F452796

General Info

Members Datasets Scaffolds Average Seq Length
483 246 483 206

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100356427|Ga0307408_1003564272
Length 255
Sequence VSDEVQGYGASAGRDGGDHGRADPDEQGKRRRVQTDAPEQSPADDPHARLDVAVNSPGREGLTGTTPSNIYKPLPDREQVTIPPDGRPLHYQPQWRKDFPIDWPQDHYVTRRDFTKFLTLTSFAFVVGQLWIGAQNLWRRGRGKPPLRKIASLAALPVGGIVQFDYPGEHDSCILVRLGPGPDDVVAYGQKCTHLSCAVIPQFDKGRIHCPCHEGHFHLATGEVLAGPPPRPLPRILLERRGDDIYATGIEWRTV

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
170 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
175 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
176 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 2.07
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10081967 3300005290 Bacteria 2959
2 Ga0065712_10365430 3300005290 Unclassified 770
3 Ga0065715_10095063 3300005293 Bacteria 4176
4 Ga0070676_10020433 3300005328 Bacteria 3696
5 Ga0070676_10028078 3300005328 Bacteria 3195
6 Ga0070690_100017159 3300005330 Bacteria 4348
7 Ga0070690_100413006 3300005330 Unclassified 993
8 Ga0070670_100048541 3300005331 Bacteria 3653
9 Ga0070670_100129959 3300005331 Bacteria 2175
10 Ga0070670_100230423 3300005331 Bacteria 1612
11 Ga0070670_100441771 3300005331 Bacteria 1152
12 Ga0070677_10096110 3300005333 Bacteria 1297
13 Ga0068869_101049686 3300005334 Unclassified 711
14 Ga0070682_100068558 3300005337 Bacteria 2263
15 Ga0068868_100486694 3300005338 Unclassified 1079
16 Ga0068868_101016352 3300005338 Bacteria 759
17 Ga0070660_100191928 3300005339 Bacteria 1655
18 Ga0070689_100015138 3300005340 Bacteria 5619
19 Ga0070689_100269747 3300005340 Bacteria 1409
20 Ga0070689_100397536 3300005340 Bacteria 1164
21 Ga0070689_100424819 3300005340 Unclassified 1127
22 Ga0070689_100563450 3300005340 Bacteria 983
23 Ga0070691_10001764 3300005341 Bacteria 9412
24 Ga0070691_10031943 3300005341 Bacteria 2471
25 Ga0070687_100157151 3300005343 Bacteria 1340
26 Ga0070687_100287408 3300005343 Bacteria 1038
27 Ga0070661_100000811 3300005344 Bacteria 22454
28 Ga0070661_100180439 3300005344 Bacteria 1606
29 Ga0070669_100082767 3300005353 Bacteria 2393
30 Ga0070669_100429382 3300005353 Unclassified 1086
31 Ga0070675_100000389 3300005354 Bacteria 29768
32 Ga0070675_100139050 3300005354 Bacteria 2075
33 Ga0070675_100272722 3300005354 Bacteria 1485
34 Ga0070675_100810955 3300005354 Bacteria 856
35 Ga0070671_100010640 3300005355 Bacteria 7383
36 Ga0070671_100068315 3300005355 Bacteria 2964
37 Ga0070674_100130733 3300005356 Bacteria 1871
38 Ga0070673_100000749 3300005364 Bacteria 18022
39 Ga0070673_100131582 3300005364 Bacteria 2100
40 Ga0070673_100164624 3300005364 Bacteria 1888
41 Ga0070688_100006574 3300005365 Bacteria 6221
42 Ga0070688_100116383 3300005365 Bacteria 1785
43 Ga0070688_100349609 3300005365 Bacteria 1082
44 Ga0070688_100723552 3300005365 Unclassified 773
45 Ga0070659_100107164 3300005366 Bacteria 2253
46 Ga0070667_100173051 3300005367 Bacteria 1907
47 Ga0070667_100302778 3300005367 Bacteria 1440
48 Ga0070667_100711079 3300005367 Unclassified 930
49 Ga0070703_10000339 3300005406 Bacteria 20813
50 Ga0070714_100005531 3300005435 Bacteria 9649
51 Ga0070714_100209508 3300005435 Unclassified 1786
52 Ga0070705_100028130 3300005440 Bacteria 3076
53 Ga0070705_100055886 3300005440 Bacteria 2322
54 Ga0070705_100460003 3300005440 Unclassified 957
55 Ga0070700_100008636 3300005441 Bacteria 5553
56 Ga0070700_100010235 3300005441 Bacteria 5174
57 Ga0070700_101030836 3300005441 Bacteria 678
58 Ga0070694_100000585 3300005444 Bacteria 20123
59 Ga0070694_100099854 3300005444 Bacteria 2052
60 Ga0070708_100000508 3300005445 Bacteria 29318
61 Ga0070678_100166440 3300005456 Bacteria 1791
62 Ga0070662_100242731 3300005457 Bacteria 1445
63 Ga0070681_10482134 3300005458 Bacteria 1153
64 Ga0068867_100014650 3300005459 Bacteria 5557
65 Ga0068867_100103135 3300005459 Bacteria 2181
66 Ga0068867_100254628 3300005459 Bacteria 1429
67 Ga0070685_10226653 3300005466 Bacteria 1227
68 Ga0070685_10384236 3300005466 Unclassified 968
69 Ga0070706_100004927 3300005467 Bacteria 12777
70 Ga0070706_101134606 3300005467 Unclassified 719
71 Ga0070707_100607673 3300005468 Bacteria 1056
72 Ga0070698_100012336 3300005471 Bacteria 9049
73 Ga0070698_100627878 3300005471 Bacteria 1015
74 Ga0070699_100001427 3300005518 Bacteria 21970
75 Ga0070679_100115205 3300005530 Bacteria 2673
76 Ga0070679_100885821 3300005530 Bacteria 836
77 Ga0070697_100032588 3300005536 Bacteria 4194
78 Ga0068853_100763931 3300005539 Bacteria 924
79 Ga0070672_100075300 3300005543 Bacteria 2694
80 Ga0070672_100192159 3300005543 Bacteria 1705
81 Ga0070672_100603670 3300005543 Unclassified 956
82 Ga0070686_100027149 3300005544 Bacteria 3463
83 Ga0070686_100196893 3300005544 Bacteria 1442
84 Ga0070686_100245238 3300005544 Bacteria 1306
85 Ga0070686_100487121 3300005544 Unclassified 955
86 Ga0070695_100201203 3300005545 Bacteria 1424
87 Ga0070695_100348907 3300005545 Unclassified 1108
88 Ga0070696_100057800 3300005546 Bacteria 2707
89 Ga0070696_100312672 3300005546 Bacteria 1206
90 Ga0070693_100009557 3300005547 Bacteria 4823
91 Ga0070665_100010950 3300005548 Bacteria 9172
92 Ga0070704_100009220 3300005549 Bacteria 5952
93 Ga0070704_100341386 3300005549 Bacteria 1261
94 Ga0068855_100034080 3300005563 Bacteria 6075
95 Ga0068855_100312688 3300005563 Bacteria 1738
96 Ga0068855_100472171 3300005563 Bacteria 1366
97 Ga0068855_100479867 3300005563 Unclassified 1353
98 Ga0068855_100719476 3300005563 Unclassified 1067
99 Ga0070664_100002095 3300005564 Bacteria 15937
100 Ga0070664_100089314 3300005564 Bacteria 2666
101 Ga0068857_100169430 3300005577 Bacteria 1984
102 Ga0068857_100270718 3300005577 Bacteria 1561
103 Ga0068857_100318437 3300005577 Bacteria 1436
104 Ga0068857_100433770 3300005577 Unclassified 1227
105 Ga0068854_100028438 3300005578 Bacteria 3863
106 Ga0068854_100120814 3300005578 Bacteria 1989
107 Ga0068854_100177142 3300005578 Bacteria 1663
108 Ga0068856_100336965 3300005614 Unclassified 1526
109 Ga0070702_100019667 3300005615 Bacteria 3527
110 Ga0068852_100029482 3300005616 Bacteria 4509
111 Ga0068852_100110217 3300005616 Bacteria 2501
112 Ga0068852_100647327 3300005616 Bacteria 1064
113 Ga0068859_100004031 3300005617 Bacteria 14977
114 Ga0068859_100095744 3300005617 Bacteria 3021
115 Ga0068859_100280079 3300005617 Bacteria 1760
116 Ga0068859_100936648 3300005617 Bacteria 950
117 Ga0068859_101021336 3300005617 Unclassified 908
118 Ga0068864_100506148 3300005618 Bacteria 1163
119 Ga0068864_101232700 3300005618 Unclassified 747
120 Ga0068866_10013391 3300005718 Bacteria 3598
121 Ga0068866_10245501 3300005718 Unclassified 1093
122 Ga0068861_100010652 3300005719 Bacteria 6385
123 Ga0068861_100549194 3300005719 Bacteria 1052
124 Ga0068861_100569995 3300005719 Bacteria 1035
125 Ga0068861_100789061 3300005719 Unclassified 890
126 Ga0068870_10222047 3300005840 Bacteria 1157
127 Ga0068863_100064197 3300005841 Bacteria 3473
128 Ga0068863_100271839 3300005841 Bacteria 1641
129 Ga0068858_100088009 3300005842 Bacteria 2889
130 Ga0068860_100029980 3300005843 Bacteria 5232
131 Ga0068860_100307052 3300005843 Bacteria 1555
132 Ga0068860_100383367 3300005843 Bacteria 1388
133 Ga0068860_100460339 3300005843 Bacteria 1265
134 Ga0068862_100024038 3300005844 Bacteria 5109
135 Ga0068862_100213300 3300005844 Bacteria 1745
136 Ga0068862_100238207 3300005844 Bacteria 1653
137 Ga0081538_10012338 3300005981 Bacteria 6852
138 Ga0075368_10104942 3300006042 Bacteria 1162
139 Ga0075363_100260510 3300006048 Unclassified 1000
140 Ga0075364_10064337 3300006051 Bacteria 2407
141 Ga0075362_10001619 3300006177 Bacteria 7297
142 Ga0075367_10010192 3300006178 Bacteria 4927
143 Ga0075366_10000100 3300006195 Bacteria 34958
144 Ga0097621_100011130 3300006237 Bacteria 6618
145 Ga0075370_10009355 3300006353 Bacteria 5085
146 Ga0075428_100016776 3300006844 Bacteria 8087
147 Ga0075428_100122047 3300006844 Bacteria 2837
148 Ga0075428_100232664 3300006844 Bacteria 1989
149 Ga0075428_100256045 3300006844 Bacteria 1885
150 Ga0075428_100280631 3300006844 Bacteria 1792
151 Ga0075428_100614952 3300006844 Bacteria 1160
152 Ga0075430_100020048 3300006846 Bacteria 5692
153 Ga0075430_100035132 3300006846 Bacteria 4254
154 Ga0075430_100246537 3300006846 Bacteria 1480
155 Ga0075431_100070494 3300006847 Bacteria 3607
156 Ga0075431_100136056 3300006847 Bacteria 2533
157 Ga0075431_100566068 3300006847 Bacteria 1123
158 Ga0075433_10023993 3300006852 Bacteria 5142
159 Ga0075434_100062375 3300006871 Bacteria 3710
160 Ga0075434_100064690 3300006871 Bacteria 3642
161 Ga0075434_100162228 3300006871 Bacteria 2255
162 Ga0075429_100036403 3300006880 Bacteria 4281
163 Ga0075429_100066680 3300006880 Bacteria 3134
164 Ga0075429_100074842 3300006880 Bacteria 2950
165 Ga0075429_100242918 3300006880 Bacteria 1577
166 Ga0075429_100413147 3300006880 Bacteria 1182
167 Ga0068865_100269344 3300006881 Unclassified 1352
168 Ga0097620_100004031 3300006931 Bacteria 14977
169 Ga0097620_100095746 3300006931 Bacteria 3021
170 Ga0097620_100280077 3300006931 Bacteria 1760
171 Ga0097620_100936641 3300006931 Bacteria 950
172 Ga0097620_101021503 3300006931 Unclassified 908
173 Ga0075435_100006983 3300007076 Bacteria 8016
174 Ga0075435_100014420 3300007076 Bacteria 5906
175 Ga0075435_100079465 3300007076 Bacteria 2692
176 Ga0075435_100107132 3300007076 Bacteria 2321
177 Ga0105240_10176216 3300009093 Bacteria 2528
178 Ga0105240_10219420 3300009093 Bacteria 2216
179 Ga0111539_10000732 3300009094 Bacteria 42670
180 Ga0111539_10018934 3300009094 Bacteria 8514
181 Ga0111539_10022531 3300009094 Bacteria 7737
182 Ga0111539_10143646 3300009094 Bacteria 2793
183 Ga0111539_10212649 3300009094 Bacteria 2253
184 Ga0111539_11466047 3300009094 Unclassified 791
185 Ga0105245_10044318 3300009098 Bacteria 3970
186 Ga0105245_10983985 3300009098 Unclassified 887
187 Ga0114129_10147659 3300009147 Unclassified 3220
188 Ga0105243_10000629 3300009148 Bacteria 35046
189 Ga0105243_10277391 3300009148 Bacteria 1508
190 Ga0105242_10000849 3300009176 Bacteria 23661
191 Ga0105248_10011673 3300009177 Bacteria 9680
192 Ga0105248_10119321 3300009177 Bacteria 2975
193 Ga0105248_10341786 3300009177 Bacteria 1685
194 Ga0105248_10514327 3300009177 Bacteria 1350
195 Ga0105248_10859863 3300009177 Unclassified 1024
196 Ga0105237_10000919 3300009545 Bacteria 39583
197 Ga0105249_10055707 3300009553 Bacteria 3618
198 Ga0105249_10127420 3300009553 Bacteria 2426
199 Ga0105249_10979740 3300009553 Unclassified 914
200 Ga0105239_10210855 3300010375 Bacteria 2177
201 Ga0105246_10681295 3300011119 Unclassified 899
202 Ga0157370_10026930 3300013104 Bacteria 5670
203 Ga0157370_10105679 3300013104 Bacteria 2635
204 Ga0157370_10282005 3300013104 Bacteria 1535
205 Ga0157369_10300130 3300013105 Bacteria 1671
206 Ga0157369_10349668 3300013105 Bacteria 1535
207 Ga0157369_10454463 3300013105 Bacteria 1326
208 Ga0157369_10507383 3300013105 Bacteria 1248
209 Ga0157374_10609885 3300013296 Unclassified 1102
210 Ga0157378_10293046 3300013297 Bacteria 1572
211 Ga0163162_10251394 3300013306 Bacteria 1900
212 Ga0163162_10321618 3300013306 Bacteria 1679
213 Ga0157372_10043530 3300013307 Bacteria 4971
214 Ga0157372_10070680 3300013307 Bacteria 3928
215 Ga0157372_10967853 3300013307 Unclassified 986
216 Ga0157372_11259701 3300013307 Unclassified 854
217 Ga0157372_11320455 3300013307 Unclassified 832
218 Ga0157375_10285540 3300013308 Bacteria 1813
219 Ga0157375_10401453 3300013308 Bacteria 1537
220 Ga0157375_10549189 3300013308 Bacteria 1317
221 Ga0157375_10856102 3300013308 Bacteria 1055
222 Ga0163163_10154709 3300014325 Bacteria 2337
223 Ga0163163_10435818 3300014325 Unclassified 1370
224 Ga0163163_10645656 3300014325 Bacteria 1122
225 Ga0157380_10070543 3300014326 Bacteria 2823
226 Ga0157380_10188365 3300014326 Bacteria 1819
227 Ga0157380_10446739 3300014326 Bacteria 1240
228 Ga0157380_11212168 3300014326 Bacteria 799
229 Ga0182008_10089238 3300014497 Bacteria 1519
230 Ga0157377_10366707 3300014745 Bacteria 971
231 Ga0206350_10799874 3300020080 Unclassified 1286
232 Ga0207653_10000371 3300025885 Bacteria 21042
233 Ga0207642_10106483 3300025899 Bacteria 1419
234 Ga0207688_10168438 3300025901 Bacteria 1302
235 Ga0207680_10585769 3300025903 Unclassified 797
236 Ga0207647_10119965 3300025904 Bacteria 1551
237 Ga0207645_10005699 3300025907 Bacteria 8998
238 Ga0207645_10012483 3300025907 Bacteria 5761
239 Ga0207643_10110742 3300025908 Bacteria 1618
240 Ga0207705_10053972 3300025909 Bacteria 2896
241 Ga0207684_10029016 3300025910 Unclassified 4712
242 Ga0207654_10028636 3300025911 Bacteria 3038
243 Ga0207707_10335679 3300025912 Bacteria 1304
244 Ga0207695_10002596 3300025913 Bacteria 26488
245 Ga0207671_10000120 3300025914 Bacteria 120786
246 Ga0207663_10000020 3300025916 Bacteria 137200
247 Ga0207662_10001028 3300025918 Bacteria 13053
248 Ga0207662_10096495 3300025918 Bacteria 1826
249 Ga0207662_10121406 3300025918 Bacteria 1639
250 Ga0207649_10003405 3300025920 Bacteria 8692
251 Ga0207649_10212241 3300025920 Bacteria 1374
252 Ga0207652_10008447 3300025921 Bacteria 8284
253 Ga0207646_10693937 3300025922 Bacteria 910
254 Ga0207646_10718615 3300025922 Unclassified 893
255 Ga0207681_10090380 3300025923 Bacteria 2185
256 Ga0207681_10100492 3300025923 Bacteria 2085
257 Ga0207681_10782736 3300025923 Unclassified 796
258 Ga0207650_10050073 3300025925 Bacteria 3087
259 Ga0207650_10081286 3300025925 Bacteria 2458
260 Ga0207650_10085863 3300025925 Bacteria 2395
261 Ga0207659_10000080 3300025926 Bacteria 60332
262 Ga0207659_10086616 3300025926 Bacteria 2330
263 Ga0207659_10121086 3300025926 Bacteria 2005
264 Ga0207659_10721135 3300025926 Bacteria 854
265 Ga0207664_10139265 3300025929 Bacteria 2051
266 Ga0207644_10088344 3300025931 Unclassified 2305
267 Ga0207644_10313168 3300025931 Bacteria 1267
268 Ga0207690_10172695 3300025932 Bacteria 1621
269 Ga0207690_10639025 3300025932 Bacteria 871
270 Ga0207686_10000039 3300025934 Bacteria 126792
271 Ga0207686_10018260 3300025934 Bacteria 3969
272 Ga0207709_10000192 3300025935 Bacteria 81277
273 Ga0207670_10123155 3300025936 Unclassified 1888
274 Ga0207670_10176706 3300025936 Unclassified 1605
275 Ga0207670_10821205 3300025936 Unclassified 775
276 Ga0207704_10354383 3300025938 Unclassified 1143
277 Ga0207704_10718283 3300025938 Bacteria 829
278 Ga0207691_10082925 3300025940 Bacteria 2879
279 Ga0207691_10212179 3300025940 Bacteria 1681
280 Ga0207691_10385075 3300025940 Bacteria 1197
281 Ga0207711_10008173 3300025941 Bacteria 8759
282 Ga0207711_10051954 3300025941 Bacteria 3511
283 Ga0207711_10445140 3300025941 Bacteria 1206
284 Ga0207711_10582269 3300025941 Bacteria 1044
285 Ga0207689_10197230 3300025942 Bacteria 1662
286 Ga0207679_10003018 3300025945 Bacteria 10433
287 Ga0207679_10059517 3300025945 Bacteria 2834
288 Ga0207667_10024393 3300025949 Bacteria 6640
289 Ga0207667_10182646 3300025949 Bacteria 2153
290 Ga0207651_10000043 3300025960 Bacteria 59486
291 Ga0207651_10000742 3300025960 Bacteria 13984
292 Ga0207651_10133680 3300025960 Bacteria 1904
293 Ga0207651_10272376 3300025960 Bacteria 1395
294 Ga0207651_10371221 3300025960 Bacteria 1210
295 Ga0207712_10074634 3300025961 Bacteria 2449
296 Ga0207640_10058212 3300025981 Bacteria 2545
297 Ga0207640_10231941 3300025981 Bacteria 1421
298 Ga0207640_10543034 3300025981 Bacteria 975
299 Ga0207658_10822449 3300025986 Unclassified 844
300 Ga0207703_10066486 3300026035 Bacteria 2965
301 Ga0207703_10076448 3300026035 Bacteria 2777
302 Ga0207708_10007480 3300026075 Bacteria 8072
303 Ga0207708_10195689 3300026075 Bacteria 1611
304 Ga0207708_11010918 3300026075 Bacteria 723
305 Ga0207702_10400526 3300026078 Bacteria 1323
306 Ga0207641_10172698 3300026088 Bacteria 1974
307 Ga0207641_10206350 3300026088 Bacteria 1815
308 Ga0207648_10009113 3300026089 Bacteria 9540
309 Ga0207648_10026336 3300026089 Bacteria 5169
310 Ga0207648_10113187 3300026089 Bacteria 2383
311 Ga0207648_11578240 3300026089 Unclassified 617
312 Ga0207676_10043806 3300026095 Bacteria 3448
313 Ga0207674_10189743 3300026116 Bacteria 2005
314 Ga0207674_10318495 3300026116 Bacteria 1505
315 Ga0207675_100057364 3300026118 Bacteria 3633
316 Ga0207675_100261829 3300026118 Bacteria 1676
317 Ga0207683_10222713 3300026121 Bacteria 1719
318 Ga0207683_10346761 3300026121 Bacteria 1362
319 Ga0207698_10115319 3300026142 Bacteria 2262
320 Ga0207698_10184647 3300026142 Bacteria 1851
321 Ga0209971_1022578 3300027682 Bacteria 1499
322 Ga0209813_10050951 3300027866 Bacteria 1293
323 Ga0207428_10000601 3300027907 Bacteria 42555
324 Ga0207428_10004578 3300027907 Bacteria 13102
325 Ga0207428_10025538 3300027907 Bacteria 4945
326 Ga0207428_10035629 3300027907 Bacteria 4066
327 Ga0207428_10051568 3300027907 Bacteria 3289
328 Ga0207428_10259467 3300027907 Bacteria 1294
329 Ga0268266_10099462 3300028379 Bacteria 2560
330 Ga0268265_10007072 3300028380 Bacteria 7585
331 Ga0268265_10169004 3300028380 Bacteria 1866
332 Ga0268265_10724647 3300028380 Unclassified 963
333 Ga0268264_10031212 3300028381 Bacteria 4369
334 Ga0268264_10299233 3300028381 Bacteria 1514
335 Ga0268264_10675408 3300028381 Bacteria 1024
336 Ga0265334_10088355 3300028573 Bacteria 1134
337 Ga0307408_100356427 3300031548 Bacteria 1243
338 Ga0307405_10504912 3300031731 Bacteria 970
339 Ga0307413_10068735 3300031824 Bacteria 2220
340 Ga0307410_10164825 3300031852 Bacteria 1664
341 Ga0307410_10204716 3300031852 Bacteria 1509
342 Ga0307406_10015500 3300031901 Bacteria 4413
343 Ga0307406_10499374 3300031901 Unclassified 986
344 Ga0307407_10079523 3300031903 Bacteria 1978
345 Ga0307409_100011665 3300031995 Bacteria 5555
346 Ga0307409_100035367 3300031995 Bacteria 3660
347 Ga0307409_100438292 3300031995 Bacteria 1258
348 Ga0307409_100466756 3300031995 Bacteria 1222
349 Ga0307416_100676635 3300032002 Bacteria 1119
350 Ga0307411_10080593 3300032005 Bacteria 2239
351 Ga0307415_100213510 3300032126 Bacteria 1541
352 Ga0373948_0006201 3300034817 Bacteria 1969
353 Ga0373950_0041394 3300034818 Unclassified 883
354 Ga0373949_0082047 3300035090 Unclassified 861
355 Ga0373933_0108114 3300035724 Bacteria 1732
356 Ga0373937_0019343 3300036401 Bacteria 6094
357 Ga0373937_0062585 3300036401 Bacteria 3421
358 Ga0373937_0330816 3300036401 Bacteria 1442
359 Ga0450920_004091 3300042122 Bacteria 2553
360 Ga0450895_000570 3300042132 Bacteria 2194
361 Ga0450896_015208 3300042133 Bacteria 1101
362 Ga0439435_0009020 3300042436 Bacteria 2330
363 Ga0451577_0029001 3300042876 Bacteria 5004
364 Ga0453684_0570270 3300044712 Unclassified 1244
365 Ga0453684_1012005 3300044712 Unclassified 883
366 Ga0451576_0369379 3300045051 Bacteria 1503
367 Ga0466967_0550101 3300045976 Bacteria 1136
368 Ga0495603_0129208 3300046455 Bacteria 1472
369 Ga0495652_0511464 3300046529 Unclassified 831
370 Ga0495645_0201425 3300046543 Bacteria 1350
371 Ga0495659_0010397 3300046664 Bacteria 2985
372 Ga0495613_0134204 3300046689 Archaea 1772
373 Ga0495613_0390517 3300046689 Bacteria 950
374 Ga0495581_0161880 3300047315 Bacteria 1308
375 Ga0495675_0206808 3300047444 Bacteria 1193
376 Ga0495684_0014303 3300047471 Bacteria 6109
377 Ga0495602_0629458 3300048088 Bacteria 735
378 Ga0496106_0147025 3300048909 Bacteria 1857
379 Ga0496108_0326538 3300048911 Bacteria 1338
380 Ga0496109_0804389 3300048912 Unclassified 878
381 Ga0496110_0143080 3300048913 Bacteria 2162
382 Ga0496112_0160858 3300048915 Bacteria 2212
383 Ga0496112_1147049 3300048915 Bacteria 695
384 Ga0496112_1445487 3300048915 Unclassified 602
385 Ga0496113_0367579 3300048916 Bacteria 1154
386 Ga0496114_0079214 3300048917 Bacteria 2773
387 Ga0496114_0111338 3300048917 Bacteria 2346
388 Ga0501034_0000429 3300049571 Bacteria 69803
389 Ga0501034_0010374 3300049571 Bacteria 9709
390 Ga0501034_0014249 3300049571 Bacteria 8196
391 Ga0501034_0083212 3300049571 Bacteria 3202
392 Ga0501036_0527102 3300049572 Bacteria 982
393 Ga0501038_0017381 3300049574 Bacteria 6500
394 Ga0501038_0621000 3300049574 Bacteria 816
395 Ga0501039_0082974 3300049575 Bacteria 2496
396 Ga0501039_0140597 3300049575 Bacteria 1896
397 Ga0501040_0281805 3300049576 Bacteria 1187
398 Ga0501041_0058265 3300049577 Bacteria 2362
399 Ga0501042_0032513 3300049578 Bacteria 3695
400 Ga0501043_0479145 3300049579 Bacteria 932
401 Ga0501046_0149788 3300049580 Bacteria 1760
402 Ga0501046_0364094 3300049580 Bacteria 1048
403 Ga0501046_0557551 3300049580 Bacteria 816
404 Ga0501047_0011206 3300049581 Bacteria 8484
405 Ga0501047_0912743 3300049581 Unclassified 692
406 Ga0501047_1016707 3300049581 Unclassified 642
407 Ga0501067_0052116 3300049583 Bacteria 2267
408 Ga0501068_0047422 3300049584 Bacteria 2592
409 Ga0501071_0090149 3300049587 Bacteria 2251
410 Ga0501072_0018404 3300049588 Bacteria 5379
411 Ga0501072_0085076 3300049588 Bacteria 2508
412 Ga0501073_0197385 3300049589 Bacteria 1392
413 Ga0501074_0087298 3300049590 Bacteria 2234
414 Ga0501075_0041188 3300049591 Bacteria 3461
415 Ga0501075_0196390 3300049591 Bacteria 1539
416 Ga0501075_0238794 3300049591 Bacteria 1385
417 Ga0501076_0090493 3300049592 Bacteria 2461
418 Ga0501077_0094466 3300049593 Bacteria 1896
419 Ga0501079_0160717 3300049741 Bacteria 1752
420 Ga0501080_0060052 3300049742 Bacteria 3538
421 Ga0501080_0071633 3300049742 Bacteria 3224
422 Ga0501081_0051943 3300049743 Bacteria 2827
423 Ga0501081_0907845 3300049743 Unclassified 664
424 Ga0501083_0112924 3300049744 Bacteria 1785
425 Ga0501035_0193281 3300049822 Unclassified 1749
426 Ga0501044_0005183 3300049823 Bacteria 14507
427 Ga0501044_0009239 3300049823 Bacteria 10766
428 Ga0501045_0005562 3300049824 Bacteria 8717
429 Ga0501045_0081402 3300049824 Bacteria 2388
430 Ga0501045_0311098 3300049824 Bacteria 1172
431 nmdc:mga0yw44_61008_c1 3300050492 Bacteria 2312
432 nmdc:mga0k408_644_c1 3300050493 Bacteria 19205
433 nmdc:mga06z11_2728_c1 3300050494 Bacteria 6770
434 nmdc:mga04h51_49429_c1 3300050495 Bacteria 1405
435 nmdc:mga07m45_9191_c1 3300050496 Bacteria 5112
436 nmdc:mga05p37_13360_c1 3300050507 Bacteria 9837
437 nmdc:mga05p37_306856_c1 3300050507 Bacteria 1883
438 nmdc:mga05p37_69833_c2 3300050507 Bacteria 3113
439 nmdc:mga09592_161827_c1 3300050508 Unclassified 1934
440 nmdc:mga09592_24696_c2 3300050508 Bacteria 3477
441 nmdc:mga09592_443769_c1 3300050508 Bacteria 1120
442 nmdc:mga09592_73219_c1 3300050508 Bacteria 2910
443 nmdc:mga0qj67_11122_c1 3300050509 Bacteria 6740
444 nmdc:mga0qj67_33684_c1 3300050509 Bacteria 3998
445 nmdc:mga06r32_1147776_c1 3300050510 Bacteria 725
446 nmdc:mga06r32_189360_c1 3300050510 Bacteria 2045
447 nmdc:mga06r32_343859_c1 3300050510 Bacteria 1476
448 nmdc:mga06r32_399133_c1 3300050510 Unclassified 1357
449 nmdc:mga06r32_60244_c1 3300050510 Bacteria 3653
450 nmdc:mga06r32_639088_c1 3300050510 Bacteria 1033
451 nmdc:mga08y16_116689_c1 3300050511 Bacteria 2779
452 nmdc:mga08y16_1227849_c1 3300050511 Bacteria 719
453 nmdc:mga08y16_19620_c1 3300050511 Bacteria 7129
454 nmdc:mga08y16_365994_c1 3300050511 Bacteria 1480
455 nmdc:mga08y16_555438_c1 3300050511 Bacteria 1162
456 nmdc:mga08y16_655_c1 3300050511 Bacteria 32531
457 nmdc:mga08y16_9913_c1 3300050511 Bacteria 10001
458 nmdc:mga0n895_316469_c1 3300050512 Unclassified 1582
459 nmdc:mga0n895_344296_c1 3300050512 Bacteria 1510
460 nmdc:mga0n895_509011_c1 3300050512 Bacteria 1212
461 nmdc:mga0rr50_160216_c1 3300050513 Bacteria 1826
462 nmdc:mga0rr50_566_c1 3300050513 Bacteria 19832
463 nmdc:mga0rr50_68868_c1 3300050513 Bacteria 2692
464 nmdc:mga0a205_132227_c1 3300050515 Bacteria 2396
465 nmdc:mga0a205_24570_c1 3300050515 Bacteria 5732
466 Ga0495601_0114309 3300053077 Bacteria 1750
467 Ga0495595_0117157 3300053084 Bacteria 1296
468 Ga0495619_0556231 3300053085 Bacteria 787
469 Ga0501084_0037455 3300054114 Bacteria 4052
470 Ga0501084_0063908 3300054114 Bacteria 3082
471 Ga0501084_0663989 3300054114 Bacteria 880
472 Ga0501084_0715303 3300054114 Unclassified 844
473 Ga0590071_000235 3300059421 Bacteria 16189
474 Ga0590074_000772 3300059423 Bacteria 4900
475 Ga0590075_000649 3300059424 Bacteria 9247
476 Ga0590075_002431 3300059424 Bacteria 4463
477 Ga0590077_000031 3300059426 Bacteria 33228
478 Ga0590077_000825 3300059426 Bacteria 8006
479 Ga0501082_0064049 3300060353 Bacteria 3166
480 Ga0501082_0358893 3300060353 Bacteria 1271
481 Ga0530510_0027475 3300061734 Bacteria 4076
482 Ga0530510_0233040 3300061734 Bacteria 1370
483 Ga0530510_0262125 3300061734 Bacteria 1289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100269747 Ga0070689_1002697472 179
2 3300005617 Ga0068859_100936648 Ga0068859_1009366482 179
3 3300005843 Ga0068860_100029980 Ga0068860_1000299804 179
4 3300006931 Ga0097620_100936641 Ga0097620_1009366412 179
5 3300028381 Ga0268264_10031212 Ga0268264_100312124 179
6 3300005340 Ga0070689_100563450 Ga0070689_1005634501 180
7 3300005343 Ga0070687_100157151 Ga0070687_1001571512 180
8 3300005354 Ga0070675_100272722 Ga0070675_1002727222 180
9 3300005365 Ga0070688_100723552 Ga0070688_1007235521 180
10 3300005406 Ga0070703_10000339 Ga0070703_100003397 180
11 3300005440 Ga0070705_100460003 Ga0070705_1004600031 180
12 3300005441 Ga0070700_101030836 Ga0070700_1010308361 180
13 3300005444 Ga0070694_100000585 Ga0070694_1000005859 180
14 3300005467 Ga0070706_101134606 Ga0070706_1011346062 180
15 3300005468 Ga0070707_100607673 Ga0070707_1006076731 180
16 3300005544 Ga0070686_100027149 Ga0070686_1000271492 180
17 3300005615 Ga0070702_100019667 Ga0070702_1000196673 180
18 3300005618 Ga0068864_100506148 Ga0068864_1005061482 180
19 3300005719 Ga0068861_100789061 Ga0068861_1007890611 180
20 3300006844 Ga0075428_100232664 Ga0075428_1002326644 180
21 3300006880 Ga0075429_100074842 Ga0075429_1000748423 180
22 3300009094 Ga0111539_10212649 Ga0111539_102126492 180
23 3300009147 Ga0114129_10147659 Ga0114129_101476595 180
24 3300009148 Ga0105243_10000629 Ga0105243_100006295 180
25 3300009176 Ga0105242_10000849 Ga0105242_1000084910 180
26 3300009177 Ga0105248_10859863 Ga0105248_108598632 180
27 3300009553 Ga0105249_10055707 Ga0105249_100557073 180
28 3300013308 Ga0157375_10401453 Ga0157375_104014532 180
29 3300014325 Ga0163163_10435818 Ga0163163_104358181 180
30 3300025885 Ga0207653_10000371 Ga0207653_1000037115 180
31 3300025918 Ga0207662_10096495 Ga0207662_100964952 180
32 3300025922 Ga0207646_10693937 Ga0207646_106939371 180
33 3300025926 Ga0207659_10121086 Ga0207659_101210863 180
34 3300025934 Ga0207686_10000039 Ga0207686_1000003925 180
35 3300025935 Ga0207709_10000192 Ga0207709_1000019225 180
36 3300025936 Ga0207670_10176706 Ga0207670_101767062 180
37 3300025941 Ga0207711_10051954 Ga0207711_100519542 180
38 3300025961 Ga0207712_10074634 Ga0207712_100746343 180
39 3300026035 Ga0207703_10076448 Ga0207703_100764483 180
40 3300026075 Ga0207708_11010918 Ga0207708_110109182 180
41 3300026089 Ga0207648_11578240 Ga0207648_115782401 180
42 3300026095 Ga0207676_10043806 Ga0207676_100438062 180
43 3300027907 Ga0207428_10025538 Ga0207428_100255386 180
44 3300046664 Ga0495659_0010397 Ga0495659_0010397_1604_2146 180
45 3300050507 nmdc:mga05p37_69833_c2 nmdc:mga05p37_69833_c2_748_1290 180
46 3300050508 nmdc:mga09592_24696_c2 nmdc:mga09592_24696_c2_2857_3399 180
47 3300050511 nmdc:mga08y16_555438_c1 nmdc:mga08y16_555438_c1_217_759 180
48 3300005331 Ga0070670_100230423 Ga0070670_1002304233 181
49 3300005356 Ga0070674_100130733 Ga0070674_1001307332 181
50 3300005457 Ga0070662_100242731 Ga0070662_1002427312 181
51 3300005549 Ga0070704_100009220 Ga0070704_1000092203 181
52 3300005718 Ga0068866_10013391 Ga0068866_100133913 181
53 3300005719 Ga0068861_100549194 Ga0068861_1005491943 181
54 3300005844 Ga0068862_100024038 Ga0068862_1000240384 181
55 3300006042 Ga0075368_10104942 Ga0075368_101049422 181
56 3300006048 Ga0075363_100260510 Ga0075363_1002605102 181
57 3300006051 Ga0075364_10064337 Ga0075364_100643373 181
58 3300006177 Ga0075362_10001619 Ga0075362_100016192 181
59 3300006178 Ga0075367_10010192 Ga0075367_100101923 181
60 3300006195 Ga0075366_10000100 Ga0075366_1000010015 181
61 3300006353 Ga0075370_10009355 Ga0075370_100093555 181
62 3300006844 Ga0075428_100280631 Ga0075428_1002806312 181
63 3300006847 Ga0075431_100566068 Ga0075431_1005660683 181
64 3300006880 Ga0075429_100036403 Ga0075429_1000364033 181
65 3300009094 Ga0111539_10000732 Ga0111539_1000073213 181
66 3300009094 Ga0111539_10018934 Ga0111539_100189342 181
67 3300009177 Ga0105248_10514327 Ga0105248_105143272 181
68 3300011119 Ga0105246_10681295 Ga0105246_106812951 181
69 3300013297 Ga0157378_10293046 Ga0157378_102930462 181
70 3300020080 Ga0206350_10799874 Ga0206350_107998742 181
71 3300025899 Ga0207642_10106483 Ga0207642_101064832 181
72 3300025922 Ga0207646_10718615 Ga0207646_107186152 181
73 3300025941 Ga0207711_10445140 Ga0207711_104451402 181
74 3300026075 Ga0207708_10195689 Ga0207708_101956893 181
75 3300026118 Ga0207675_100261829 Ga0207675_1002618292 181
76 3300027866 Ga0209813_10050951 Ga0209813_100509512 181
77 3300027907 Ga0207428_10000601 Ga0207428_1000060114 181
78 3300027907 Ga0207428_10004578 Ga0207428_100045788 181
79 3300028380 Ga0268265_10007072 Ga0268265_100070723 181
80 3300028573 Ga0265334_10088355 Ga0265334_100883551 181
81 3300049581 Ga0501047_0011206 Ga0501047_0011206_6473_7018 181
82 3300050492 nmdc:mga0yw44_61008_c1 nmdc:mga0yw44_61008_c1_1349_1915 181
83 3300050493 nmdc:mga0k408_644_c1 nmdc:mga0k408_644_c1_4251_4817 181
84 3300050494 nmdc:mga06z11_2728_c1 nmdc:mga06z11_2728_c1_1590_2156 181
85 3300050495 nmdc:mga04h51_49429_c1 nmdc:mga04h51_49429_c1_382_948 181
86 3300050496 nmdc:mga07m45_9191_c1 nmdc:mga07m45_9191_c1_1568_2134 181
87 3300050508 nmdc:mga09592_161827_c1 nmdc:mga09592_161827_c1_1308_1874 181
88 3300050511 nmdc:mga08y16_19620_c1 nmdc:mga08y16_19620_c1_1590_2156 181
89 3300050511 nmdc:mga08y16_9913_c1 nmdc:mga08y16_9913_c1_1190_1735 181
90 3300050512 nmdc:mga0n895_509011_c1 nmdc:mga0n895_509011_c1_489_1034 181
91 3300061734 Ga0530510_0233040 Ga0530510_0233040_212_757 181
92 3300005340 Ga0070689_100397536 Ga0070689_1003975362 182
93 3300005445 Ga0070708_100000508 Ga0070708_10000050816 182
94 3300005467 Ga0070706_100004927 Ga0070706_1000049277 182
95 3300005471 Ga0070698_100012336 Ga0070698_1000123366 182
96 3300005471 Ga0070698_100627878 Ga0070698_1006278782 182
97 3300005518 Ga0070699_100001427 Ga0070699_10000142719 182
98 3300005536 Ga0070697_100032588 Ga0070697_1000325885 182
99 3300005981 Ga0081538_10012338 Ga0081538_100123384 182
100 3300006844 Ga0075428_100256045 Ga0075428_1002560454 182
101 3300006846 Ga0075430_100020048 Ga0075430_1000200483 182
102 3300009098 Ga0105245_10983985 Ga0105245_109839852 182
103 3300025910 Ga0207684_10029016 Ga0207684_100290166 182
104 3300025916 Ga0207663_10000020 Ga0207663_10000020122 182
105 3300031901 Ga0307406_10015500 Ga0307406_100155004 182
106 3300044712 Ga0453684_0570270 Ga0453684_0570270_298_846 182
107 3300049574 Ga0501038_0017381 Ga0501038_0017381_84_632 182
108 3300049576 Ga0501040_0281805 Ga0501040_0281805_107_655 182
109 3300049581 Ga0501047_1016707 Ga0501047_1016707_81_632 182
110 3300049743 Ga0501081_0907845 Ga0501081_0907845_52_600 182
111 3300049824 Ga0501045_0311098 Ga0501045_0311098_215_763 182
112 3300050509 nmdc:mga0qj67_11122_c1 nmdc:mga0qj67_11122_c1_1251_1799 182
113 3300050510 nmdc:mga06r32_1147776_c1 nmdc:mga06r32_1147776_c1_38_586 182
114 3300050510 nmdc:mga06r32_399133_c1 nmdc:mga06r32_399133_c1_48_596 182
115 3300053084 Ga0495595_0117157 Ga0495595_0117157_730_1281 182
116 3300054114 Ga0501084_0037455 Ga0501084_0037455_298_846 182
117 3300054114 Ga0501084_0715303 Ga0501084_0715303_26_577 182
118 3300060353 Ga0501082_0358893 Ga0501082_0358893_330_878 182
119 3300005545 Ga0070695_100348907 Ga0070695_1003489072 183
120 3300005577 Ga0068857_100433770 Ga0068857_1004337703 183
121 3300048915 Ga0496112_1445487 Ga0496112_1445487_35_589 184
122 3300053085 Ga0495619_0556231 Ga0495619_0556231_141_695 184
123 3300048917 Ga0496114_0111338 Ga0496114_0111338_519_1076 185
124 3300049571 Ga0501034_0010374 Ga0501034_0010374_1854_2414 185
125 3300049581 Ga0501047_0912743 Ga0501047_0912743_121_681 185
126 3300049589 Ga0501073_0197385 Ga0501073_0197385_495_1055 185
127 3300036401 Ga0373937_0019343 Ga0373937_0019343_2470_3060 189
128 3300046529 Ga0495652_0511464 Ga0495652_0511464_177_767 189
129 3300046543 Ga0495645_0201425 Ga0495645_0201425_517_1107 189
130 3300053077 Ga0495601_0114309 Ga0495601_0114309_934_1524 189
131 3300048915 Ga0496112_1147049 Ga0496112_1147049_21_599 192
132 3300049575 Ga0501039_0082974 Ga0501039_0082974_185_763 192
133 3300049587 Ga0501071_0090149 Ga0501071_0090149_880_1458 192
134 3300049588 Ga0501072_0085076 Ga0501072_0085076_764_1342 192
135 3300049591 Ga0501075_0196390 Ga0501075_0196390_227_805 192
136 3300049593 Ga0501077_0094466 Ga0501077_0094466_1254_1832 192
137 3300049741 Ga0501079_0160717 Ga0501079_0160717_1033_1611 192
138 3300049743 Ga0501081_0051943 Ga0501081_0051943_329_907 192
139 3300049824 Ga0501045_0081402 Ga0501045_0081402_770_1348 192
140 3300054114 Ga0501084_0063908 Ga0501084_0063908_898_1476 192
141 3300061734 Ga0530510_0262125 Ga0530510_0262125_480_1058 192
142 3300027682 Ga0209971_1022578 Ga0209971_10225782 194
143 3300054114 Ga0501084_0663989 Ga0501084_0663989_214_816 198
144 3300045976 Ga0466967_0550101 Ga0466967_0550101_381_980 199
145 3300005338 Ga0068868_100486694 Ga0068868_1004866941 203
146 3300005353 Ga0070669_100429382 Ga0070669_1004293822 203
147 3300005355 Ga0070671_100010640 Ga0070671_1000106409 203
148 3300005364 Ga0070673_100164624 Ga0070673_1001646243 203
149 3300005367 Ga0070667_100302778 Ga0070667_1003027783 203
150 3300005456 Ga0070678_100166440 Ga0070678_1001664402 203
151 3300005459 Ga0068867_100103135 Ga0068867_1001031352 203
152 3300005466 Ga0070685_10226653 Ga0070685_102266532 203
153 3300005543 Ga0070672_100075300 Ga0070672_1000753003 203
154 3300005548 Ga0070665_100010950 Ga0070665_1000109503 203
155 3300005617 Ga0068859_101021336 Ga0068859_1010213361 203
156 3300005718 Ga0068866_10245501 Ga0068866_102455012 203
157 3300005719 Ga0068861_100569995 Ga0068861_1005699953 203
158 3300005840 Ga0068870_10222047 Ga0068870_102220472 203
159 3300005842 Ga0068858_100088009 Ga0068858_1000880093 203
160 3300005843 Ga0068860_100460339 Ga0068860_1004603392 203
161 3300005844 Ga0068862_100213300 Ga0068862_1002133003 203
162 3300006237 Ga0097621_100011130 Ga0097621_1000111309 203
163 3300006881 Ga0068865_100269344 Ga0068865_1002693443 203
164 3300006931 Ga0097620_101021503 Ga0097620_1010215032 203
165 3300009177 Ga0105248_10011673 Ga0105248_100116734 203
166 3300013296 Ga0157374_10609885 Ga0157374_106098853 203
167 3300013306 Ga0163162_10321618 Ga0163162_103216183 203
168 3300013308 Ga0157375_10285540 Ga0157375_102855403 203
169 3300025901 Ga0207688_10168438 Ga0207688_101684383 203
170 3300025908 Ga0207643_10110742 Ga0207643_101107423 203
171 3300025923 Ga0207681_10100492 Ga0207681_101004923 203
172 3300025925 Ga0207650_10081286 Ga0207650_100812863 203
173 3300025938 Ga0207704_10354383 Ga0207704_103543832 203
174 3300025940 Ga0207691_10082925 Ga0207691_100829253 203
175 3300025941 Ga0207711_10582269 Ga0207711_105822692 203
176 3300025960 Ga0207651_10000043 Ga0207651_100000432 203
177 3300026035 Ga0207703_10066486 Ga0207703_100664863 203
178 3300026089 Ga0207648_10113187 Ga0207648_101131873 203
179 3300028379 Ga0268266_10099462 Ga0268266_100994623 203
180 3300028381 Ga0268264_10675408 Ga0268264_106754082 203
181 3300050510 nmdc:mga06r32_343859_c1 nmdc:mga06r32_343859_c1_255_911 206
182 3300005344 Ga0070661_100000811 Ga0070661_10000081113 207
183 3300005564 Ga0070664_100002095 Ga0070664_10000209516 207
184 3300005577 Ga0068857_100169430 Ga0068857_1001694303 207
185 3300025920 Ga0207649_10003405 Ga0207649_100034052 207
186 3300025945 Ga0207679_10003018 Ga0207679_100030185 207
187 3300026116 Ga0207674_10189743 Ga0207674_101897432 207
188 3300042876 Ga0451577_0029001 Ga0451577_0029001_3561_4184 207
189 3300046689 Ga0495613_0134204 Ga0495613_0134204_1097_1729 207
190 3300005530 Ga0070679_100885821 Ga0070679_1008858212 208
191 3300005616 Ga0068852_100110217 Ga0068852_1001102172 208
192 3300009094 Ga0111539_11466047 Ga0111539_114660472 208
193 3300013104 Ga0157370_10105679 Ga0157370_101056793 208
194 3300013308 Ga0157375_10549189 Ga0157375_105491891 208
195 3300025932 Ga0207690_10172695 Ga0207690_101726952 208
196 3300026142 Ga0207698_10115319 Ga0207698_101153193 208
197 3300032002 Ga0307416_100676635 Ga0307416_1006766352 208
198 3300044712 Ga0453684_1012005 Ga0453684_1012005_41_667 208
199 3300050511 nmdc:mga08y16_1227849_c1 nmdc:mga08y16_1227849_c1_32_658 208
200 3300005435 Ga0070714_100005531 Ga0070714_1000055313 209
201 3300025929 Ga0207664_10139265 Ga0207664_101392653 209
202 3300036401 Ga0373937_0330816 Ga0373937_0330816_303_944 209
203 3300049583 Ga0501067_0052116 Ga0501067_0052116_1061_1711 209
204 3300049584 Ga0501068_0047422 Ga0501068_0047422_1356_2006 209
205 3300005337 Ga0070682_100068558 Ga0070682_1000685583 210
206 3300005339 Ga0070660_100191928 Ga0070660_1001919282 210
207 3300005366 Ga0070659_100107164 Ga0070659_1001071643 210
208 3300005530 Ga0070679_100115205 Ga0070679_1001152051 210
209 3300005563 Ga0068855_100034080 Ga0068855_1000340803 210
210 3300005563 Ga0068855_100312688 Ga0068855_1003126883 210
211 3300005577 Ga0068857_100270718 Ga0068857_1002707182 210
212 3300007076 Ga0075435_100014420 Ga0075435_10001442010 210
213 3300009545 Ga0105237_10000919 Ga0105237_1000091911 210
214 3300013104 Ga0157370_10026930 Ga0157370_100269302 210
215 3300013105 Ga0157369_10454463 Ga0157369_104544632 210
216 3300013105 Ga0157369_10507383 Ga0157369_105073832 210
217 3300013307 Ga0157372_10043530 Ga0157372_100435305 210
218 3300025909 Ga0207705_10053972 Ga0207705_100539723 210
219 3300025914 Ga0207671_10000120 Ga0207671_1000012097 210
220 3300025921 Ga0207652_10008447 Ga0207652_100084474 210
221 3300025932 Ga0207690_10639025 Ga0207690_106390251 210
222 3300025942 Ga0207689_10197230 Ga0207689_101972302 210
223 3300025949 Ga0207667_10024393 Ga0207667_100243934 210
224 3300028380 Ga0268265_10724647 Ga0268265_107246472 210
225 3300035724 Ga0373933_0108114 Ga0373933_0108114_666_1322 210
226 3300049571 Ga0501034_0014249 Ga0501034_0014249_5595_6248 210
227 3300049571 Ga0501034_0083212 Ga0501034_0083212_2531_3187 210
228 3300049579 Ga0501043_0479145 Ga0501043_0479145_230_883 210
229 3300049580 Ga0501046_0557551 Ga0501046_0557551_19_672 210
230 3300049742 Ga0501080_0060052 Ga0501080_0060052_780_1433 210
231 3300049823 Ga0501044_0005183 Ga0501044_0005183_12261_12914 210
232 3300060353 Ga0501082_0064049 Ga0501082_0064049_210_863 210
233 3300005290 Ga0065712_10081967 Ga0065712_100819673 211
234 3300005290 Ga0065712_10365430 Ga0065712_103654301 211
235 3300005293 Ga0065715_10095063 Ga0065715_100950633 211
236 3300005328 Ga0070676_10020433 Ga0070676_100204336 211
237 3300005328 Ga0070676_10028078 Ga0070676_100280785 211
238 3300005330 Ga0070690_100017159 Ga0070690_1000171593 211
239 3300005330 Ga0070690_100413006 Ga0070690_1004130062 211
240 3300005331 Ga0070670_100048541 Ga0070670_1000485413 211
241 3300005331 Ga0070670_100129959 Ga0070670_1001299593 211
242 3300005331 Ga0070670_100441771 Ga0070670_1004417712 211
243 3300005333 Ga0070677_10096110 Ga0070677_100961102 211
244 3300005334 Ga0068869_101049686 Ga0068869_1010496861 211
245 3300005338 Ga0068868_101016352 Ga0068868_1010163521 211
246 3300005340 Ga0070689_100015138 Ga0070689_1000151387 211
247 3300005340 Ga0070689_100424819 Ga0070689_1004248192 211
248 3300005341 Ga0070691_10001764 Ga0070691_100017646 211
249 3300005341 Ga0070691_10031943 Ga0070691_100319433 211
250 3300005343 Ga0070687_100287408 Ga0070687_1002874081 211
251 3300005344 Ga0070661_100180439 Ga0070661_1001804393 211
252 3300005353 Ga0070669_100082767 Ga0070669_1000827673 211
253 3300005354 Ga0070675_100000389 Ga0070675_1000003893 211
254 3300005354 Ga0070675_100139050 Ga0070675_1001390503 211
255 3300005354 Ga0070675_100810955 Ga0070675_1008109552 211
256 3300005355 Ga0070671_100068315 Ga0070671_1000683153 211
257 3300005364 Ga0070673_100000749 Ga0070673_10000074912 211
258 3300005364 Ga0070673_100131582 Ga0070673_1001315822 211
259 3300005365 Ga0070688_100006574 Ga0070688_1000065746 211
260 3300005365 Ga0070688_100116383 Ga0070688_1001163832 211
261 3300005365 Ga0070688_100349609 Ga0070688_1003496092 211
262 3300005367 Ga0070667_100173051 Ga0070667_1001730513 211
263 3300005367 Ga0070667_100711079 Ga0070667_1007110791 211
264 3300005435 Ga0070714_100209508 Ga0070714_1002095082 211
265 3300005440 Ga0070705_100028130 Ga0070705_1000281301 211
266 3300005440 Ga0070705_100055886 Ga0070705_1000558863 211
267 3300005441 Ga0070700_100008636 Ga0070700_1000086365 211
268 3300005441 Ga0070700_100010235 Ga0070700_1000102354 211
269 3300005444 Ga0070694_100099854 Ga0070694_1000998542 211
270 3300005458 Ga0070681_10482134 Ga0070681_104821342 211
271 3300005459 Ga0068867_100014650 Ga0068867_1000146506 211
272 3300005459 Ga0068867_100254628 Ga0068867_1002546281 211
273 3300005466 Ga0070685_10384236 Ga0070685_103842361 211
274 3300005539 Ga0068853_100763931 Ga0068853_1007639311 211
275 3300005543 Ga0070672_100192159 Ga0070672_1001921593 211
276 3300005543 Ga0070672_100603670 Ga0070672_1006036702 211
277 3300005544 Ga0070686_100196893 Ga0070686_1001968933 211
278 3300005544 Ga0070686_100245238 Ga0070686_1002452382 211
279 3300005544 Ga0070686_100487121 Ga0070686_1004871212 211
280 3300005545 Ga0070695_100201203 Ga0070695_1002012031 211
281 3300005546 Ga0070696_100057800 Ga0070696_1000578003 211
282 3300005546 Ga0070696_100312672 Ga0070696_1003126722 211
283 3300005547 Ga0070693_100009557 Ga0070693_1000095574 211
284 3300005549 Ga0070704_100341386 Ga0070704_1003413863 211
285 3300005563 Ga0068855_100472171 Ga0068855_1004721712 211
286 3300005563 Ga0068855_100479867 Ga0068855_1004798673 211
287 3300005563 Ga0068855_100719476 Ga0068855_1007194762 211
288 3300005564 Ga0070664_100089314 Ga0070664_1000893143 211
289 3300005577 Ga0068857_100318437 Ga0068857_1003184372 211
290 3300005578 Ga0068854_100028438 Ga0068854_1000284382 211
291 3300005578 Ga0068854_100120814 Ga0068854_1001208143 211
292 3300005578 Ga0068854_100177142 Ga0068854_1001771422 211
293 3300005614 Ga0068856_100336965 Ga0068856_1003369652 211
294 3300005616 Ga0068852_100029482 Ga0068852_1000294826 211
295 3300005616 Ga0068852_100647327 Ga0068852_1006473272 211
296 3300005617 Ga0068859_100004031 Ga0068859_1000040317 211
297 3300005617 Ga0068859_100095744 Ga0068859_1000957443 211
298 3300005617 Ga0068859_100280079 Ga0068859_1002800792 211
299 3300005618 Ga0068864_101232700 Ga0068864_1012327001 211
300 3300005719 Ga0068861_100010652 Ga0068861_1000106523 211
301 3300005841 Ga0068863_100064197 Ga0068863_1000641973 211
302 3300005841 Ga0068863_100271839 Ga0068863_1002718392 211
303 3300005843 Ga0068860_100307052 Ga0068860_1003070523 211
304 3300005843 Ga0068860_100383367 Ga0068860_1003833672 211
305 3300005844 Ga0068862_100238207 Ga0068862_1002382073 211
306 3300006844 Ga0075428_100016776 Ga0075428_1000167761 211
307 3300006844 Ga0075428_100122047 Ga0075428_1001220474 211
308 3300006844 Ga0075428_100614952 Ga0075428_1006149522 211
309 3300006846 Ga0075430_100035132 Ga0075430_1000351323 211
310 3300006846 Ga0075430_100246537 Ga0075430_1002465373 211
311 3300006847 Ga0075431_100070494 Ga0075431_1000704943 211
312 3300006847 Ga0075431_100136056 Ga0075431_1001360563 211
313 3300006852 Ga0075433_10023993 Ga0075433_100239934 211
314 3300006871 Ga0075434_100062375 Ga0075434_1000623755 211
315 3300006871 Ga0075434_100064690 Ga0075434_1000646902 211
316 3300006871 Ga0075434_100162228 Ga0075434_1001622282 211
317 3300006880 Ga0075429_100066680 Ga0075429_1000666803 211
318 3300006880 Ga0075429_100242918 Ga0075429_1002429181 211
319 3300006880 Ga0075429_100413147 Ga0075429_1004131471 211
320 3300006931 Ga0097620_100004031 Ga0097620_1000040317 211
321 3300006931 Ga0097620_100095746 Ga0097620_1000957463 211
322 3300006931 Ga0097620_100280077 Ga0097620_1002800772 211
323 3300007076 Ga0075435_100006983 Ga0075435_1000069836 211
324 3300007076 Ga0075435_100079465 Ga0075435_1000794653 211
325 3300007076 Ga0075435_100107132 Ga0075435_1001071322 211
326 3300009093 Ga0105240_10176216 Ga0105240_101762163 211
327 3300009093 Ga0105240_10219420 Ga0105240_102194202 211
328 3300009094 Ga0111539_10022531 Ga0111539_100225313 211
329 3300009094 Ga0111539_10143646 Ga0111539_101436464 211
330 3300009098 Ga0105245_10044318 Ga0105245_100443183 211
331 3300009148 Ga0105243_10277391 Ga0105243_102773912 211
332 3300009177 Ga0105248_10119321 Ga0105248_101193213 211
333 3300009177 Ga0105248_10341786 Ga0105248_103417862 211
334 3300009553 Ga0105249_10127420 Ga0105249_101274202 211
335 3300009553 Ga0105249_10979740 Ga0105249_109797401 211
336 3300010375 Ga0105239_10210855 Ga0105239_102108552 211
337 3300013104 Ga0157370_10282005 Ga0157370_102820053 211
338 3300013105 Ga0157369_10300130 Ga0157369_103001303 211
339 3300013105 Ga0157369_10349668 Ga0157369_103496682 211
340 3300013306 Ga0163162_10251394 Ga0163162_102513943 211
341 3300013307 Ga0157372_10070680 Ga0157372_100706803 211
342 3300013307 Ga0157372_10967853 Ga0157372_109678532 211
343 3300013307 Ga0157372_11259701 Ga0157372_112597011 211
344 3300013307 Ga0157372_11320455 Ga0157372_113204552 211
345 3300013308 Ga0157375_10856102 Ga0157375_108561022 211
346 3300014325 Ga0163163_10154709 Ga0163163_101547093 211
347 3300014325 Ga0163163_10645656 Ga0163163_106456562 211
348 3300014326 Ga0157380_10070543 Ga0157380_100705434 211
349 3300014326 Ga0157380_10188365 Ga0157380_101883653 211
350 3300014326 Ga0157380_10446739 Ga0157380_104467392 211
351 3300014326 Ga0157380_11212168 Ga0157380_112121682 211
352 3300014497 Ga0182008_10089238 Ga0182008_100892382 211
353 3300014745 Ga0157377_10366707 Ga0157377_103667071 211
354 3300025903 Ga0207680_10585769 Ga0207680_105857692 211
355 3300025904 Ga0207647_10119965 Ga0207647_101199652 211
356 3300025907 Ga0207645_10005699 Ga0207645_100056999 211
357 3300025907 Ga0207645_10012483 Ga0207645_100124833 211
358 3300025911 Ga0207654_10028636 Ga0207654_100286365 211
359 3300025912 Ga0207707_10335679 Ga0207707_103356792 211
360 3300025913 Ga0207695_10002596 Ga0207695_1000259621 211
361 3300025918 Ga0207662_10001028 Ga0207662_1000102813 211
362 3300025918 Ga0207662_10121406 Ga0207662_101214063 211
363 3300025920 Ga0207649_10212241 Ga0207649_102122413 211
364 3300025923 Ga0207681_10090380 Ga0207681_100903803 211
365 3300025923 Ga0207681_10782736 Ga0207681_107827361 211
366 3300025925 Ga0207650_10050073 Ga0207650_100500733 211
367 3300025925 Ga0207650_10085863 Ga0207650_100858633 211
368 3300025926 Ga0207659_10000080 Ga0207659_1000008043 211
369 3300025926 Ga0207659_10086616 Ga0207659_100866163 211
370 3300025926 Ga0207659_10721135 Ga0207659_107211352 211
371 3300025931 Ga0207644_10088344 Ga0207644_100883443 211
372 3300025931 Ga0207644_10313168 Ga0207644_103131682 211
373 3300025934 Ga0207686_10018260 Ga0207686_100182603 211
374 3300025936 Ga0207670_10123155 Ga0207670_101231553 211
375 3300025936 Ga0207670_10821205 Ga0207670_108212051 211
376 3300025938 Ga0207704_10718283 Ga0207704_107182831 211
377 3300025940 Ga0207691_10212179 Ga0207691_102121792 211
378 3300025940 Ga0207691_10385075 Ga0207691_103850752 211
379 3300025941 Ga0207711_10008173 Ga0207711_100081736 211
380 3300025945 Ga0207679_10059517 Ga0207679_100595173 211
381 3300025949 Ga0207667_10182646 Ga0207667_101826462 211
382 3300025960 Ga0207651_10000742 Ga0207651_100007426 211
383 3300025960 Ga0207651_10133680 Ga0207651_101336802 211
384 3300025960 Ga0207651_10272376 Ga0207651_102723762 211
385 3300025960 Ga0207651_10371221 Ga0207651_103712211 211
386 3300025981 Ga0207640_10058212 Ga0207640_100582123 211
387 3300025981 Ga0207640_10231941 Ga0207640_102319412 211
388 3300025981 Ga0207640_10543034 Ga0207640_105430342 211
389 3300025986 Ga0207658_10822449 Ga0207658_108224492 211
390 3300026075 Ga0207708_10007480 Ga0207708_100074806 211
391 3300026078 Ga0207702_10400526 Ga0207702_104005262 211
392 3300026088 Ga0207641_10172698 Ga0207641_101726982 211
393 3300026088 Ga0207641_10206350 Ga0207641_102063503 211
394 3300026089 Ga0207648_10009113 Ga0207648_1000911310 211
395 3300026089 Ga0207648_10026336 Ga0207648_100263366 211
396 3300026116 Ga0207674_10318495 Ga0207674_103184953 211
397 3300026118 Ga0207675_100057364 Ga0207675_1000573643 211
398 3300026121 Ga0207683_10222713 Ga0207683_102227133 211
399 3300026121 Ga0207683_10346761 Ga0207683_103467612 211
400 3300026142 Ga0207698_10184647 Ga0207698_101846472 211
401 3300027907 Ga0207428_10035629 Ga0207428_100356293 211
402 3300027907 Ga0207428_10051568 Ga0207428_100515685 211
403 3300027907 Ga0207428_10259467 Ga0207428_102594672 211
404 3300028380 Ga0268265_10169004 Ga0268265_101690043 211
405 3300028381 Ga0268264_10299233 Ga0268264_102992332 211
406 3300031548 Ga0307408_100356427 Ga0307408_1003564272 211
407 3300031731 Ga0307405_10504912 Ga0307405_105049122 211
408 3300031824 Ga0307413_10068735 Ga0307413_100687354 211
409 3300031852 Ga0307410_10164825 Ga0307410_101648252 211
410 3300031852 Ga0307410_10204716 Ga0307410_102047161 211
411 3300031901 Ga0307406_10499374 Ga0307406_104993742 211
412 3300031903 Ga0307407_10079523 Ga0307407_100795232 211
413 3300031995 Ga0307409_100011665 Ga0307409_1000116653 211
414 3300031995 Ga0307409_100035367 Ga0307409_1000353673 211
415 3300031995 Ga0307409_100438292 Ga0307409_1004382922 211
416 3300031995 Ga0307409_100466756 Ga0307409_1004667563 211
417 3300032005 Ga0307411_10080593 Ga0307411_100805933 211
418 3300032126 Ga0307415_100213510 Ga0307415_1002135102 211
419 3300034817 Ga0373948_0006201 Ga0373948_0006201_347_985 211
420 3300034818 Ga0373950_0041394 Ga0373950_0041394_175_813 211
421 3300035090 Ga0373949_0082047 Ga0373949_0082047_208_846 211
422 3300036401 Ga0373937_0062585 Ga0373937_0062585_1461_2141 211
423 3300042122 Ga0450920_004091 Ga0450920_004091_16_663 211
424 3300042132 Ga0450895_000570 Ga0450895_000570_831_1478 211
425 3300042133 Ga0450896_015208 Ga0450896_015208_24_671 211
426 3300042436 Ga0439435_0009020 Ga0439435_0009020_580_1227 211
427 3300045051 Ga0451576_0369379 Ga0451576_0369379_46_684 211
428 3300046455 Ga0495603_0129208 Ga0495603_0129208_308_976 211
429 3300046689 Ga0495613_0390517 Ga0495613_0390517_178_858 211
430 3300047315 Ga0495581_0161880 Ga0495581_0161880_468_1136 211
431 3300047444 Ga0495675_0206808 Ga0495675_0206808_302_982 211
432 3300047471 Ga0495684_0014303 Ga0495684_0014303_1154_1834 211
433 3300048088 Ga0495602_0629458 Ga0495602_0629458_14_694 211
434 3300048909 Ga0496106_0147025 Ga0496106_0147025_866_1504 211
435 3300048911 Ga0496108_0326538 Ga0496108_0326538_166_807 211
436 3300048912 Ga0496109_0804389 Ga0496109_0804389_155_796 211
437 3300048913 Ga0496110_0143080 Ga0496110_0143080_591_1226 211
438 3300048915 Ga0496112_0160858 Ga0496112_0160858_337_978 211
439 3300048916 Ga0496113_0367579 Ga0496113_0367579_356_1000 211
440 3300048917 Ga0496114_0079214 Ga0496114_0079214_1460_2134 211
441 3300049571 Ga0501034_0000429 Ga0501034_0000429_52084_52740 211
442 3300049572 Ga0501036_0527102 Ga0501036_0527102_85_732 211
443 3300049574 Ga0501038_0621000 Ga0501038_0621000_26_673 211
444 3300049575 Ga0501039_0140597 Ga0501039_0140597_336_998 211
445 3300049577 Ga0501041_0058265 Ga0501041_0058265_1216_1878 211
446 3300049578 Ga0501042_0032513 Ga0501042_0032513_2067_2729 211
447 3300049580 Ga0501046_0149788 Ga0501046_0149788_257_919 211
448 3300049580 Ga0501046_0364094 Ga0501046_0364094_142_789 211
449 3300049588 Ga0501072_0018404 Ga0501072_0018404_434_1096 211
450 3300049590 Ga0501074_0087298 Ga0501074_0087298_925_1587 211
451 3300049591 Ga0501075_0041188 Ga0501075_0041188_2229_2891 211
452 3300049591 Ga0501075_0238794 Ga0501075_0238794_295_942 211
453 3300049592 Ga0501076_0090493 Ga0501076_0090493_759_1421 211
454 3300049742 Ga0501080_0071633 Ga0501080_0071633_362_1024 211
455 3300049744 Ga0501083_0112924 Ga0501083_0112924_1008_1664 211
456 3300049822 Ga0501035_0193281 Ga0501035_0193281_1036_1698 211
457 3300049823 Ga0501044_0009239 Ga0501044_0009239_8065_8727 211
458 3300049824 Ga0501045_0005562 Ga0501045_0005562_1485_2147 211
459 3300050507 nmdc:mga05p37_13360_c1 nmdc:mga05p37_13360_c1_6717_7364 211
460 3300050507 nmdc:mga05p37_306856_c1 nmdc:mga05p37_306856_c1_413_1075 211
461 3300050508 nmdc:mga09592_443769_c1 nmdc:mga09592_443769_c1_48_695 211
462 3300050508 nmdc:mga09592_73219_c1 nmdc:mga09592_73219_c1_1983_2666 211
463 3300050509 nmdc:mga0qj67_33684_c1 nmdc:mga0qj67_33684_c1_569_1252 211
464 3300050510 nmdc:mga06r32_189360_c1 nmdc:mga06r32_189360_c1_456_1139 211
465 3300050510 nmdc:mga06r32_60244_c1 nmdc:mga06r32_60244_c1_1917_2564 211
466 3300050510 nmdc:mga06r32_639088_c1 nmdc:mga06r32_639088_c1_381_1019 211
467 3300050511 nmdc:mga08y16_116689_c1 nmdc:mga08y16_116689_c1_1162_1800 211
468 3300050511 nmdc:mga08y16_365994_c1 nmdc:mga08y16_365994_c1_204_851 211
469 3300050511 nmdc:mga08y16_655_c1 nmdc:mga08y16_655_c1_2443_3090 211
470 3300050512 nmdc:mga0n895_316469_c1 nmdc:mga0n895_316469_c1_728_1375 211
471 3300050512 nmdc:mga0n895_344296_c1 nmdc:mga0n895_344296_c1_700_1344 211
472 3300050513 nmdc:mga0rr50_160216_c1 nmdc:mga0rr50_160216_c1_397_1044 211
473 3300050513 nmdc:mga0rr50_566_c1 nmdc:mga0rr50_566_c1_7844_8488 211
474 3300050513 nmdc:mga0rr50_68868_c1 nmdc:mga0rr50_68868_c1_319_966 211
475 3300050515 nmdc:mga0a205_132227_c1 nmdc:mga0a205_132227_c1_905_1552 211
476 3300050515 nmdc:mga0a205_24570_c1 nmdc:mga0a205_24570_c1_2394_3041 211
477 3300059421 Ga0590071_000235 Ga0590071_000235_9516_10157 211
478 3300059423 Ga0590074_000772 Ga0590074_000772_2695_3336 211
479 3300059424 Ga0590075_000649 Ga0590075_000649_5542_6183 211
480 3300059424 Ga0590075_002431 Ga0590075_002431_336_1007 211
481 3300059426 Ga0590077_000031 Ga0590077_000031_14709_15350 211
482 3300059426 Ga0590077_000825 Ga0590077_000825_1172_1843 211
483 3300061734 Ga0530510_0027475 Ga0530510_0027475_2783_3445 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

154

237

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g8k-assembly1.cif.gz_B crystal structure analysis of arsenite oxidase from alcaligenes faecalis 0.9313 103 207
1g8j-assembly1.cif.gz_B crystal structure analysis of arsenite oxidase from alcaligenes faecalis 0.9307 105 207
8cgs-assembly1.cif.gz_B crystal structure of arsenite oxidase from alcaligenes faecalis (af aio) bound to antimony oxyanion 0.9196 102 207
5nqd-assembly2.cif.gz_D arsenite oxidase aioab from rhizobium sp. str. nt-26 mutant aiobf108a 0.898 102 208
8ed4-assembly1.cif.gz_D structure of the complex between the arsenite oxidase and its native electron acceptor cytochrome c552 from pseudorhizobium sp. str. nt-26 0.8962 102 208
ID Description Score Start End Superfamily
1g8kF00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9338 103 207 2.102.10.10
4aayB00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9011 102 208 2.102.10.10
1jm1A00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8733 103 206 2.102.10.10
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8713 106 205 2.102.10.10
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8553 106 205 2.102.10.10
ID Description Score Start End GO Terms
AF-B1I6L5-F1-model_v4 Rieske (2Fe-2S) domain protein 0.9658 105 204 GO:0046872
GO:0051537
AF-A0A535QCV9-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9591 103 206 GO:0046872
GO:0051537
AF-A0A3M2GQ28-F1-model_v4 Arsenate reductase (Azurin) small subunit (EC 1.20.9.1) 0.9424 105 207 GO:0046872
GO:0050611
GO:0051537
AF-A0A7Y3P3H0-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9379 102 206 GO:0016020
GO:0046872
GO:0051537
AF-A0A3B9MMI8-F1-model_v4 Rieske domain-containing protein 0.9372 102 206 GO:0016020
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
79.58 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map