F452819

General Info

Members Datasets Scaffolds Average Seq Length
483 284 462 175

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0392049|Ga0466960_0392049_125_742
Length 205
Sequence MGFVRSARAFGCDAGAGRILTTSGEQTLMRALGPGSVSSFLKIILDVVFAALWIGLVVLALITLAALLLSFNPDLLAENARAGSISELVRNGPSVASGLFAAVLYVAGVLVIVGSLRRIFTTLTAGDPFHPDNVARLRVIGLMLAGLELGRYVFWAISAWLLPGVTHVEKQNLSLTAWFSVLVVFVLAEVFREGARLRREAELTI

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2818991435 Caulobacter henricii 536 Isolate Unclassified
18 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
19 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
20 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
21 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
157 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
158 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
159 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
229 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
246 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
247 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
248 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
249 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
252 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
253 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
256 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
257 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
260 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
261 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
262 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
263 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
269 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
270 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
273 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
276 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
277 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
278 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
281 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
282 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
283 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
284 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 0.21
Isolates 4.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.67
Nodule 0
Rhizoplane 2.28
Rhizosphere 63.15
Stem 0
Stem Tuber 0
Unclassified 8.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10013055 3300003316 Bacteria 4588
2 Ga0055526_1033927 3300003771 Bacteria 1405
3 Ga0055537_1001045 3300003773 Bacteria 12416
4 Ga0055524_1008150 3300003775 Bacteria 4378
5 Ga0055524_1031795 3300003775 Bacteria 1511
6 Ga0055536_1000815 3300003781 Bacteria 20611
7 Ga0055536_1000953 3300003781 Bacteria 18523
8 Ga0055528_1036338 3300003790 Bacteria 1178
9 Ga0055530_10001482 3300003791 Bacteria 17041
10 Ga0055530_10001790 3300003791 Bacteria 14930
11 Ga0055531_10000541 3300003794 Bacteria 33459
12 Ga0055531_10001885 3300003794 Bacteria 14679
13 Ga0055531_10006083 3300003794 Bacteria 6910
14 Ga0065165_1001044 3300005262 Bacteria 33434
15 Ga0065165_1001092 3300005262 Bacteria 32262
16 Ga0065165_1007051 3300005262 Bacteria 5654
17 Ga0070658_10067815 3300005327 Bacteria 2915
18 Ga0070658_10378644 3300005327 Bacteria 1214
19 Ga0070658_10766548 3300005327 Bacteria 838
20 Ga0070670_100000004 3300005331 Bacteria 392110
21 Ga0070670_100226147 3300005331 Bacteria 1628
22 Ga0068869_100056322 3300005334 Bacteria 2867
23 Ga0068869_100914441 3300005334 Bacteria 760
24 Ga0070666_10147768 3300005335 Bacteria 1639
25 Ga0070680_100057923 3300005336 Bacteria 3168
26 Ga0070691_10006066 3300005341 Bacteria 5516
27 Ga0070668_100000279 3300005347 Bacteria 33807
28 Ga0070668_100004126 3300005347 Bacteria 10756
29 Ga0070668_100008889 3300005347 Bacteria 7460
30 Ga0070669_100212242 3300005353 Bacteria 1528
31 Ga0070669_100304716 3300005353 Bacteria 1282
32 Ga0070671_100079951 3300005355 Bacteria 2733
33 Ga0070659_100068160 3300005366 Bacteria 2822
34 Ga0070667_100000175 3300005367 Bacteria 79433
35 Ga0070663_100341041 3300005455 Bacteria 1211
36 Ga0070678_100511115 3300005456 Bacteria 1061
37 Ga0070681_10059441 3300005458 Bacteria 3802
38 Ga0070681_10272226 3300005458 Bacteria 1605
39 Ga0070681_10469255 3300005458 Bacteria 1171
40 Ga0070679_100211985 3300005530 Bacteria 1900
41 Ga0070679_100583704 3300005530 Bacteria 1061
42 Ga0070679_100930446 3300005530 Bacteria 813
43 Ga0068853_100056100 3300005539 Bacteria 3396
44 Ga0070686_100460023 3300005544 Bacteria 980
45 Ga0070665_100000198 3300005548 Bacteria 105999
46 Ga0070665_100000738 3300005548 Bacteria 43554
47 Ga0068855_100042938 3300005563 Bacteria 5357
48 Ga0068855_100152030 3300005563 Bacteria 2632
49 Ga0068855_100273814 3300005563 Bacteria 1876
50 Ga0068856_100269610 3300005614 Bacteria 1718
51 Ga0068852_100049814 3300005616 Bacteria 3585
52 Ga0068852_100306400 3300005616 Bacteria 1539
53 Ga0068859_100027712 3300005617 Bacteria 5682
54 Ga0068864_100000082 3300005618 Bacteria 101182
55 Ga0068864_100505213 3300005618 Bacteria 1164
56 Ga0068864_101060261 3300005618 Bacteria 805
57 Ga0068866_10076077 3300005718 Bacteria 1789
58 Ga0068861_100720893 3300005719 Bacteria 929
59 Ga0068870_10089148 3300005840 Bacteria 1721
60 Ga0068863_100002562 3300005841 Bacteria 18042
61 Ga0068863_100027662 3300005841 Bacteria 5411
62 Ga0068863_100759328 3300005841 Bacteria 966
63 Ga0068858_100003392 3300005842 Bacteria 15849
64 Ga0068858_100083260 3300005842 Bacteria 2975
65 Ga0068860_100000077 3300005843 Bacteria 171297
66 Ga0068860_100003426 3300005843 Bacteria 16306
67 Ga0068860_101289221 3300005843 Bacteria 751
68 Ga0068862_100000183 3300005844 Bacteria 68758
69 Ga0068862_100021079 3300005844 Bacteria 5447
70 Ga0068862_100031033 3300005844 Bacteria 4507
71 Ga0068862_100106589 3300005844 Bacteria 2457
72 Ga0068862_100736706 3300005844 Bacteria 958
73 Ga0068862_101457999 3300005844 Bacteria 689
74 Ga0075363_100043191 3300006048 Bacteria 2384
75 Ga0075364_10004307 3300006051 Bacteria 8167
76 Ga0075362_10094624 3300006177 Bacteria 1390
77 Ga0075362_10309585 3300006177 Bacteria 785
78 Ga0075367_10009900 3300006178 Bacteria 4993
79 Ga0075369_10001212 3300006186 Bacteria 8746
80 Ga0075366_10020867 3300006195 Bacteria 3805
81 Ga0075366_10033211 3300006195 Bacteria 3039
82 Ga0075366_10045389 3300006195 Bacteria 2604
83 Ga0075366_10056028 3300006195 Bacteria 2341
84 Ga0075370_10080534 3300006353 Bacteria 1871
85 Ga0068871_101012782 3300006358 Bacteria 774
86 Ga0068865_100005392 3300006881 Bacteria 7749
87 Ga0097620_100027712 3300006931 Bacteria 5682
88 Ga0105251_10298832 3300009011 Bacteria 730
89 Ga0105240_10000428 3300009093 Bacteria 77995
90 Ga0105240_10190741 3300009093 Bacteria 2410
91 Ga0105240_10593550 3300009093 Bacteria 1220
92 Ga0105240_10778012 3300009093 Bacteria 1038
93 Ga0105245_10449107 3300009098 Bacteria 1297
94 Ga0105247_10257773 3300009101 Bacteria 1195
95 Ga0105241_10099847 3300009174 Bacteria 2306
96 Ga0105242_10829404 3300009176 Bacteria 918
97 Ga0105248_10001822 3300009177 Bacteria 23689
98 Ga0105248_10136071 3300009177 Bacteria 2771
99 Ga0105248_10283916 3300009177 Bacteria 1864
100 Ga0105248_10467961 3300009177 Bacteria 1421
101 Ga0105237_10188995 3300009545 Bacteria 2060
102 Ga0105237_10621283 3300009545 Bacteria 1087
103 Ga0105238_10059347 3300009551 Bacteria 3832
104 Ga0105238_10162526 3300009551 Bacteria 2209
105 Ga0105238_11616959 3300009551 Unclassified 678
106 Ga0105249_10001314 3300009553 Bacteria 21767
107 Ga0105249_10114671 3300009553 Bacteria 2552
108 Ga0105239_10407312 3300010375 Bacteria 1539
109 Ga0157370_10099924 3300013104 Bacteria 2719
110 Ga0163162_10137390 3300013306 Bacteria 2556
111 Ga0163162_10189386 3300013306 Bacteria 2184
112 Ga0163162_10532111 3300013306 Bacteria 1304
113 Ga0163163_10039963 3300014325 Bacteria 4580
114 Ga0213876_10005570 3300021384 Bacteria 6911
115 Ga0209026_1001360 3300025250 Bacteria 10913
116 Ga0209565_1000798 3300025263 Bacteria 18129
117 Ga0209673_1005598 3300025273 Bacteria 6277
118 Ga0209675_1015100 3300025291 Bacteria 2312
119 Ga0209676_1000169 3300025292 Bacteria 155600
120 Ga0209676_1000319 3300025292 Bacteria 93542
121 Ga0209564_1007084 3300025295 Bacteria 5866
122 Ga0209564_1018803 3300025295 Bacteria 2613
123 Ga0209564_1033664 3300025295 Bacteria 1518
124 Ga0209758_1000852 3300025297 Bacteria 42442
125 Ga0209758_1005712 3300025297 Bacteria 9388
126 Ga0209758_1011442 3300025297 Bacteria 5139
127 Ga0209050_1000053 3300025298 Bacteria 349521
128 Ga0209050_1000281 3300025298 Bacteria 108751
129 Ga0209050_1000722 3300025298 Bacteria 48344
130 Ga0209050_1031075 3300025298 Bacteria 1672
131 Ga0209256_1003409 3300025299 Bacteria 11199
132 Ga0209256_1014428 3300025299 Bacteria 2843
133 Ga0209256_1015542 3300025299 Bacteria 2653
134 Ga0209051_1001156 3300025303 Bacteria 23987
135 Ga0209257_1000036 3300025304 Bacteria 616006
136 Ga0209257_1000289 3300025304 Bacteria 110882
137 Ga0209257_1000845 3300025304 Bacteria 43868
138 Ga0209257_1003375 3300025304 Bacteria 13790
139 Ga0207710_10058605 3300025900 Bacteria 1741
140 Ga0207680_10011980 3300025903 Bacteria 4404
141 Ga0207643_10126190 3300025908 Bacteria 1519
142 Ga0207705_10140471 3300025909 Bacteria 1803
143 Ga0207705_10154354 3300025909 Bacteria 1722
144 Ga0207705_10185369 3300025909 Bacteria 1572
145 Ga0207705_10319527 3300025909 Bacteria 1193
146 Ga0207705_10343791 3300025909 Bacteria 1149
147 Ga0207705_10677738 3300025909 Bacteria 802
148 Ga0207707_10158906 3300025912 Bacteria 1976
149 Ga0207707_10231402 3300025912 Bacteria 1608
150 Ga0207707_10251109 3300025912 Bacteria 1536
151 Ga0207695_10001559 3300025913 Bacteria 37604
152 Ga0207695_10003977 3300025913 Bacteria 20402
153 Ga0207695_10006445 3300025913 Bacteria 15243
154 Ga0207695_10216015 3300025913 Bacteria 1826
155 Ga0207695_10699759 3300025913 Bacteria 894
156 Ga0207671_10140184 3300025914 Bacteria 1862
157 Ga0207671_10408991 3300025914 Bacteria 1079
158 Ga0207660_10088909 3300025917 Bacteria 2285
159 Ga0207657_10166919 3300025919 Bacteria 1785
160 Ga0207649_10309538 3300025920 Bacteria 1157
161 Ga0207652_10029023 3300025921 Bacteria 4620
162 Ga0207652_10425615 3300025921 Bacteria 1197
163 Ga0207681_10205575 3300025923 Bacteria 1514
164 Ga0207681_10317856 3300025923 Bacteria 1237
165 Ga0207694_10020522 3300025924 Bacteria 5000
166 Ga0207694_10132397 3300025924 Bacteria 1999
167 Ga0207650_10000033 3300025925 Bacteria 226809
168 Ga0207650_10450970 3300025925 Bacteria 1070
169 Ga0207644_10244387 3300025931 Bacteria 1430
170 Ga0207690_10042276 3300025932 Bacteria 2992
171 Ga0207709_10229421 3300025935 Bacteria 1344
172 Ga0207711_10001563 3300025941 Bacteria 21146
173 Ga0207711_10124667 3300025941 Bacteria 2303
174 Ga0207711_10433923 3300025941 Bacteria 1222
175 Ga0207689_10070978 3300025942 Bacteria 2861
176 Ga0207679_10485376 3300025945 Bacteria 1101
177 Ga0207667_10027861 3300025949 Bacteria 6142
178 Ga0207667_10041397 3300025949 Bacteria 4899
179 Ga0207712_10004694 3300025961 Bacteria 8637
180 Ga0207712_10036301 3300025961 Bacteria 3355
181 Ga0207712_10144345 3300025961 Bacteria 1830
182 Ga0207668_10000004 3300025972 Bacteria 201204
183 Ga0207668_10000217 3300025972 Bacteria 38890
184 Ga0207668_10000351 3300025972 Bacteria 29942
185 Ga0207668_10062976 3300025972 Bacteria 2614
186 Ga0207658_10000229 3300025986 Bacteria 58984
187 Ga0207658_10075922 3300025986 Bacteria 2558
188 Ga0207658_10304699 3300025986 Bacteria 1374
189 Ga0207703_10002722 3300026035 Bacteria 15149
190 Ga0207703_10116794 3300026035 Bacteria 2285
191 Ga0207639_10041338 3300026041 Bacteria 3448
192 Ga0207639_10374588 3300026041 Bacteria 1277
193 Ga0207702_10164391 3300026078 Bacteria 2029
194 Ga0207702_10538332 3300026078 Bacteria 1141
195 Ga0207702_10570115 3300026078 Bacteria 1109
196 Ga0207641_10002872 3300026088 Bacteria 15624
197 Ga0207641_10663299 3300026088 Bacteria 1025
198 Ga0207676_10000068 3300026095 Bacteria 104705
199 Ga0207676_10145231 3300026095 Bacteria 2037
200 Ga0207676_10426674 3300026095 Bacteria 1245
201 Ga0207674_10063275 3300026116 Bacteria 3734
202 Ga0207675_100492885 3300026118 Bacteria 1219
203 Ga0207683_10343114 3300026121 Bacteria 1370
204 Ga0207698_10061277 3300026142 Bacteria 2931
205 Ga0268266_10006348 3300028379 Bacteria 10836
206 Ga0268265_10000500 3300028380 Bacteria 40586
207 Ga0268265_10029542 3300028380 Bacteria 3936
208 Ga0268265_10069163 3300028380 Bacteria 2741
209 Ga0268265_10183396 3300028380 Bacteria 1800
210 Ga0268265_10378721 3300028380 Bacteria 1301
211 Ga0268264_10000032 3300028381 Bacteria 408337
212 Ga0268264_10747254 3300028381 Bacteria 974
213 Ga0268264_11131679 3300028381 Bacteria 792
214 Ga0307517_10037162 3300028786 Bacteria 5449
215 Ga0307515_10011325 3300028794 Bacteria 16927
216 Ga0307515_10114187 3300028794 Bacteria 3124
217 Ga0265338_10234268 3300028800 Bacteria 1364
218 Ga0307511_10012287 3300030521 Bacteria 8408
219 Ga0265760_10022154 3300031090 Bacteria 1840
220 Ga0265327_10001057 3300031251 Bacteria 38486
221 Ga0307513_10000045 3300031456 Bacteria 158626
222 Ga0307513_10031552 3300031456 Bacteria 5997
223 Ga0307513_10280783 3300031456 Bacteria 1443
224 Ga0307513_10281522 3300031456 Bacteria 1440
225 Ga0307513_10367071 3300031456 Bacteria 1183
226 Ga0307513_10434022 3300031456 Bacteria 1041
227 Ga0307508_10260704 3300031616 Bacteria 1328
228 Ga0307413_10129654 3300031824 Bacteria 1723
229 Ga0307409_100595541 3300031995 Bacteria 1092
230 Ga0307414_10476267 3300032004 Bacteria 1100
231 Ga0307414_11661486 3300032004 Bacteria 595
232 Ga0307411_10440859 3300032005 Bacteria 1087
233 Ga0307510_10020409 3300033180 Bacteria 7742
234 Ga0373944_0027524 3300035089 Bacteria 1686
235 Ga0373936_0003626 3300035113 Bacteria 5801
236 Ga0373943_0024771 3300035170 Bacteria 2801
237 Ga0373927_0001183 3300035695 Bacteria 19796
238 Ga0373937_0677727 3300036401 Bacteria 977
239 Ga0373925_0000199 3300037068 Bacteria 65400
240 Ga0373925_0475872 3300037068 Bacteria 1024
241 Ga0373925_1029911 3300037068 Bacteria 678
242 Ga0373925_1099925 3300037068 Bacteria 654
243 Ga0395900_0101879 3300037418 Bacteria 2949
244 Ga0395898_0066114 3300037466 Bacteria 3504
245 Ga0395898_0355159 3300037466 Bacteria 1398
246 Ga0395905_0031043 3300037471 Bacteria 5032
247 Ga0395905_0341520 3300037471 Bacteria 1388
248 Ga0395905_0529487 3300037471 Bacteria 1079
249 Ga0436365_1452750 3300039437 Bacteria 7110
250 Ga0451835_0368544 3300041492 Bacteria 801
251 Ga0451849_0283330 3300041505 Bacteria 923
252 Ga0439441_122706 3300042001 Bacteria 597
253 Ga0439442_066304 3300042002 Bacteria 767
254 Ga0439445_0007300 3300042004 Bacteria 2563
255 Ga0439457_071999 3300042014 Bacteria 789
256 Ga0439446_0003888 3300042156 Bacteria 3750
257 Ga0439434_0083505 3300042435 Bacteria 1016
258 Ga0439459_0034174 3300042438 Bacteria 1050
259 Ga0466965_0360363 3300044683 Bacteria 798
260 Ga0466961_0170379 3300044693 Bacteria 1354
261 Ga0466968_0258577 3300044735 Bacteria 829
262 Ga0466960_0392049 3300044901 Bacteria 798
263 Ga0466967_1262238 3300045976 Bacteria 736
264 Ga0495627_000508 3300046453 Bacteria 32410
265 Ga0495590_0000442 3300046457 Bacteria 20633
266 Ga0495590_0231745 3300046457 Bacteria 684
267 Ga0495629_0010325 3300046459 Bacteria 6801
268 Ga0495638_0000403 3300046460 Bacteria 52881
269 Ga0495638_0001416 3300046460 Bacteria 21777
270 Ga0495638_0001710 3300046460 Bacteria 19321
271 Ga0495638_0008799 3300046460 Bacteria 7129
272 Ga0495638_0047592 3300046460 Bacteria 2688
273 Ga0495638_0097790 3300046460 Bacteria 1759
274 Ga0495650_0000207 3300046471 Bacteria 127568
275 Ga0495650_0007609 3300046471 Bacteria 6471
276 Ga0495650_0028332 3300046471 Bacteria 2574
277 Ga0495585_0047761 3300046492 Bacteria 2383
278 Ga0495583_0000025 3300046506 Bacteria 263775
279 Ga0495583_0170381 3300046506 Bacteria 895
280 Ga0495606_0014729 3300046507 Bacteria 6080
281 Ga0495606_0092696 3300046507 Bacteria 1855
282 Ga0495606_0303810 3300046507 Bacteria 863
283 Ga0495610_0000507 3300046512 Bacteria 39719
284 Ga0495610_0003178 3300046512 Bacteria 13015
285 Ga0495610_0004190 3300046512 Bacteria 10769
286 Ga0495610_0066321 3300046512 Bacteria 1700
287 Ga0495610_0205817 3300046512 Bacteria 803
288 Ga0495616_0000458 3300046513 Bacteria 31083
289 Ga0495616_0062615 3300046513 Bacteria 1821
290 Ga0495628_0123776 3300046516 Bacteria 1982
291 Ga0495630_0213459 3300046517 Bacteria 1473
292 Ga0495631_0005691 3300046518 Bacteria 6501
293 Ga0495631_0199626 3300046518 Bacteria 855
294 Ga0495632_0004692 3300046519 Bacteria 9233
295 Ga0495637_0008261 3300046520 Bacteria 5118
296 Ga0495637_0099495 3300046520 Bacteria 1138
297 Ga0495643_0021690 3300046522 Bacteria 3678
298 Ga0495643_0184483 3300046522 Bacteria 1011
299 Ga0495648_0000039 3300046524 Bacteria 185430
300 Ga0495648_0027135 3300046524 Bacteria 3840
301 Ga0495648_0125826 3300046524 Bacteria 1370
302 Ga0495654_0000016 3300046530 Bacteria 306416
303 Ga0495654_0016101 3300046530 Bacteria 3960
304 Ga0495654_0141754 3300046530 Bacteria 1070
305 Ga0495587_0312642 3300046536 Bacteria 878
306 Ga0495621_0078037 3300046539 Bacteria 1231
307 Ga0495597_0001314 3300046542 Bacteria 18224
308 Ga0495645_0056303 3300046543 Bacteria 2855
309 Ga0495645_0588841 3300046543 Bacteria 685
310 Ga0495622_0000865 3300046557 Bacteria 16582
311 Ga0495633_0267424 3300046558 Bacteria 779
312 Ga0495668_0000040 3300046616 Bacteria 230681
313 Ga0495668_0002977 3300046616 Bacteria 13250
314 Ga0495668_0040226 3300046616 Bacteria 2608
315 Ga0495668_0054716 3300046616 Bacteria 2205
316 Ga0495668_0081943 3300046616 Bacteria 1770
317 Ga0495668_0188161 3300046616 Bacteria 1130
318 Ga0495668_0244823 3300046616 Bacteria 982
319 Ga0495625_0000043 3300046660 Bacteria 205715
320 Ga0495625_0002221 3300046660 Bacteria 21452
321 Ga0495625_0017877 3300046660 Bacteria 5542
322 Ga0495625_0032948 3300046660 Bacteria 3836
323 Ga0495625_0161776 3300046660 Bacteria 1499
324 Ga0495625_0290462 3300046660 Bacteria 1049
325 Ga0495669_0000222 3300046684 Bacteria 34149
326 Ga0495669_0033229 3300046684 Bacteria 2270
327 Ga0495624_0310423 3300046690 Bacteria 950
328 Ga0495670_0119789 3300046691 Bacteria 1367
329 Ga0495670_0226056 3300046691 Bacteria 995
330 Ga0495670_0379580 3300046691 Bacteria 762
331 Ga0495589_0008147 3300046794 Bacteria 5479
332 Ga0495660_0123446 3300046810 Bacteria 1307
333 Ga0495660_0171602 3300046810 Bacteria 1056
334 Ga0495660_0228295 3300046810 Bacteria 874
335 Ga0495674_0384156 3300047319 Bacteria 1136
336 Ga0495672_0001670 3300047320 Bacteria 21514
337 Ga0495683_0108043 3300047323 Bacteria 1331
338 Ga0495687_017228 3300047443 Bacteria 3611
339 Ga0495677_0017610 3300047445 Bacteria 2590
340 Ga0495685_065414 3300047447 Bacteria 1222
341 Ga0495673_0000148 3300047469 Bacteria 124135
342 Ga0495673_0000340 3300047469 Bacteria 59502
343 Ga0495673_0001397 3300047469 Bacteria 19412
344 Ga0495681_0045869 3300047470 Bacteria 2088
345 Ga0495681_0085280 3300047470 Bacteria 1403
346 Ga0495686_0006516 3300047472 Bacteria 8915
347 Ga0495686_0037836 3300047472 Bacteria 3089
348 Ga0495686_0056568 3300047472 Bacteria 2450
349 Ga0495593_0063747 3300047673 Bacteria 1924
350 Ga0495602_0220390 3300048088 Bacteria 1433
351 Ga0496102_0059766 3300048905 Bacteria 3486
352 Ga0496102_0328189 3300048905 Bacteria 1441
353 Ga0496103_0129673 3300048906 Bacteria 1610
354 Ga0496106_0013519 3300048909 Bacteria 6028
355 Ga0496107_0000097 3300048910 Bacteria 42547
356 Ga0496107_0118635 3300048910 Bacteria 1948
357 Ga0496110_0524962 3300048913 Bacteria 1077
358 Ga0496112_0875825 3300048915 Bacteria 821
359 Ga0496115_0001700 3300048918 Bacteria 15774
360 Ga0496115_0037132 3300048918 Bacteria 3860
361 Ga0496115_0404674 3300048918 Bacteria 1107
362 Ga0496116_0176985 3300048919 Bacteria 1147
363 Ga0496117_0005914 3300048920 Bacteria 12632
364 Ga0496118_0036784 3300048921 Bacteria 3951
365 Ga0496119_0034779 3300048922 Bacteria 3310
366 Ga0496121_0000042 3300048924 Bacteria 342304
367 Ga0496121_0149724 3300048924 Bacteria 1719
368 Ga0496123_0149296 3300048926 Bacteria 1264
369 Ga0496123_0292767 3300048926 Bacteria 781
370 Ga0496124_0006743 3300048927 Bacteria 12418
371 Ga0496125_0037584 3300048928 Bacteria 4207
372 Ga0496126_0045491 3300048929 Bacteria 4033
373 Ga0496126_0071919 3300048929 Bacteria 3078
374 Ga0495678_001710 3300049459 Bacteria 16479
375 Ga0495682_0070096 3300049460 Bacteria 1262
376 Ga0501034_0431139 3300049571 Bacteria 1238
377 Ga0501034_0555471 3300049571 Bacteria 1057
378 Ga0501037_0157330 3300049573 Bacteria 1621
379 Ga0501047_0001866 3300049581 Bacteria 20290
380 Ga0501047_0661587 3300049581 Bacteria 863
381 Ga0501238_000791 3300049671 Bacteria 3584
382 Ga0501238_000834 3300049671 Bacteria 3503
383 Ga0501035_0254681 3300049822 Bacteria 1490
384 Ga0501035_0546302 3300049822 Bacteria 949
385 Ga0501044_0045682 3300049823 Bacteria 4537
386 Ga0501044_0254015 3300049823 Bacteria 1698
387 Ga0501044_1064853 3300049823 Bacteria 679
388 nmdc:mga03683_140170_c1 3300050489 Bacteria 1087
389 nmdc:mga03n38_28417_c1 3300050490 Bacteria 2331
390 nmdc:mga00v17_3414_c1 3300050491 Bacteria 8209
391 nmdc:mga0k408_15526_c1 3300050493 Bacteria 4211
392 nmdc:mga0k408_24716_c1 3300050493 Bacteria 3398
393 nmdc:mga0k408_260282_c1 3300050493 Bacteria 1036
394 nmdc:mga0k408_58044_c1 3300050493 Bacteria 2248
395 nmdc:mga06z11_51432_c1 3300050494 Bacteria 2110
396 nmdc:mga04h51_5466_c1 3300050495 Bacteria 3241
397 nmdc:mga07m45_147261_c1 3300050496 Bacteria 1365
398 nmdc:mga07m45_304052_c1 3300050496 Bacteria 927
399 nmdc:mga0sz30_2263_c1 3300050516 Bacteria 6886
400 Ga0500635_0000249 3300053080 Bacteria 23486
401 Ga0500578_0000041 3300053086 Bacteria 129580
402 Ga0500578_0089340 3300053086 Bacteria 1956
403 Ga0500578_0381319 3300053086 Bacteria 817
404 Ga0500643_016455 3300053087 Bacteria 2504
405 Ga0500643_049529 3300053087 Bacteria 1204
406 Ga0500643_063744 3300053087 Bacteria 1031
407 Ga0500644_0000368 3300053088 Bacteria 22094
408 Ga0500647_0085417 3300053091 Bacteria 1513
409 Ga0500583_0141359 3300053092 Bacteria 1196
410 Ga0500651_0028207 3300053093 Bacteria 3529
411 Ga0500641_0267382 3300053096 Bacteria 712
412 Ga0500641_0345672 3300053096 Bacteria 599
413 Ga0500650_0049221 3300053098 Bacteria 1956
414 Ga0500650_0085063 3300053098 Bacteria 1480
415 Ga0500555_000638 3300053103 Bacteria 13543
416 Ga0500555_048537 3300053103 Bacteria 1166
417 Ga0500555_115030 3300053103 Bacteria 675
418 Ga0500556_0002669 3300053104 Bacteria 5559
419 Ga0500556_0065173 3300053104 Bacteria 1350
420 Ga0500562_000558 3300053108 Bacteria 8992
421 Ga0500562_001723 3300053108 Bacteria 5444
422 Ga0500591_228675 3300053115 Bacteria 604
423 Ga0500594_0002660 3300053118 Bacteria 3882
424 Ga0500595_018188 3300053119 Bacteria 2575
425 Ga0500595_121113 3300053119 Bacteria 739
426 Ga0500597_311384 3300053120 Bacteria 625
427 Ga0500607_051000 3300053121 Bacteria 2202
428 Ga0500608_000105 3300053122 Bacteria 34366
429 Ga0500608_003564 3300053122 Bacteria 5863
430 Ga0500608_097725 3300053122 Bacteria 1364
431 Ga0500614_006173 3300053123 Bacteria 2517
432 Ga0500614_030013 3300053123 Bacteria 1323
433 Ga0500618_000022 3300053125 Bacteria 157907
434 Ga0500642_0140105 3300053130 Bacteria 1134
435 Ga0500655_030393 3300053133 Bacteria 1039
436 Ga0500655_089585 3300053133 Bacteria 638
437 Ga0500658_0089400 3300053134 Bacteria 1329
438 Ga0500559_0000806 3300053136 Bacteria 20467
439 Ga0500559_0002565 3300053136 Bacteria 9318
440 Ga0500559_0021623 3300053136 Bacteria 2727
441 Ga0500559_0072119 3300053136 Bacteria 1556
442 Ga0500564_000200 3300053138 Bacteria 16311
443 Ga0500590_055569 3300053148 Bacteria 2002
444 Ga0500603_049880 3300053150 Bacteria 1142
445 Ga0500616_0063656 3300053153 Bacteria 1901
446 Ga0500616_0075223 3300053153 Bacteria 1710
447 Ga0500619_003258 3300053154 Bacteria 3291
448 Ga0500620_219383 3300053155 Bacteria 643
449 Ga0500622_0004450 3300053156 Bacteria 8797
450 Ga0500622_0010724 3300053156 Bacteria 5015
451 Ga0500622_0015383 3300053156 Bacteria 4097
452 Ga0500624_001834 3300053157 Bacteria 3075
453 Ga0500627_0007431 3300053158 Bacteria 3815
454 Ga0500633_0214097 3300053160 Bacteria 720
455 Ga0500639_219201 3300053163 Bacteria 796
456 Ga0500636_0027596 3300053177 Bacteria 3354
457 Ga0500637_0021661 3300053178 Bacteria 3493
458 Ga0500611_058341 3300053727 Bacteria 906
459 Ga0500645_006258 3300053730 Bacteria 4270
460 Ga0500645_171436 3300053730 Bacteria 592
461 Ga0500609_001881 3300053731 Bacteria 3044
462 Ga0500596_002327 3300053735 Bacteria 3759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10005570 Ga0213876_100055704 144
2 3300039437 Ga0436365_1452750 Ga0436365_1452750_2793_3317 144
3 3300048910 Ga0496107_0118635 Ga0496107_0118635_967_1497 157
4 3300048905 Ga0496102_0328189 Ga0496102_0328189_143_625 160
5 3300005841 Ga0068863_100759328 Ga0068863_1007593282 161
6 3300026088 Ga0207641_10663299 Ga0207641_106632992 161
7 3300031090 Ga0265760_10022154 Ga0265760_100221543 161
8 3300053104 Ga0500556_0065173 Ga0500556_0065173_348_872 161
9 3300005456 Ga0070678_100511115 Ga0070678_1005111151 162
10 3300005618 Ga0068864_101060261 Ga0068864_1010602612 162
11 3300005843 Ga0068860_101289221 Ga0068860_1012892211 162
12 3300006358 Ga0068871_101012782 Ga0068871_1010127822 162
13 3300006881 Ga0068865_100005392 Ga0068865_1000053924 162
14 3300009098 Ga0105245_10449107 Ga0105245_104491072 162
15 3300009177 Ga0105248_10283916 Ga0105248_102839162 162
16 3300013306 Ga0163162_10189386 Ga0163162_101893863 162
17 3300026095 Ga0207676_10426674 Ga0207676_104266742 162
18 3300028381 Ga0268264_11131679 Ga0268264_111316792 162
19 3300046516 Ga0495628_0123776 Ga0495628_0123776_1428_1949 162
20 3300046517 Ga0495630_0213459 Ga0495630_0213459_601_1122 162
21 3300046543 Ga0495645_0056303 Ga0495645_0056303_363_953 162
22 3300047319 Ga0495674_0384156 Ga0495674_0384156_262_852 162
23 3300049573 Ga0501037_0157330 Ga0501037_0157330_926_1456 162
24 3300049822 Ga0501035_0546302 Ga0501035_0546302_187_717 162
25 3300049823 Ga0501044_0045682 Ga0501044_0045682_2613_3143 162
26 3300025945 Ga0207679_10485376 Ga0207679_104853762 163
27 3300005347 Ga0070668_100004126 Ga0070668_1000041263 164
28 3300005548 Ga0070665_100000198 Ga0070665_10000019866 164
29 3300005844 Ga0068862_100031033 Ga0068862_1000310335 164
30 3300009177 Ga0105248_10136071 Ga0105248_101360713 164
31 3300009553 Ga0105249_10114671 Ga0105249_101146713 164
32 3300025941 Ga0207711_10124667 Ga0207711_101246673 164
33 3300025961 Ga0207712_10036301 Ga0207712_100363013 164
34 3300025972 Ga0207668_10000004 Ga0207668_1000000460 164
35 3300028380 Ga0268265_10029542 Ga0268265_100295425 164
36 3300046684 Ga0495669_0000222 Ga0495669_0000222_12799_13329 164
37 3300047445 Ga0495677_0017610 Ga0495677_0017610_1179_1709 164
38 3300005614 Ga0068856_100269610 Ga0068856_1002696103 165
39 3300031456 Ga0307513_10031552 Ga0307513_100315526 165
40 3300037068 Ga0373925_1099925 Ga0373925_1099925_44_571 165
41 3300005539 Ga0068853_100056100 Ga0068853_1000561004 166
42 3300026041 Ga0207639_10041338 Ga0207639_100413384 166
43 3300053087 Ga0500643_016455 Ga0500643_016455_510_1034 166
44 3300005366 Ga0070659_100068160 Ga0070659_1000681604 169
45 3300025932 Ga0207690_10042276 Ga0207690_100422762 169
46 3300028800 Ga0265338_10234268 Ga0265338_102342682 169
47 3300047472 Ga0495686_0056568 Ga0495686_0056568_1928_2437 169
48 3300036401 Ga0373937_0677727 Ga0373937_0677727_231_767 171
49 3300025986 Ga0207658_10304699 Ga0207658_103046993 172
50 3300031456 Ga0307513_10000045 Ga0307513_1000004535 172
51 iso_pu_bacteria 2643221598 2643999729 172
52 3300005327 Ga0070658_10067815 Ga0070658_100678152 173
53 3300025909 Ga0207705_10140471 Ga0207705_101404712 173
54 3300025909 Ga0207705_10677738 Ga0207705_106777382 173
55 iso_pu_bacteria 2510917020 2511122820 173
56 iso_pu_bacteria 2582581279 2585150144 173
57 iso_pu_bacteria 2582581280 2585154615 173
58 iso_pu_bacteria 2582581293 2585194761 173
59 iso_pu_bacteria 2585428106 2587919801 173
60 iso_pu_bacteria 2643221545 2643750469 173
61 iso_pu_bacteria 2643221552 2643780376 173
62 iso_pu_bacteria 2643221583 2643922675 173
63 iso_pu_bacteria 2643221584 2643929694 173
64 iso_pu_bacteria 2643221614 2644087512 173
65 iso_pu_bacteria 2643221640 2644223572 173
66 iso_pu_bacteria 2643221642 2644236338 173
67 iso_pu_bacteria 2643221661 2644344444 173
68 iso_pu_bacteria 2643221666 2644366872 173
69 iso_pu_bacteria 2643221691 2644507359 173
70 iso_pu_bacteria 2818991435 2819537679 173
71 iso_pu_bacteria 2818991454 2819647456 173
72 iso_pu_bacteria 2857504554 2857505955 173
73 iso_pu_bacteria 2884960567 2884963696 173
74 iso_pu_bacteria 2928531327 2928531941 173
75 3300005327 Ga0070658_10378644 Ga0070658_103786441 174
76 3300005327 Ga0070658_10766548 Ga0070658_107665481 174
77 3300005331 Ga0070670_100000004 Ga0070670_100000004160 174
78 3300005335 Ga0070666_10147768 Ga0070666_101477683 174
79 3300005341 Ga0070691_10006066 Ga0070691_100060668 174
80 3300005347 Ga0070668_100000279 Ga0070668_10000027927 174
81 3300005367 Ga0070667_100000175 Ga0070667_10000017562 174
82 3300005458 Ga0070681_10059441 Ga0070681_100594415 174
83 3300005458 Ga0070681_10272226 Ga0070681_102722263 174
84 3300005530 Ga0070679_100211985 Ga0070679_1002119853 174
85 3300005530 Ga0070679_100583704 Ga0070679_1005837042 174
86 3300005530 Ga0070679_100930446 Ga0070679_1009304461 174
87 3300005548 Ga0070665_100000738 Ga0070665_10000073828 174
88 3300005563 Ga0068855_100042938 Ga0068855_1000429387 174
89 3300005563 Ga0068855_100152030 Ga0068855_1001520305 174
90 3300005563 Ga0068855_100273814 Ga0068855_1002738142 174
91 3300005617 Ga0068859_100027712 Ga0068859_1000277124 174
92 3300005618 Ga0068864_100000082 Ga0068864_10000008271 174
93 3300005841 Ga0068863_100002562 Ga0068863_1000025628 174
94 3300005842 Ga0068858_100003392 Ga0068858_10000339213 174
95 3300005843 Ga0068860_100000077 Ga0068860_100000077160 174
96 3300005844 Ga0068862_100000183 Ga0068862_10000018339 174
97 3300005844 Ga0068862_101457999 Ga0068862_1014579991 174
98 3300006048 Ga0075363_100043191 Ga0075363_1000431913 174
99 3300006051 Ga0075364_10004307 Ga0075364_1000430710 174
100 3300006178 Ga0075367_10009900 Ga0075367_100099004 174
101 3300006195 Ga0075366_10020867 Ga0075366_100208673 174
102 3300006353 Ga0075370_10080534 Ga0075370_100805343 174
103 3300006931 Ga0097620_100027712 Ga0097620_1000277124 174
104 3300009011 Ga0105251_10298832 Ga0105251_102988322 174
105 3300009093 Ga0105240_10000428 Ga0105240_1000042843 174
106 3300009093 Ga0105240_10190741 Ga0105240_101907415 174
107 3300009093 Ga0105240_10778012 Ga0105240_107780122 174
108 3300009101 Ga0105247_10257773 Ga0105247_102577732 174
109 3300009176 Ga0105242_10829404 Ga0105242_108294042 174
110 3300009177 Ga0105248_10001822 Ga0105248_1000182223 174
111 3300009177 Ga0105248_10467961 Ga0105248_104679613 174
112 3300009545 Ga0105237_10621283 Ga0105237_106212832 174
113 3300009551 Ga0105238_10162526 Ga0105238_101625264 174
114 3300009551 Ga0105238_11616959 Ga0105238_116169591 174
115 3300009553 Ga0105249_10001314 Ga0105249_100013146 174
116 3300010375 Ga0105239_10407312 Ga0105239_104073121 174
117 3300013306 Ga0163162_10137390 Ga0163162_101373903 174
118 3300013306 Ga0163162_10532111 Ga0163162_105321112 174
119 3300014325 Ga0163163_10039963 Ga0163163_100399634 174
120 3300025900 Ga0207710_10058605 Ga0207710_100586053 174
121 3300025903 Ga0207680_10011980 Ga0207680_100119803 174
122 3300025909 Ga0207705_10154354 Ga0207705_101543542 174
123 3300025909 Ga0207705_10185369 Ga0207705_101853693 174
124 3300025909 Ga0207705_10319527 Ga0207705_103195271 174
125 3300025909 Ga0207705_10343791 Ga0207705_103437912 174
126 3300025912 Ga0207707_10158906 Ga0207707_101589063 174
127 3300025912 Ga0207707_10231402 Ga0207707_102314022 174
128 3300025913 Ga0207695_10001559 Ga0207695_1000155932 174
129 3300025913 Ga0207695_10006445 Ga0207695_1000644514 174
130 3300025913 Ga0207695_10216015 Ga0207695_102160154 174
131 3300025913 Ga0207695_10699759 Ga0207695_106997592 174
132 3300025914 Ga0207671_10408991 Ga0207671_104089912 174
133 3300025919 Ga0207657_10166919 Ga0207657_101669192 174
134 3300025920 Ga0207649_10309538 Ga0207649_103095382 174
135 3300025921 Ga0207652_10029023 Ga0207652_100290235 174
136 3300025921 Ga0207652_10425615 Ga0207652_104256152 174
137 3300025923 Ga0207681_10317856 Ga0207681_103178561 174
138 3300025924 Ga0207694_10132397 Ga0207694_101323973 174
139 3300025925 Ga0207650_10000033 Ga0207650_10000033254 174
140 3300025941 Ga0207711_10001563 Ga0207711_1000156313 174
141 3300025941 Ga0207711_10433923 Ga0207711_104339231 174
142 3300025949 Ga0207667_10027861 Ga0207667_100278611 174
143 3300025949 Ga0207667_10041397 Ga0207667_100413975 174
144 3300025961 Ga0207712_10004694 Ga0207712_100046946 174
145 3300025972 Ga0207668_10000217 Ga0207668_1000021714 174
146 3300025972 Ga0207668_10000351 Ga0207668_1000035124 174
147 3300025986 Ga0207658_10000229 Ga0207658_1000022927 174
148 3300026035 Ga0207703_10002722 Ga0207703_100027223 174
149 3300026041 Ga0207639_10374588 Ga0207639_103745882 174
150 3300026078 Ga0207702_10164391 Ga0207702_101643912 174
151 3300026078 Ga0207702_10538332 Ga0207702_105383322 174
152 3300026088 Ga0207641_10002872 Ga0207641_1000287211 174
153 3300026095 Ga0207676_10000068 Ga0207676_1000006854 174
154 3300026121 Ga0207683_10343114 Ga0207683_103431142 174
155 3300028379 Ga0268266_10006348 Ga0268266_1000634810 174
156 3300028380 Ga0268265_10000500 Ga0268265_1000050031 174
157 3300028380 Ga0268265_10378721 Ga0268265_103787212 174
158 3300028381 Ga0268264_10000032 Ga0268264_10000032255 174
159 3300028786 Ga0307517_10037162 Ga0307517_100371626 174
160 3300031616 Ga0307508_10260704 Ga0307508_102607043 174
161 3300035089 Ga0373944_0027524 Ga0373944_0027524_551_1075 174
162 3300035113 Ga0373936_0003626 Ga0373936_0003626_4511_5035 174
163 3300035170 Ga0373943_0024771 Ga0373943_0024771_1262_1852 174
164 3300035695 Ga0373927_0001183 Ga0373927_0001183_19065_19589 174
165 3300037068 Ga0373925_0000199 Ga0373925_0000199_37564_38088 174
166 3300037068 Ga0373925_0475872 Ga0373925_0475872_485_1009 174
167 3300037068 Ga0373925_1029911 Ga0373925_1029911_130_654 174
168 3300037418 Ga0395900_0101879 Ga0395900_0101879_527_1051 174
169 3300037466 Ga0395898_0066114 Ga0395898_0066114_747_1271 174
170 3300037466 Ga0395898_0355159 Ga0395898_0355159_195_770 174
171 3300037471 Ga0395905_0031043 Ga0395905_0031043_2230_2754 174
172 3300037471 Ga0395905_0341520 Ga0395905_0341520_133_708 174
173 3300044693 Ga0466961_0170379 Ga0466961_0170379_55_648 174
174 3300046459 Ga0495629_0010325 Ga0495629_0010325_937_1461 174
175 3300046506 Ga0495583_0170381 Ga0495583_0170381_228_752 174
176 3300046507 Ga0495606_0303810 Ga0495606_0303810_59_583 174
177 3300046512 Ga0495610_0066321 Ga0495610_0066321_846_1370 174
178 3300046522 Ga0495643_0021690 Ga0495643_0021690_1459_1983 174
179 3300046536 Ga0495587_0312642 Ga0495587_0312642_50_574 174
180 3300046542 Ga0495597_0001314 Ga0495597_0001314_4208_4732 174
181 3300046543 Ga0495645_0588841 Ga0495645_0588841_125_649 174
182 3300046557 Ga0495622_0000865 Ga0495622_0000865_15437_15961 174
183 3300046558 Ga0495633_0267424 Ga0495633_0267424_146_670 174
184 3300046616 Ga0495668_0081943 Ga0495668_0081943_271_795 174
185 3300046660 Ga0495625_0161776 Ga0495625_0161776_938_1462 174
186 3300046684 Ga0495669_0033229 Ga0495669_0033229_978_1502 174
187 3300046690 Ga0495624_0310423 Ga0495624_0310423_296_820 174
188 3300046691 Ga0495670_0226056 Ga0495670_0226056_214_738 174
189 3300047443 Ga0495687_017228 Ga0495687_017228_367_891 174
190 3300047447 Ga0495685_065414 Ga0495685_065414_185_709 174
191 3300047673 Ga0495593_0063747 Ga0495593_0063747_439_963 174
192 3300048088 Ga0495602_0220390 Ga0495602_0220390_86_610 174
193 3300048905 Ga0496102_0059766 Ga0496102_0059766_1095_1619 174
194 3300048906 Ga0496103_0129673 Ga0496103_0129673_799_1323 174
195 3300048913 Ga0496110_0524962 Ga0496110_0524962_290_814 174
196 3300048915 Ga0496112_0875825 Ga0496112_0875825_263_787 174
197 3300048918 Ga0496115_0037132 Ga0496115_0037132_3289_3813 174
198 3300048918 Ga0496115_0404674 Ga0496115_0404674_270_794 174
199 3300048919 Ga0496116_0176985 Ga0496116_0176985_382_906 174
200 3300048920 Ga0496117_0005914 Ga0496117_0005914_7515_8039 174
201 3300048921 Ga0496118_0036784 Ga0496118_0036784_832_1359 174
202 3300048922 Ga0496119_0034779 Ga0496119_0034779_546_1070 174
203 3300048924 Ga0496121_0000042 Ga0496121_0000042_125023_125547 174
204 3300049460 Ga0495682_0070096 Ga0495682_0070096_52_576 174
205 3300049581 Ga0501047_0001866 Ga0501047_0001866_2932_3462 174
206 3300049581 Ga0501047_0661587 Ga0501047_0661587_208_732 174
207 3300049823 Ga0501044_0254015 Ga0501044_0254015_1111_1635 174
208 3300049823 Ga0501044_1064853 Ga0501044_1064853_94_618 174
209 3300050490 nmdc:mga03n38_28417_c1 nmdc:mga03n38_28417_c1_734_1258 174
210 3300050491 nmdc:mga00v17_3414_c1 nmdc:mga00v17_3414_c1_1016_1540 174
211 3300050493 nmdc:mga0k408_24716_c1 nmdc:mga0k408_24716_c1_1124_1648 174
212 3300050494 nmdc:mga06z11_51432_c1 nmdc:mga06z11_51432_c1_1253_1777 174
213 3300050495 nmdc:mga04h51_5466_c1 nmdc:mga04h51_5466_c1_1935_2459 174
214 3300053080 Ga0500635_0000249 Ga0500635_0000249_14176_14700 174
215 3300053086 Ga0500578_0089340 Ga0500578_0089340_913_1437 174
216 3300053091 Ga0500647_0085417 Ga0500647_0085417_565_1089 174
217 3300053092 Ga0500583_0141359 Ga0500583_0141359_212_736 174
218 3300053093 Ga0500651_0028207 Ga0500651_0028207_246_770 174
219 3300053096 Ga0500641_0345672 Ga0500641_0345672_34_558 174
220 3300053103 Ga0500555_000638 Ga0500555_000638_8699_9223 174
221 3300053115 Ga0500591_228675 Ga0500591_228675_53_577 174
222 3300053119 Ga0500595_121113 Ga0500595_121113_109_633 174
223 3300053120 Ga0500597_311384 Ga0500597_311384_28_552 174
224 3300053121 Ga0500607_051000 Ga0500607_051000_836_1360 174
225 3300053122 Ga0500608_003564 Ga0500608_003564_169_693 174
226 3300053123 Ga0500614_030013 Ga0500614_030013_597_1121 174
227 3300053130 Ga0500642_0140105 Ga0500642_0140105_96_620 174
228 3300053136 Ga0500559_0072119 Ga0500559_0072119_150_674 174
229 3300053148 Ga0500590_055569 Ga0500590_055569_111_635 174
230 3300053150 Ga0500603_049880 Ga0500603_049880_563_1087 174
231 3300053153 Ga0500616_0063656 Ga0500616_0063656_680_1207 174
232 3300053154 Ga0500619_003258 Ga0500619_003258_1176_1700 174
233 3300053155 Ga0500620_219383 Ga0500620_219383_63_587 174
234 3300053157 Ga0500624_001834 Ga0500624_001834_1742_2266 174
235 3300053163 Ga0500639_219201 Ga0500639_219201_110_634 174
236 3300053177 Ga0500636_0027596 Ga0500636_0027596_668_1192 174
237 3300053178 Ga0500637_0021661 Ga0500637_0021661_229_753 174
238 3300053735 Ga0500596_002327 Ga0500596_002327_3126_3650 174
239 3300005331 Ga0070670_100226147 Ga0070670_1002261472 175
240 3300005334 Ga0068869_100056322 Ga0068869_1000563224 175
241 3300005347 Ga0070668_100008889 Ga0070668_1000088893 175
242 3300005353 Ga0070669_100212242 Ga0070669_1002122422 175
243 3300005355 Ga0070671_100079951 Ga0070671_1000799513 175
244 3300005618 Ga0068864_100505213 Ga0068864_1005052133 175
245 3300005719 Ga0068861_100720893 Ga0068861_1007208932 175
246 3300005840 Ga0068870_10089148 Ga0068870_100891482 175
247 3300005841 Ga0068863_100027662 Ga0068863_1000276627 175
248 3300005842 Ga0068858_100083260 Ga0068858_1000832603 175
249 3300005843 Ga0068860_100003426 Ga0068860_1000034266 175
250 3300005844 Ga0068862_100021079 Ga0068862_1000210792 175
251 3300005844 Ga0068862_100106589 Ga0068862_1001065894 175
252 3300005844 Ga0068862_100736706 Ga0068862_1007367062 175
253 3300025908 Ga0207643_10126190 Ga0207643_101261902 175
254 3300025923 Ga0207681_10205575 Ga0207681_102055753 175
255 3300025925 Ga0207650_10450970 Ga0207650_104509703 175
256 3300025931 Ga0207644_10244387 Ga0207644_102443872 175
257 3300025942 Ga0207689_10070978 Ga0207689_100709782 175
258 3300025961 Ga0207712_10144345 Ga0207712_101443451 175
259 3300025972 Ga0207668_10062976 Ga0207668_100629762 175
260 3300025986 Ga0207658_10075922 Ga0207658_100759223 175
261 3300026035 Ga0207703_10116794 Ga0207703_101167941 175
262 3300026095 Ga0207676_10145231 Ga0207676_101452313 175
263 3300026116 Ga0207674_10063275 Ga0207674_100632755 175
264 3300026118 Ga0207675_100492885 Ga0207675_1004928853 175
265 3300028380 Ga0268265_10069163 Ga0268265_100691634 175
266 3300028380 Ga0268265_10183396 Ga0268265_101833963 175
267 3300028381 Ga0268264_10747254 Ga0268264_107472541 175
268 3300042002 Ga0439442_066304 Ga0439442_066304_152_679 175
269 3300042004 Ga0439445_0007300 Ga0439445_0007300_1942_2469 175
270 3300042014 Ga0439457_071999 Ga0439457_071999_40_570 175
271 3300044901 Ga0466960_0392049 Ga0466960_0392049_125_742 175
272 3300049571 Ga0501034_0555471 Ga0501034_0555471_28_561 175
273 3300050496 nmdc:mga07m45_304052_c1 nmdc:mga07m45_304052_c1_59_586 175
274 3300053103 Ga0500555_115030 Ga0500555_115030_120_656 175
275 3300053108 Ga0500562_000558 Ga0500562_000558_4298_4825 175
276 3300005336 Ga0070680_100057923 Ga0070680_1000579235 176
277 3300005458 Ga0070681_10469255 Ga0070681_104692551 176
278 3300005616 Ga0068852_100049814 Ga0068852_1000498145 176
279 3300009093 Ga0105240_10593550 Ga0105240_105935503 176
280 3300013104 Ga0157370_10099924 Ga0157370_100999241 176
281 3300025912 Ga0207707_10251109 Ga0207707_102511094 176
282 3300025913 Ga0207695_10003977 Ga0207695_100039774 176
283 3300025917 Ga0207660_10088909 Ga0207660_100889093 176
284 3300025935 Ga0207709_10229421 Ga0207709_102294212 176
285 3300026078 Ga0207702_10570115 Ga0207702_105701153 176
286 3300026142 Ga0207698_10061277 Ga0207698_100612774 176
287 3300031251 Ga0265327_10001057 Ga0265327_1000105739 176
288 3300031824 Ga0307413_10129654 Ga0307413_101296542 176
289 3300032004 Ga0307414_11661486 Ga0307414_116614861 176
290 3300032005 Ga0307411_10440859 Ga0307411_104408592 176
291 3300044735 Ga0466968_0258577 Ga0466968_0258577_15_545 176
292 3300045976 Ga0466967_1262238 Ga0466967_1262238_97_630 176
293 3300049571 Ga0501034_0431139 Ga0501034_0431139_365_895 176
294 3300049822 Ga0501035_0254681 Ga0501035_0254681_58_588 176
295 3300003316 rootH1_10013055 rootH1_100130555 177
296 3300003771 Ga0055526_1033927 Ga0055526_10339271 177
297 3300003773 Ga0055537_1001045 Ga0055537_10010453 177
298 3300003775 Ga0055524_1008150 Ga0055524_10081503 177
299 3300003775 Ga0055524_1031795 Ga0055524_10317953 177
300 3300003781 Ga0055536_1000815 Ga0055536_10008156 177
301 3300003781 Ga0055536_1000953 Ga0055536_10009536 177
302 3300003790 Ga0055528_1036338 Ga0055528_10363381 177
303 3300003791 Ga0055530_10001482 Ga0055530_1000148211 177
304 3300003791 Ga0055530_10001790 Ga0055530_100017906 177
305 3300003794 Ga0055531_10000541 Ga0055531_1000054117 177
306 3300003794 Ga0055531_10001885 Ga0055531_1000188510 177
307 3300003794 Ga0055531_10006083 Ga0055531_100060838 177
308 3300005262 Ga0065165_1001044 Ga0065165_100104430 177
309 3300005262 Ga0065165_1001092 Ga0065165_10010926 177
310 3300005262 Ga0065165_1007051 Ga0065165_10070515 177
311 3300005334 Ga0068869_100914441 Ga0068869_1009144411 177
312 3300005353 Ga0070669_100304716 Ga0070669_1003047162 177
313 3300005455 Ga0070663_100341041 Ga0070663_1003410411 177
314 3300005544 Ga0070686_100460023 Ga0070686_1004600232 177
315 3300005616 Ga0068852_100306400 Ga0068852_1003064003 177
316 3300005718 Ga0068866_10076077 Ga0068866_100760774 177
317 3300006177 Ga0075362_10094624 Ga0075362_100946243 177
318 3300006177 Ga0075362_10309585 Ga0075362_103095851 177
319 3300006186 Ga0075369_10001212 Ga0075369_100012127 177
320 3300006195 Ga0075366_10033211 Ga0075366_100332114 177
321 3300006195 Ga0075366_10045389 Ga0075366_100453894 177
322 3300006195 Ga0075366_10056028 Ga0075366_100560282 177
323 3300009174 Ga0105241_10099847 Ga0105241_100998473 177
324 3300009545 Ga0105237_10188995 Ga0105237_101889953 177
325 3300009551 Ga0105238_10059347 Ga0105238_100593474 177
326 3300025250 Ga0209026_1001360 Ga0209026_10013608 177
327 3300025263 Ga0209565_1000798 Ga0209565_100079816 177
328 3300025273 Ga0209673_1005598 Ga0209673_10055986 177
329 3300025291 Ga0209675_1015100 Ga0209675_10151003 177
330 3300025292 Ga0209676_1000169 Ga0209676_1000169114 177
331 3300025292 Ga0209676_1000319 Ga0209676_100031968 177
332 3300025295 Ga0209564_1007084 Ga0209564_10070848 177
333 3300025295 Ga0209564_1018803 Ga0209564_10188033 177
334 3300025295 Ga0209564_1033664 Ga0209564_10336643 177
335 3300025297 Ga0209758_1000852 Ga0209758_100085238 177
336 3300025297 Ga0209758_1005712 Ga0209758_10057123 177
337 3300025297 Ga0209758_1011442 Ga0209758_10114423 177
338 3300025298 Ga0209050_1000053 Ga0209050_1000053203 177
339 3300025298 Ga0209050_1000281 Ga0209050_100028190 177
340 3300025298 Ga0209050_1000722 Ga0209050_100072232 177
341 3300025298 Ga0209050_1031075 Ga0209050_10310753 177
342 3300025299 Ga0209256_1003409 Ga0209256_100340911 177
343 3300025299 Ga0209256_1014428 Ga0209256_10144283 177
344 3300025299 Ga0209256_1015542 Ga0209256_10155424 177
345 3300025303 Ga0209051_1001156 Ga0209051_100115614 177
346 3300025304 Ga0209257_1000036 Ga0209257_100003634 177
347 3300025304 Ga0209257_1000289 Ga0209257_100028973 177
348 3300025304 Ga0209257_1000845 Ga0209257_100084522 177
349 3300025304 Ga0209257_1003375 Ga0209257_10033753 177
350 3300025914 Ga0207671_10140184 Ga0207671_101401842 177
351 3300025924 Ga0207694_10020522 Ga0207694_100205225 177
352 3300028794 Ga0307515_10011325 Ga0307515_100113258 177
353 3300028794 Ga0307515_10114187 Ga0307515_101141874 177
354 3300030521 Ga0307511_10012287 Ga0307511_100122875 177
355 3300031456 Ga0307513_10280783 Ga0307513_102807833 177
356 3300031456 Ga0307513_10281522 Ga0307513_102815223 177
357 3300031456 Ga0307513_10367071 Ga0307513_103670713 177
358 3300031456 Ga0307513_10434022 Ga0307513_104340222 177
359 3300031995 Ga0307409_100595541 Ga0307409_1005955411 177
360 3300032004 Ga0307414_10476267 Ga0307414_104762672 177
361 3300033180 Ga0307510_10020409 Ga0307510_100204093 177
362 3300037471 Ga0395905_0529487 Ga0395905_0529487_171_728 177
363 3300041492 Ga0451835_0368544 Ga0451835_0368544_186_719 177
364 3300041505 Ga0451849_0283330 Ga0451849_0283330_204_737 177
365 3300042001 Ga0439441_122706 Ga0439441_122706_46_579 177
366 3300042156 Ga0439446_0003888 Ga0439446_0003888_1111_1644 177
367 3300042435 Ga0439434_0083505 Ga0439434_0083505_255_788 177
368 3300042438 Ga0439459_0034174 Ga0439459_0034174_210_743 177
369 3300044683 Ga0466965_0360363 Ga0466965_0360363_228_761 177
370 3300046453 Ga0495627_000508 Ga0495627_000508_22731_23264 177
371 3300046457 Ga0495590_0000442 Ga0495590_0000442_14983_15516 177
372 3300046457 Ga0495590_0231745 Ga0495590_0231745_106_639 177
373 3300046460 Ga0495638_0000403 Ga0495638_0000403_40251_40784 177
374 3300046460 Ga0495638_0001416 Ga0495638_0001416_353_886 177
375 3300046460 Ga0495638_0001710 Ga0495638_0001710_15748_16281 177
376 3300046460 Ga0495638_0008799 Ga0495638_0008799_1078_1614 177
377 3300046460 Ga0495638_0047592 Ga0495638_0047592_322_855 177
378 3300046460 Ga0495638_0097790 Ga0495638_0097790_1056_1589 177
379 3300046471 Ga0495650_0000207 Ga0495650_0000207_9418_9951 177
380 3300046471 Ga0495650_0007609 Ga0495650_0007609_4606_5139 177
381 3300046471 Ga0495650_0028332 Ga0495650_0028332_278_811 177
382 3300046492 Ga0495585_0047761 Ga0495585_0047761_1036_1569 177
383 3300046506 Ga0495583_0000025 Ga0495583_0000025_182719_183252 177
384 3300046507 Ga0495606_0014729 Ga0495606_0014729_3741_4274 177
385 3300046507 Ga0495606_0092696 Ga0495606_0092696_638_1171 177
386 3300046512 Ga0495610_0000507 Ga0495610_0000507_29566_30099 177
387 3300046512 Ga0495610_0003178 Ga0495610_0003178_6112_6645 177
388 3300046512 Ga0495610_0004190 Ga0495610_0004190_7439_7972 177
389 3300046512 Ga0495610_0205817 Ga0495610_0205817_240_773 177
390 3300046513 Ga0495616_0000458 Ga0495616_0000458_21060_21593 177
391 3300046513 Ga0495616_0062615 Ga0495616_0062615_1113_1646 177
392 3300046518 Ga0495631_0005691 Ga0495631_0005691_5110_5643 177
393 3300046518 Ga0495631_0199626 Ga0495631_0199626_93_626 177
394 3300046519 Ga0495632_0004692 Ga0495632_0004692_726_1259 177
395 3300046520 Ga0495637_0008261 Ga0495637_0008261_3376_3909 177
396 3300046520 Ga0495637_0099495 Ga0495637_0099495_235_768 177
397 3300046522 Ga0495643_0184483 Ga0495643_0184483_82_615 177
398 3300046524 Ga0495648_0000039 Ga0495648_0000039_137982_138515 177
399 3300046524 Ga0495648_0027135 Ga0495648_0027135_2869_3402 177
400 3300046524 Ga0495648_0125826 Ga0495648_0125826_630_1163 177
401 3300046530 Ga0495654_0000016 Ga0495654_0000016_296698_297231 177
402 3300046530 Ga0495654_0016101 Ga0495654_0016101_1744_2277 177
403 3300046530 Ga0495654_0141754 Ga0495654_0141754_106_639 177
404 3300046539 Ga0495621_0078037 Ga0495621_0078037_246_803 177
405 3300046616 Ga0495668_0000040 Ga0495668_0000040_154256_154789 177
406 3300046616 Ga0495668_0002977 Ga0495668_0002977_8241_8774 177
407 3300046616 Ga0495668_0040226 Ga0495668_0040226_106_663 177
408 3300046616 Ga0495668_0054716 Ga0495668_0054716_189_722 177
409 3300046616 Ga0495668_0188161 Ga0495668_0188161_566_1099 177
410 3300046616 Ga0495668_0244823 Ga0495668_0244823_316_873 177
411 3300046660 Ga0495625_0000043 Ga0495625_0000043_121427_121999 177
412 3300046660 Ga0495625_0002221 Ga0495625_0002221_18784_19317 177
413 3300046660 Ga0495625_0017877 Ga0495625_0017877_4782_5315 177
414 3300046660 Ga0495625_0032948 Ga0495625_0032948_343_876 177
415 3300046660 Ga0495625_0290462 Ga0495625_0290462_361_897 177
416 3300046691 Ga0495670_0119789 Ga0495670_0119789_608_1141 177
417 3300046691 Ga0495670_0379580 Ga0495670_0379580_58_591 177
418 3300046794 Ga0495589_0008147 Ga0495589_0008147_1409_1945 177
419 3300046810 Ga0495660_0123446 Ga0495660_0123446_419_985 177
420 3300046810 Ga0495660_0171602 Ga0495660_0171602_505_1041 177
421 3300046810 Ga0495660_0228295 Ga0495660_0228295_273_806 177
422 3300047320 Ga0495672_0001670 Ga0495672_0001670_13496_14029 177
423 3300047323 Ga0495683_0108043 Ga0495683_0108043_448_981 177
424 3300047469 Ga0495673_0000148 Ga0495673_0000148_92057_92590 177
425 3300047469 Ga0495673_0000340 Ga0495673_0000340_58533_59069 177
426 3300047469 Ga0495673_0001397 Ga0495673_0001397_9218_9751 177
427 3300047470 Ga0495681_0045869 Ga0495681_0045869_1522_2055 177
428 3300047470 Ga0495681_0085280 Ga0495681_0085280_826_1359 177
429 3300047472 Ga0495686_0006516 Ga0495686_0006516_3064_3597 177
430 3300047472 Ga0495686_0037836 Ga0495686_0037836_1521_2078 177
431 3300048909 Ga0496106_0013519 Ga0496106_0013519_2984_3517 177
432 3300048910 Ga0496107_0000097 Ga0496107_0000097_38219_38752 177
433 3300048918 Ga0496115_0001700 Ga0496115_0001700_5711_6244 177
434 3300048924 Ga0496121_0149724 Ga0496121_0149724_267_800 177
435 3300048926 Ga0496123_0149296 Ga0496123_0149296_99_632 177
436 3300048926 Ga0496123_0292767 Ga0496123_0292767_96_629 177
437 3300048927 Ga0496124_0006743 Ga0496124_0006743_7293_7826 177
438 3300048928 Ga0496125_0037584 Ga0496125_0037584_3450_3983 177
439 3300048929 Ga0496126_0045491 Ga0496126_0045491_1495_2028 177
440 3300048929 Ga0496126_0071919 Ga0496126_0071919_620_1153 177
441 3300049459 Ga0495678_001710 Ga0495678_001710_5036_5569 177
442 3300049671 Ga0501238_000791 Ga0501238_000791_86_619 177
443 3300049671 Ga0501238_000834 Ga0501238_000834_2167_2700 177
444 3300050489 nmdc:mga03683_140170_c1 nmdc:mga03683_140170_c1_317_874 177
445 3300050493 nmdc:mga0k408_15526_c1 nmdc:mga0k408_15526_c1_1574_2107 177
446 3300050493 nmdc:mga0k408_260282_c1 nmdc:mga0k408_260282_c1_184_717 177
447 3300050493 nmdc:mga0k408_58044_c1 nmdc:mga0k408_58044_c1_1412_1945 177
448 3300050496 nmdc:mga07m45_147261_c1 nmdc:mga07m45_147261_c1_166_699 177
449 3300050516 nmdc:mga0sz30_2263_c1 nmdc:mga0sz30_2263_c1_1911_2444 177
450 3300053086 Ga0500578_0000041 Ga0500578_0000041_47833_48366 177
451 3300053086 Ga0500578_0381319 Ga0500578_0381319_258_791 177
452 3300053087 Ga0500643_049529 Ga0500643_049529_568_1101 177
453 3300053087 Ga0500643_063744 Ga0500643_063744_309_842 177
454 3300053088 Ga0500644_0000368 Ga0500644_0000368_1797_2330 177
455 3300053096 Ga0500641_0267382 Ga0500641_0267382_43_576 177
456 3300053098 Ga0500650_0049221 Ga0500650_0049221_1095_1631 177
457 3300053098 Ga0500650_0085063 Ga0500650_0085063_258_791 177
458 3300053103 Ga0500555_048537 Ga0500555_048537_343_876 177
459 3300053104 Ga0500556_0002669 Ga0500556_0002669_4672_5205 177
460 3300053108 Ga0500562_001723 Ga0500562_001723_1766_2299 177
461 3300053118 Ga0500594_0002660 Ga0500594_0002660_1473_2006 177
462 3300053119 Ga0500595_018188 Ga0500595_018188_746_1303 177
463 3300053122 Ga0500608_000105 Ga0500608_000105_31268_31801 177
464 3300053122 Ga0500608_097725 Ga0500608_097725_536_1069 177
465 3300053123 Ga0500614_006173 Ga0500614_006173_419_952 177
466 3300053125 Ga0500618_000022 Ga0500618_000022_95329_95862 177
467 3300053133 Ga0500655_030393 Ga0500655_030393_418_951 177
468 3300053133 Ga0500655_089585 Ga0500655_089585_41_574 177
469 3300053134 Ga0500658_0089400 Ga0500658_0089400_335_868 177
470 3300053136 Ga0500559_0000806 Ga0500559_0000806_10953_11486 177
471 3300053136 Ga0500559_0002565 Ga0500559_0002565_7236_7769 177
472 3300053136 Ga0500559_0021623 Ga0500559_0021623_1627_2199 177
473 3300053138 Ga0500564_000200 Ga0500564_000200_15590_16123 177
474 3300053153 Ga0500616_0075223 Ga0500616_0075223_320_853 177
475 3300053156 Ga0500622_0004450 Ga0500622_0004450_3131_3664 177
476 3300053156 Ga0500622_0010724 Ga0500622_0010724_2894_3427 177
477 3300053156 Ga0500622_0015383 Ga0500622_0015383_1882_2415 177
478 3300053158 Ga0500627_0007431 Ga0500627_0007431_1168_1701 177
479 3300053160 Ga0500633_0214097 Ga0500633_0214097_130_663 177
480 3300053727 Ga0500611_058341 Ga0500611_058341_210_746 177
481 3300053730 Ga0500645_006258 Ga0500645_006258_1309_1866 177
482 3300053730 Ga0500645_171436 Ga0500645_171436_47_580 177
483 3300053731 Ga0500609_001881 Ga0500609_001881_1098_1631 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11188

DUF2975

Protein of unknown function (DUF2975)

80

205

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uuj-assembly2.cif.gz_E structure of pe5-ppe4-espg3 complex from the type vii (esx-3) secretion system, space group p212121 0.4242 17 167
6h7w-assembly1.cif.gz_M model of retromer-vps5 complex assembled on membrane. 0.4026 11 173
7c4s-assembly2.cif.gz_B sphingosine-1-phosphate receptor 3 with a natural ligand. 0.3799 31 167
1i4t-assembly1.cif.gz_B crystal structure analysis of rac1-gmppnp in complex with arfaptin 0.3752 10 173
6uuj-assembly2.cif.gz_E structure of pe5-ppe4-espg3 complex from the type vii (esx-3) secretion system, space group p212121 0.3676 17 167
ID Description Score Start End Superfamily
af_H8W3Z0_1_170_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6566 69 175 1.20.140.150
af_H2KZM2_1_170_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5928 71 171 1.20.140.150
af_Q54VJ0_93_407_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.4805 9 176 1.20.1560.10
af_Q55E32_2_198_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4796 64 173 1.20.1070.10
af_Q7YTM8_1_160_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.473 34 176 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2N2Z8K4-F1-model_v4 DUF2975 domain-containing protein 0.8812 65 177 GO:0016020
AF-A0A1G9MTZ5-F1-model_v4 DUF2975 domain-containing protein 0.8416 71 177 GO:0016020
AF-A0A2Z3HS35-F1-model_v4 DUF2975 domain-containing protein 0.8283 1 177 GO:0016020
AF-A0A2Z3HS35-F1-model_v4 DUF2975 domain-containing protein 0.8239 1 177 GO:0016020
AF-A0A3E4Z444-F1-model_v4 DUF2975 domain-containing protein 0.8232 78 177 GO:0016020

Feature Viewer

pLDDT pTM Quality
86.35 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map