699 Ga0207695_10048667
700 Ga0207671_10000948
701 Ga0207671_10002949
702 Ga0207671_10004197
703 Ga0207671_10014945
704 Ga0207671_10022468
705 Ga0207693_10039863
706 Ga0207657_10165407
707 Ga0207649_10035242
708 Ga0207652_10015818
709 Ga0207652_10039708
710 Ga0207646_10001252
711 Ga0207646_10200777
712 Ga0207694_10025702
713 Ga0207694_10147051
714 Ga0207644_10009772
715 Ga0207690_10000351
716 Ga0207706_10000173
717 Ga0207686_10059636
718 Ga0207709_10000026
719 Ga0207709_10009698
720 Ga0207704_10000019
721 Ga0207711_10003881
722 Ga0207689_10188890
723 Ga0207661_10202345
724 Ga0207667_10000030
725 Ga0207667_10000218
726 Ga0207667_10011112
727 Ga0207667_10013873
728 Ga0207667_10015128
729 Ga0207667_10028328
730 Ga0207667_10033359
731 Ga0207667_10069079
732 Ga0207651_10003044
733 Ga0207640_10003804
734 Ga0207677_10015964
735 Ga0207677_10027281
736 Ga0207703_10002324
737 Ga0207639_10042961
738 Ga0207639_10113084
739 Ga0207639_10135609
740 Ga0207678_10021189
741 Ga0207702_10001383
742 Ga0207702_10028200
743 Ga0207641_10209351
744 Ga0207648_10000061
745 Ga0207676_10053061
746 Ga0207683_10002822
747 Ga0209179_1000027
748 Ga0268266_10000032
749 Ga0307517_10000640
750 Ga0307515_10002716
751 Ga0307515_10017577
752 Ga0307515_10018541
753 Ga0307515_10191099
754 Ga0265338_10006311
755 Ga0265338_10024117
756 Ga0265338_10063557
757 Ga0265338_10069960
758 Ga0268256_1004720
759 Ga0316183_1046861
760 Ga0316181_1079882
761 Ga0265340_10029943
762 Ga0265327_10003330
763 Ga0265327_10008974
764 Ga0265327_10042075
765 Ga0307509_10031891
766 Ga0307408_100000324
767 Ga0307408_100020325
768 Ga0307408_100049562
769 Ga0307405_10000006
770 Ga0307407_10000075
771 Ga0307412_10000827
772 Ga0307412_10033931
773 Ga0307412_10041772
774 Ga0307409_100011023
775 Ga0307416_100000002
776 Ga0307414_10004624
777 Ga0307414_10010138
778 Ga0307414_10014891
779 Ga0307414_10039826
780 Ga0307414_10205637
781 Ga0307507_10000034
782 Ga0307510_10005665
783 Ga0373937_0068517
784 Ga0373937_0250212
785 Ga0395899_0000011
786 Ga0395899_0000025
787 Ga0395899_0000055
788 Ga0395899_0000563
789 Ga0395900_0000173
790 Ga0395900_0001545
791 Ga0395900_0035437
792 Ga0395900_0103932
793 Ga0395900_0413957
794 Ga0395898_0005193
795 Ga0395905_0000001
796 Ga0395905_0000779
797 Ga0395905_0001821
798 Ga0395905_0003424
799 Ga0395905_0004928
800 Ga0395905_0039675
801 Ga0395905_0048862
802 Ga0395901_0006218
803 Ga0395901_0020679
804 Ga0395901_0043624
805 Ga0395901_0111729
806 Ga0395901_0128587
807 Ga0439448_0003865
808 Ga0451577_0000213
809 Ga0451577_0028735
810 Ga0451577_0081370
811 Ga0451577_0109743
812 Ga0453683_0011991
813 Ga0453683_0120503
814 Ga0466966_0058270
815 Ga0453684_0002500
816 Ga0453684_0091888
817 Ga0453684_0248173
818 Ga0453684_0280650
819 Ga0451576_0000002
820 Ga0451576_0033134
821 Ga0451576_0294584
822 Ga0466958_0014767
823 Ga0495603_0003242
824 Ga0495603_0055292
825 Ga0495591_022492
826 Ga0495629_0117416
827 Ga0495650_0000447
828 Ga0495580_0075136
829 Ga0495585_0000116
830 Ga0495585_0000596
831 Ga0495594_0107800
832 Ga0495596_0007857
833 Ga0495583_0016097
834 Ga0495606_0000844
835 Ga0495606_0030120
836 Ga0495610_0000099
837 Ga0495610_0002563
838 Ga0495610_0002995
839 Ga0495616_0006153
840 Ga0495644_0044246
841 Ga0495609_0007074
842 Ga0495609_0026385
843 Ga0495621_0000057
844 Ga0495633_0000021
845 Ga0495633_0003971
846 Ga0495668_0000165
847 Ga0495625_0000907
848 Ga0495625_0000972
849 Ga0495625_0027806
850 Ga0495661_0000341
851 Ga0495588_0035791
852 Ga0495647_0001761
853 Ga0495658_0005011
854 Ga0495649_0000014
855 Ga0495649_0014284
856 Ga0495683_0025426
857 Ga0495687_001057
858 Ga0495687_005260
859 Ga0495673_0053516
860 Ga0495681_0045705
861 Ga0495686_0000913
862 Ga0495686_0001318
863 Ga0495686_0015517
864 Ga0495686_0037993
865 Ga0495686_0042805
866 Ga0495614_0060498
867 Ga0496101_0007581
868 Ga0496104_0034585
869 Ga0496105_0002145
870 Ga0496106_0002978
871 Ga0496108_0021926
872 Ga0496109_0055722
873 Ga0496116_0022816
874 Ga0496116_0022843
875 Ga0496117_0011076
876 Ga0496122_0002491
877 Ga0496122_0092725
878 Ga0496123_0005145
879 Ga0496123_0102798
880 Ga0496124_0102864
881 Ga0496125_0237768
882 Ga0496126_0055631
883 Ga0495678_006175
884 Ga0495682_0072652
885 Ga0501032_0026240
886 Ga0501037_0000732
887 Ga0501037_0055451
888 Ga0501038_0001222
889 Ga0501038_0239254
890 Ga0501042_0080292
891 Ga0501046_0073727
892 Ga0501046_0079017
893 Ga0501047_0190045
894 Ga0501070_0002248
895 Ga0501070_0026653
896 Ga0501070_0082398
897 Ga0501071_0021897
898 Ga0501074_0000076
899 Ga0501075_0049670
900 Ga0501076_0035959
901 Ga0501223_002508
902 Ga0501080_0012965
903 Ga0501081_0018433
904 Ga0501241_005478
905 nmdc:mga0k408_237_c1
906 nmdc:mga0k408_49719_c1
907 nmdc:mga0a205_92552_c1
908 Ga0500635_0001928
909 Ga0500643_000810
910 Ga0500651_0000182
911 Ga0500608_000555
912 Ga0500608_008573
913 Ga0500618_000027
914 Ga0500642_0002544
915 Ga0500579_096933
916 Ga0500622_0000440
917 Ga0530510_0028705
918 Ga0530510_0038128
919 2586208089
920 2599479322
921 2722726247
922 2738756866
923 2738760124
924 2738856575
925 2739304992
926 2739588119
927 2739616213
928 2739646874
929 2776612108
930 2819546018
931 2819568656
932 2831906619
933 2842724085
934 2842908822
935 2842912183
936 2849282400
937 2852625364
938 2852631728
939 2857631315
940 2881645078
941 2884934376
942 2890739311
943 2890806768
944 2895501544
945 2896320770
946 2896346846
947 2898713478
948 2902052387
949 2904446276
950 2904782851
951 2919180462
952 2919191430
953 2919418229
954 2919438039
955 2928082368
956 2928149051
957 2932088406
958 2936362019
959 2939669651
960 2945999102
961 2954021551
962 2964379234
963 2977233888
964 2977256396
965 3003234849
966 8055591252

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

76

472

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hp1-assembly1.cif.gz_B inter-subunit signaling in gsam 0.9725 26 452
2hoy-assembly1.cif.gz_B inter-subunit signaling in gsam 0.972 26 450
2hoz-assembly1.cif.gz_B inter-subunit signaling in gsam 0.9718 26 452
2hoy-assembly1.cif.gz_A inter-subunit signaling in gsam 0.9717 26 450
5i92-assembly2.cif.gz_D crystal structure of glutamate-1-semialdehyde 2,1- aminomutase (gsa) from pseudomonas aeruginosa 0.9686 30 452
ID Description Score Start End Superfamily
af_Q58020_48_419_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9647 74 446 3.40.640.10
2epjA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9606 97 342 3.40.640.10
af_Q58020_48_419_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9596 74 446 3.40.640.10
af_P9WMN9_84_347_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9596 98 341 3.40.640.10
5i92D01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9505 30 452 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A4Q3BAK0-F1-model_v4 deleted 0.9904 86 455
AF-A0A3C0ZBN6-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase (GSA) (EC 5.4.3.8) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT) 0.9884 24 455 GO:0005737
GO:0006782
GO:0008483
GO:0030170
GO:0042286
AF-A0A2U2PCM3-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase (GSA) (EC 5.4.3.8) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT) 0.9866 23 453 GO:0005737
GO:0006782
GO:0008483
GO:0030170
GO:0042286
AF-A0A7V4YUB3-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9854 151 454 GO:0008483
GO:0030170
AF-A0A4Q3BAK0-F1-model_v4 deleted 0.9824 86 455

Map