F452850

General Info

Members Datasets Scaffolds Average Seq Length
483 300 966 388

Family's Representative Sequence

Representative Sequence 3300053101|Ga0500553_062531|Ga0500553_062531_287_1654
Length 455
Sequence VLFEHDQNRPVYLIHVGRLLLAGLVYHNRAPTLSAICCQSCRDPVTPESWSATLHGVTPTIHGRAAMPGKSTITVHADREVHPSRAVAPPIYQTAAFWAEDGETFAQGAVAPRGKDFYTRFGNPNHAQVAAVVAELENTEAAMVTASGMAALTTAVLALVSTGDHVIGQKSTYGGTASVLLNLLPRLGVSTTLVDQTDPESFAKALTPQTRLILVESPSNPLLQITDLRAVADLARAHNVLTMADNTFATPLNQRPTDFGIDLVWHSATKYLNGHSDVSAGVLAGPAKILDRIWDVGLLTGATLGPIDAWLLLRGMRTLPLRVPRHNANGLALAEALNEHPAVAKVHYPGLATHPQHKLAAGQMSGFGGVLGIEFAGGFETADAFLGRLRYPRRSASLGGVESLAVHPASMWRGMLSEDQIAESVPLGLVRLAAGTEDTADLVADALAAADAVSA

Samples

Sample ID Description Type Environment
1 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
174 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
182 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
274 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
275 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
276 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
277 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
278 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
279 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
280 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
281 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
282 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
285 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
286 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
287 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
288 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
289 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
290 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
291 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
295 2506783011 Frankia datiscae Dg1 Isolate Nodule
296 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
297 2773857933 Frankia sp. BMG5.30 Isolate Nodule
298 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
299 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
300 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0.21
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.63
Nodule 0.83
Rhizoplane 1.04
Rhizosphere 83.85
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500553_062531 3300053101 Bacteria 1741
2 JGI25152J39213_1001016 3300002773 Bacteria 13497
3 JGI25150J39212_1005855 3300002774 Bacteria 2584
4 JGI25406J46586_10000684 3300003203 Bacteria 15760
5 JGI25153J46596_10001423 3300003215 Bacteria 14307
6 Ga0055526_1001310 3300003771 Bacteria 17842
7 Ga0070676_10006190 3300005328 Bacteria 6388
8 Ga0070670_100021344 3300005331 Bacteria 5571
9 Ga0068869_100010776 3300005334 Bacteria 5972
10 Ga0068869_100072963 3300005334 Bacteria 2544
11 Ga0068869_100123197 3300005334 Bacteria 1985
12 Ga0068869_100143531 3300005334 Bacteria 1846
13 Ga0070680_100000065 3300005336 Bacteria 55815
14 Ga0070682_100000164 3300005337 Bacteria 50996
15 Ga0070660_100003516 3300005339 Bacteria 10798
16 Ga0070660_100068857 3300005339 Bacteria 2759
17 Ga0070691_10004996 3300005341 Bacteria 6034
18 Ga0070691_10014584 3300005341 Bacteria 3607
19 Ga0070691_10041364 3300005341 Bacteria 2179
20 Ga0070687_100009925 3300005343 Bacteria 4095
21 Ga0070661_100016200 3300005344 Bacteria 5265
22 Ga0070692_10002585 3300005345 Bacteria 7054
23 Ga0070692_10028803 3300005345 Bacteria 2763
24 Ga0070669_100030286 3300005353 Bacteria 3904
25 Ga0070688_100014780 3300005365 Bacteria 4429
26 Ga0070659_100000169 3300005366 Bacteria 50438
27 Ga0070703_10003946 3300005406 Bacteria 4200
28 Ga0070705_100009642 3300005440 Bacteria 4807
29 Ga0070705_100051999 3300005440 Bacteria 2392
30 Ga0070700_100025221 3300005441 Bacteria 3500
31 Ga0070694_100005950 3300005444 Bacteria 7395
32 Ga0070694_100006435 3300005444 Bacteria 7128
33 Ga0070694_100148692 3300005444 Bacteria 1709
34 Ga0070694_100171097 3300005444 Bacteria 1600
35 Ga0070708_100008089 3300005445 Bacteria 8431
36 Ga0070708_100034681 3300005445 Bacteria 4391
37 Ga0070708_100117783 3300005445 Bacteria 2447
38 Ga0070662_100020129 3300005457 Bacteria 4540
39 Ga0070681_10000731 3300005458 Bacteria 27148
40 Ga0070681_10024805 3300005458 Bacteria 6033
41 Ga0070681_10148699 3300005458 Bacteria 2270
42 Ga0068867_100000004 3300005459 Bacteria 180739
43 Ga0068867_100162078 3300005459 Bacteria 1764
44 Ga0070706_100008368 3300005467 Bacteria 9640
45 Ga0070706_100013972 3300005467 Bacteria 7417
46 Ga0070706_100018891 3300005467 Bacteria 6357
47 Ga0070707_100014267 3300005468 Bacteria 7449
48 Ga0070707_100015942 3300005468 Bacteria 7054
49 Ga0070707_100029453 3300005468 Bacteria 5227
50 Ga0070707_100089842 3300005468 Bacteria 2973
51 Ga0070707_100132996 3300005468 Bacteria 2419
52 Ga0070698_100006864 3300005471 Bacteria 12329
53 Ga0070698_100013383 3300005471 Bacteria 8683
54 Ga0070699_100009809 3300005518 Bacteria 8286
55 Ga0070699_100021956 3300005518 Bacteria 5499
56 Ga0070699_100033749 3300005518 Bacteria 4422
57 Ga0070699_100040354 3300005518 Bacteria 4041
58 Ga0070699_100147341 3300005518 Bacteria 2080
59 Ga0070679_100010828 3300005530 Bacteria 8664
60 Ga0070679_100046065 3300005530 Bacteria 4346
61 Ga0070684_100057728 3300005535 Bacteria 3390
62 Ga0070697_100029085 3300005536 Bacteria 4429
63 Ga0070697_100040428 3300005536 Bacteria 3773
64 Ga0070697_100078818 3300005536 Bacteria 2711
65 Ga0070697_100208587 3300005536 Bacteria 1663
66 Ga0068853_100036370 3300005539 Bacteria 4186
67 Ga0068853_100047904 3300005539 Bacteria 3669
68 Ga0070686_100025368 3300005544 Bacteria 3566
69 Ga0070686_100169132 3300005544 Bacteria 1545
70 Ga0070695_100002565 3300005545 Bacteria 10485
71 Ga0070695_100003297 3300005545 Bacteria 9433
72 Ga0070695_100007051 3300005545 Bacteria 6662
73 Ga0070696_100012914 3300005546 Bacteria 5608
74 Ga0070696_100084522 3300005546 Bacteria 2252
75 Ga0070693_100023993 3300005547 Bacteria 3266
76 Ga0070704_100014615 3300005549 Bacteria 4907
77 Ga0070704_100017305 3300005549 Bacteria 4581
78 Ga0068855_100015265 3300005563 Bacteria 9245
79 Ga0070664_100006179 3300005564 Bacteria 9682
80 Ga0068857_100042069 3300005577 Bacteria 4052
81 Ga0068857_100159298 3300005577 Bacteria 2048
82 Ga0068854_100003384 3300005578 Bacteria 9939
83 Ga0068856_100045382 3300005614 Bacteria 4327
84 Ga0068852_100043845 3300005616 Bacteria 3796
85 Ga0068852_100054875 3300005616 Bacteria 3437
86 Ga0068852_100235539 3300005616 Bacteria 1747
87 Ga0068859_100001246 3300005617 Bacteria 25988
88 Ga0068859_100010415 3300005617 Bacteria 9353
89 Ga0068864_100021269 3300005618 Bacteria 5435
90 Ga0068861_100002754 3300005719 Bacteria 11526
91 Ga0068870_10000862 3300005840 Bacteria 11850
92 Ga0068863_100069499 3300005841 Bacteria 3330
93 Ga0068863_100110648 3300005841 Bacteria 2616
94 Ga0068863_100255669 3300005841 Bacteria 1693
95 Ga0068858_100012936 3300005842 Bacteria 7868
96 Ga0068858_100066107 3300005842 Bacteria 3347
97 Ga0068860_100017033 3300005843 Bacteria 7083
98 Ga0068860_100088546 3300005843 Bacteria 2947
99 Ga0068862_100009164 3300005844 Bacteria 8196
100 Ga0068862_100078003 3300005844 Bacteria 2869
101 Ga0068862_100128198 3300005844 Bacteria 2242
102 Ga0081455_10000499 3300005937 Bacteria 51066
103 Ga0081455_10003200 3300005937 Bacteria 18964
104 Ga0081538_10011129 3300005981 Bacteria 7312
105 Ga0081540_1027106 3300005983 Bacteria 3254
106 Ga0081539_10000387 3300005985 Bacteria 95288
107 Ga0070712_100005995 3300006175 Bacteria 7519
108 Ga0070712_100079856 3300006175 Bacteria 2366
109 Ga0075366_10002875 3300006195 Bacteria 8929
110 Ga0068871_100201294 3300006358 Bacteria 1719
111 Ga0075430_100231439 3300006846 Bacteria 1532
112 Ga0075431_100001932 3300006847 Bacteria 19742
113 Ga0075431_100152745 3300006847 Bacteria 2377
114 Ga0075431_100469527 3300006847 Unclassified 1252
115 Ga0075433_10007865 3300006852 Bacteria 8478
116 Ga0075433_10013754 3300006852 Bacteria 6593
117 Ga0075433_10018652 3300006852 Bacteria 5770
118 Ga0075433_10027866 3300006852 Bacteria 4798
119 Ga0075434_100001051 3300006871 Bacteria 22510
120 Ga0075434_100002356 3300006871 Bacteria 16547
121 Ga0075434_100027581 3300006871 Bacteria 5576
122 Ga0075429_100092246 3300006880 Bacteria 2642
123 Ga0075429_100145194 3300006880 Bacteria 2077
124 Ga0075436_100123821 3300006914 Bacteria 1811
125 Ga0097620_100001246 3300006931 Bacteria 25988
126 Ga0097620_100010414 3300006931 Bacteria 9353
127 Ga0075435_100020646 3300007076 Bacteria 5053
128 Ga0075435_100022291 3300007076 Bacteria 4885
129 Ga0111539_10000557 3300009094 Bacteria 47767
130 Ga0111539_10050982 3300009094 Bacteria 4930
131 Ga0105245_10004383 3300009098 Bacteria 12495
132 Ga0114129_10402871 3300009147 Bacteria 1803
133 Ga0114129_10417402 3300009147 Bacteria 1766
134 Ga0105243_10010934 3300009148 Bacteria 6865
135 Ga0105241_10001622 3300009174 Bacteria 17146
136 Ga0105238_10033445 3300009551 Bacteria 5234
137 Ga0105249_10065854 3300009553 Bacteria 3334
138 Ga0157374_10002431 3300013296 Bacteria 15703
139 Ga0163162_10338857 3300013306 Bacteria 1636
140 Ga0157372_10024143 3300013307 Bacteria 6599
141 Ga0157375_10443623 3300013308 Bacteria 1463
142 Ga0163163_10013390 3300014325 Bacteria 7508
143 Ga0157380_10368051 3300014326 Bacteria 1351
144 Ga0157377_10000010 3300014745 Bacteria 380929
145 Ga0213876_10032129 3300021384 Bacteria 2768
146 Ga0207425_1000328 3300025245 Bacteria 33571
147 Ga0209129_1000035 3300025258 Bacteria 329303
148 Ga0209564_1000024 3300025295 Bacteria 535041
149 Ga0209758_1000066 3300025297 Bacteria 298620
150 Ga0209758_1000213 3300025297 Bacteria 126745
151 Ga0207653_10000554 3300025885 Bacteria 13697
152 Ga0207653_10004289 3300025885 Bacteria 4481
153 Ga0207688_10002237 3300025901 Bacteria 10431
154 Ga0207645_10012160 3300025907 Bacteria 5846
155 Ga0207643_10000105 3300025908 Bacteria 57132
156 Ga0207643_10009990 3300025908 Bacteria 5101
157 Ga0207705_10140858 3300025909 Bacteria 1801
158 Ga0207684_10001521 3300025910 Bacteria 24854
159 Ga0207684_10039524 3300025910 Bacteria 4001
160 Ga0207684_10142268 3300025910 Unclassified 2062
161 Ga0207707_10000034 3300025912 Bacteria 152677
162 Ga0207693_10010300 3300025915 Bacteria 7587
163 Ga0207663_10100431 3300025916 Bacteria 1942
164 Ga0207660_10000276 3300025917 Bacteria 33906
165 Ga0207662_10036409 3300025918 Bacteria 2876
166 Ga0207657_10000066 3300025919 Bacteria 98663
167 Ga0207657_10100484 3300025919 Bacteria 2401
168 Ga0207649_10001774 3300025920 Bacteria 12339
169 Ga0207652_10000245 3300025921 Bacteria 56703
170 Ga0207652_10235572 3300025921 Bacteria 1650
171 Ga0207646_10033493 3300025922 Bacteria 4648
172 Ga0207646_10043603 3300025922 Bacteria 4027
173 Ga0207646_10062922 3300025922 Bacteria 3312
174 Ga0207650_10005088 3300025925 Bacteria 8979
175 Ga0207687_10016456 3300025927 Unclassified 4858
176 Ga0207687_10036937 3300025927 Bacteria 3330
177 Ga0207690_10016489 3300025932 Bacteria 4495
178 Ga0207706_10020126 3300025933 Bacteria 5996
179 Ga0207709_10006216 3300025935 Bacteria 6717
180 Ga0207665_10054185 3300025939 Bacteria 2704
181 Ga0207691_10050425 3300025940 Bacteria 3811
182 Ga0207711_10073254 3300025941 Bacteria 2976
183 Ga0207689_10000153 3300025942 Bacteria 59635
184 Ga0207689_10022323 3300025942 Bacteria 5321
185 Ga0207689_10025422 3300025942 Bacteria 4963
186 Ga0207679_10001070 3300025945 Bacteria 17432
187 Ga0207667_10000790 3300025949 Bacteria 41185
188 Ga0207651_10106700 3300025960 Bacteria 2092
189 Ga0207712_10140232 3300025961 Bacteria 1854
190 Ga0207712_10242113 3300025961 Bacteria 1453
191 Ga0207640_10002816 3300025981 Bacteria 9327
192 Ga0207703_10018921 3300026035 Bacteria 5381
193 Ga0207639_10007488 3300026041 Bacteria 7447
194 Ga0207639_10018813 3300026041 Bacteria 4914
195 Ga0207708_10014033 3300026075 Bacteria 5985
196 Ga0207708_10015525 3300026075 Bacteria 5713
197 Ga0207702_10000483 3300026078 Bacteria 44845
198 Ga0207641_10062359 3300026088 Bacteria 3181
199 Ga0207641_10088802 3300026088 Bacteria 2700
200 Ga0207641_10129447 3300026088 Bacteria 2264
201 Ga0207641_10439107 3300026088 Bacteria 1260
202 Ga0207648_10000002 3300026089 Bacteria 307909
203 Ga0207674_10000050 3300026116 Bacteria 116782
204 Ga0207674_10048528 3300026116 Bacteria 4345
205 Ga0207675_100011318 3300026118 Bacteria 8350
206 Ga0207675_100130963 3300026118 Bacteria 2379
207 Ga0207698_10019109 3300026142 Bacteria 4683
208 Ga0207698_10065890 3300026142 Bacteria 2848
209 Ga0207698_10113344 3300026142 Bacteria 2278
210 Ga0209996_1001383 3300027395 Bacteria 2905
211 Ga0209995_1000387 3300027471 Bacteria 6868
212 Ga0209968_1000959 3300027526 Bacteria 4456
213 Ga0209982_1004143 3300027552 Bacteria 2071
214 Ga0209971_1000070 3300027682 Bacteria 31653
215 Ga0209966_1000680 3300027695 Bacteria 7395
216 Ga0209998_10000126 3300027717 Bacteria 29860
217 Ga0209974_10000121 3300027876 Bacteria 23101
218 Ga0207428_10000054 3300027907 Bacteria 175237
219 Ga0268265_10081371 3300028380 Bacteria 2557
220 Ga0268264_10065359 3300028381 Bacteria 3065
221 Ga0268264_10122839 3300028381 Bacteria 2291
222 Ga0307517_10004091 3300028786 Bacteria 22505
223 Ga0307517_10016993 3300028786 Bacteria 9516
224 Ga0307515_10002244 3300028794 Bacteria 42358
225 Ga0307515_10003048 3300028794 Bacteria 35498
226 Ga0307515_10013996 3300028794 Bacteria 14927
227 Ga0307515_10030200 3300028794 Bacteria 9117
228 Ga0265338_10000522 3300028800 Bacteria 67694
229 Ga0307511_10000585 3300030521 Bacteria 38993
230 Ga0307511_10002257 3300030521 Bacteria 20148
231 Ga0307511_10123987 3300030521 Bacteria 1584
232 Ga0307512_10042169 3300030522 Bacteria 3782
233 Ga0265330_10038865 3300031235 Bacteria 2115
234 Ga0265340_10014739 3300031247 Bacteria 4077
235 Ga0265316_10000422 3300031344 Bacteria 48284
236 Ga0265316_10004191 3300031344 Bacteria 14415
237 Ga0265316_10036248 3300031344 Bacteria 3988
238 Ga0307513_10011199 3300031456 Bacteria 11165
239 Ga0307513_10047851 3300031456 Bacteria 4647
240 Ga0307513_10123337 3300031456 Bacteria 2553
241 Ga0307509_10003613 3300031507 Bacteria 23253
242 Ga0307509_10013774 3300031507 Bacteria 9542
243 Ga0307509_10021186 3300031507 Bacteria 7355
244 Ga0307509_10023171 3300031507 Bacteria 6982
245 Ga0307509_10028397 3300031507 Bacteria 6220
246 Ga0307408_100044554 3300031548 Bacteria 3162
247 Ga0307508_10001755 3300031616 Bacteria 24076
248 Ga0307508_10009727 3300031616 Bacteria 8818
249 Ga0307508_10014007 3300031616 Bacteria 7317
250 Ga0307508_10017933 3300031616 Bacteria 6432
251 Ga0307508_10019331 3300031616 Bacteria 6191
252 Ga0307514_10003655 3300031649 Bacteria 14595
253 Ga0307514_10077985 3300031649 Bacteria 2462
254 Ga0265342_10040382 3300031712 Bacteria 2830
255 Ga0265342_10076280 3300031712 Bacteria 1943
256 Ga0307516_10006239 3300031730 Bacteria 14018
257 Ga0307516_10039202 3300031730 Bacteria 4724
258 Ga0307516_10067525 3300031730 Bacteria 3445
259 Ga0307516_10120165 3300031730 Bacteria 2419
260 Ga0307413_10119841 3300031824 Bacteria 1780
261 Ga0307412_10043000 3300031911 Bacteria 2940
262 Ga0307411_10113967 3300032005 Bacteria 1941
263 Ga0307507_10000140 3300033179 Bacteria 125574
264 Ga0307507_10028589 3300033179 Bacteria 5937
265 Ga0307510_10006872 3300033180 Bacteria 13575
266 Ga0307510_10039243 3300033180 Bacteria 5220
267 Ga0316214_1002087 3300033545 Bacteria 2435
268 Ga0373954_0001486 3300035118 Bacteria 9533
269 Ga0373956_0000055 3300035119 Bacteria 38599
270 Ga0373955_0016088 3300035172 Bacteria 3676
271 Ga0373955_0044133 3300035172 Unclassified 2400
272 Ga0373927_0000023 3300035695 Bacteria 121056
273 Ga0373933_0200300 3300035724 Bacteria 1277
274 Ga0373937_0227147 3300036401 Bacteria 1757
275 Ga0372808_000575 3300036459 Bacteria 3051
276 Ga0373925_0000343 3300037068 Bacteria 48454
277 Ga0395899_0025528 3300037312 Bacteria 4460
278 Ga0395900_0045811 3300037418 Bacteria 4504
279 Ga0395905_0007847 3300037471 Bacteria 10574
280 Ga0395901_0013986 3300038443 Bacteria 8166
281 Ga0439466_0007496 3300041411 Bacteria 4128
282 Ga0439465_0001080 3300041413 Bacteria 8728
283 Ga0451833_1305067 3300041491 Bacteria 1199
284 Ga0439431_0001562 3300041997 Bacteria 5076
285 Ga0439445_0000408 3300042004 Bacteria 8686
286 Ga0439448_0004198 3300042005 Bacteria 4057
287 Ga0439432_005149 3300042006 Bacteria 4724
288 Ga0439449_0001426 3300042007 Bacteria 9345
289 Ga0439449_0005212 3300042007 Bacteria 4987
290 Ga0439452_001192 3300042010 Bacteria 11185
291 Ga0439452_020722 3300042010 Bacteria 1721
292 Ga0439455_0001873 3300042012 Bacteria 3678
293 Ga0439457_007416 3300042014 Bacteria 2633
294 Ga0439457_009553 3300042014 Bacteria 2254
295 Ga0439462_0007876 3300042015 Bacteria 2675
296 Ga0439458_0003221 3300042157 Bacteria 3862
297 Ga0439460_0000911 3300042461 Bacteria 6766
298 Ga0451577_0000288 3300042876 Bacteria 97988
299 Ga0451577_0003499 3300042876 Bacteria 17445
300 Ga0451577_0031343 3300042876 Bacteria 4797
301 Ga0451577_0340373 3300042876 Bacteria 1360
302 Ga0453683_0019755 3300044673 Bacteria 4312
303 Ga0453683_0030886 3300044673 Bacteria 3385
304 Ga0453684_0062840 3300044712 Bacteria 4753
305 Ga0453684_0135621 3300044712 Bacteria 2947
306 Ga0453684_0140959 3300044712 Bacteria 2879
307 Ga0451576_0008536 3300045051 Bacteria 12011
308 Ga0451576_0252336 3300045051 Bacteria 1844
309 Ga0451576_0346494 3300045051 Bacteria 1555
310 Ga0495627_014922 3300046453 Bacteria 2695
311 Ga0495629_0001664 3300046459 Bacteria 17437
312 Ga0495629_0013922 3300046459 Bacteria 5798
313 Ga0495629_0129309 3300046459 Bacteria 1759
314 Ga0495651_0036072 3300046462 Bacteria 3848
315 Ga0495651_0102580 3300046462 Bacteria 2127
316 Ga0495653_0027555 3300046463 Bacteria 4546
317 Ga0495580_0115019 3300046472 Bacteria 1868
318 Ga0495582_0026506 3300046473 Bacteria 3177
319 Ga0495639_0002883 3300046475 Bacteria 7482
320 Ga0495662_0000567 3300046476 Bacteria 17020
321 Ga0495662_0017952 3300046476 Bacteria 3423
322 Ga0495664_0059257 3300046477 Bacteria 2278
323 Ga0495585_0004992 3300046492 Bacteria 8485
324 Ga0495608_0002615 3300046511 Bacteria 12931
325 Ga0495618_0063105 3300046514 Bacteria 2352
326 Ga0495628_0030486 3300046516 Bacteria 4366
327 Ga0495628_0156966 3300046516 Bacteria 1730
328 Ga0495630_0000359 3300046517 Bacteria 36192
329 Ga0495630_0051041 3300046517 Bacteria 3095
330 Ga0495631_0057553 3300046518 Bacteria 1692
331 Ga0495643_0002249 3300046522 Bacteria 15660
332 Ga0495648_0002107 3300046524 Bacteria 18758
333 Ga0495652_0001574 3300046529 Bacteria 24938
334 Ga0495652_0041027 3300046529 Bacteria 3997
335 Ga0495652_0106836 3300046529 Bacteria 2259
336 Ga0495652_0230983 3300046529 Bacteria 1383
337 Ga0495665_0009674 3300046531 Bacteria 5220
338 Ga0495640_0001812 3300046533 Bacteria 16941
339 Ga0495640_0080438 3300046533 Bacteria 2167
340 Ga0495586_0009232 3300046535 Bacteria 5245
341 Ga0495586_0085682 3300046535 Bacteria 1736
342 Ga0495587_0043951 3300046536 Bacteria 2658
343 Ga0495587_0128887 3300046536 Bacteria 1446
344 Ga0495622_0000639 3300046557 Bacteria 20279
345 Ga0495633_0035250 3300046558 Bacteria 2403
346 Ga0495667_0039327 3300046559 Bacteria 3145
347 Ga0495667_0049072 3300046559 Bacteria 2786
348 Ga0495668_0088301 3300046616 Bacteria 1700
349 Ga0495634_0000711 3300046642 Bacteria 32299
350 Ga0495634_0022103 3300046642 Bacteria 4484
351 Ga0495634_0134274 3300046642 Bacteria 1575
352 Ga0495625_0003686 3300046660 Bacteria 14990
353 Ga0495635_0009141 3300046663 Bacteria 6917
354 Ga0495635_0037691 3300046663 Bacteria 3346
355 Ga0495635_0059336 3300046663 Bacteria 2630
356 Ga0495635_0101093 3300046663 Bacteria 1970
357 Ga0495588_0007983 3300046674 Bacteria 4838
358 Ga0495657_0007162 3300046675 Bacteria 8653
359 Ga0495657_0018617 3300046675 Bacteria 5020
360 Ga0495599_0026551 3300046678 Bacteria 3629
361 Ga0495623_0014071 3300046679 Bacteria 5183
362 Ga0495646_0010771 3300046680 Bacteria 5809
363 Ga0495613_0007385 3300046689 Bacteria 8191
364 Ga0495613_0011746 3300046689 Bacteria 6508
365 Ga0495613_0017716 3300046689 Bacteria 5306
366 Ga0495670_0008729 3300046691 Bacteria 4987
367 Ga0495670_0020288 3300046691 Bacteria 3276
368 Ga0495671_0000820 3300046692 Bacteria 22192
369 Ga0495600_0052479 3300046809 Bacteria 2662
370 Ga0495600_0055085 3300046809 Bacteria 2597
371 Ga0495660_0029718 3300046810 Bacteria 3082
372 Ga0495660_0076180 3300046810 Bacteria 1767
373 Ga0495660_0076766 3300046810 Bacteria 1759
374 Ga0495581_0108662 3300047315 Bacteria 1612
375 Ga0495604_0011636 3300047317 Bacteria 6996
376 Ga0495604_0101177 3300047317 Bacteria 2117
377 Ga0495674_0042157 3300047319 Bacteria 4072
378 Ga0495674_0089542 3300047319 Bacteria 2631
379 Ga0495674_0090939 3300047319 Bacteria 2607
380 Ga0495676_0004221 3300047321 Bacteria 13120
381 Ga0495676_0015168 3300047321 Bacteria 6874
382 Ga0495680_0055374 3300047322 Bacteria 3077
383 Ga0495680_0124606 3300047322 Bacteria 1899
384 Ga0495683_0002620 3300047323 Bacteria 10758
385 Ga0495687_003659 3300047443 Bacteria 10947
386 Ga0495687_004919 3300047443 Bacteria 8746
387 Ga0495687_049374 3300047443 Bacteria 1798
388 Ga0495687_073723 3300047443 Bacteria 1359
389 Ga0495685_001290 3300047447 Bacteria 7656
390 Ga0495673_0001614 3300047469 Bacteria 17509
391 Ga0495681_0003678 3300047470 Bacteria 10649
392 Ga0495681_0005117 3300047470 Bacteria 8839
393 Ga0495686_0051407 3300047472 Bacteria 2586
394 Ga0495602_0045632 3300048088 Bacteria 3964
395 Ga0495614_0005003 3300048089 Bacteria 5977
396 Ga0495614_0009316 3300048089 Bacteria 4343
397 Ga0496102_0029828 3300048905 Bacteria 4881
398 Ga0496102_0118566 3300048905 Bacteria 2470
399 Ga0496106_0012835 3300048909 Bacteria 6184
400 Ga0496106_0029801 3300048909 Bacteria 4068
401 Ga0496108_0113922 3300048911 Bacteria 2315
402 Ga0501036_0075056 3300049572 Bacteria 2860
403 Ga0501038_0048015 3300049574 Bacteria 3696
404 Ga0501040_0007330 3300049576 Bacteria 7143
405 Ga0501041_0016587 3300049577 Bacteria 4381
406 Ga0501042_0026365 3300049578 Bacteria 4084
407 Ga0501042_0146227 3300049578 Bacteria 1704
408 Ga0501046_0000084 3300049580 Bacteria 100971
409 Ga0501047_0026457 3300049581 Bacteria 5581
410 Ga0501067_0063385 3300049583 Bacteria 2047
411 Ga0501068_0027333 3300049584 Bacteria 3369
412 Ga0501068_0046443 3300049584 Bacteria 2619
413 Ga0501072_0107596 3300049588 Bacteria 2218
414 Ga0501074_0004755 3300049590 Bacteria 9731
415 Ga0501074_0086462 3300049590 Bacteria 2246
416 Ga0501074_0095644 3300049590 Bacteria 2127
417 Ga0501075_0070970 3300049591 Bacteria 2632
418 Ga0501075_0090023 3300049591 Bacteria 2327
419 Ga0501076_0006353 3300049592 Bacteria 8569
420 Ga0501076_0054572 3300049592 Bacteria 3167
421 Ga0501076_0091825 3300049592 Bacteria 2442
422 Ga0501077_0011470 3300049593 Bacteria 5536
423 Ga0501077_0041712 3300049593 Bacteria 2920
424 Ga0501079_0002073 3300049741 Bacteria 14372
425 Ga0501079_0020570 3300049741 Bacteria 5045
426 Ga0501079_0054969 3300049741 Bacteria 3071
427 Ga0501080_0022486 3300049742 Bacteria 5841
428 Ga0501081_0001187 3300049743 Bacteria 15771
429 Ga0501081_0005445 3300049743 Bacteria 8215
430 Ga0501081_0016469 3300049743 Bacteria 4887
431 Ga0501083_0007029 3300049744 Bacteria 7992
432 Ga0501045_0002792 3300049824 Bacteria 11938
433 Ga0501045_0068618 3300049824 Bacteria 2605
434 Ga0501045_0075777 3300049824 Bacteria 2478
435 nmdc:mga05p37_240111_c1 3300050507 Bacteria 2179
436 nmdc:mga05p37_67379_c1 3300050507 Bacteria 4404
437 nmdc:mga09592_81949_c1 3300050508 Bacteria 2749
438 nmdc:mga06r32_21610_c1 3300050510 Bacteria 5942
439 nmdc:mga06r32_265107_c1 3300050510 Bacteria 1705
440 nmdc:mga08y16_7654_c1 3300050511 Bacteria 11306
441 nmdc:mga0n895_14276_c1 3300050512 Bacteria 7207
442 nmdc:mga0n895_148845_c1 3300050512 Bacteria 2370
443 nmdc:mga0rr50_137945_c1 3300050513 Bacteria 1959
444 nmdc:mga0rr50_9745_c1 3300050513 Bacteria 6062
445 nmdc:mga08x19_111402_c1 3300050514 Bacteria 1826
446 nmdc:mga0a205_14587_c1 3300050515 Bacteria 7334
447 nmdc:mga0a205_55512_c1 3300050515 Bacteria 3826
448 nmdc:mga0a205_7787_c1 3300050515 Bacteria 9728
449 Ga0495601_0000443 3300053077 Bacteria 21677
450 Ga0495612_0002016 3300053078 Bacteria 8364
451 Ga0500610_0000294 3300053079 Bacteria 15100
452 Ga0500610_0000321 3300053079 Bacteria 14413
453 Ga0495655_0003668 3300053083 Bacteria 2554
454 Ga0500578_0015320 3300053086 Bacteria 4929
455 Ga0500646_0015885 3300053090 Bacteria 1963
456 Ga0500556_0022021 3300053104 Bacteria 2065
457 Ga0500569_011479 3300053109 Bacteria 2117
458 Ga0500593_001339 3300053117 Bacteria 8874
459 Ga0500607_000992 3300053121 Bacteria 27011
460 Ga0500621_034195 3300053126 Bacteria 2033
461 Ga0500652_002124 3300053131 Bacteria 5962
462 Ga0500658_0004546 3300053134 Bacteria 5170
463 Ga0500561_0000834 3300053137 Bacteria 4927
464 Ga0500573_0027441 3300053140 Bacteria 3275
465 Ga0500573_0093171 3300053140 Bacteria 1700
466 Ga0500579_061561 3300053143 Bacteria 2225
467 Ga0500600_0009889 3300053149 Bacteria 5763
468 Ga0500616_0012592 3300053153 Bacteria 4947
469 Ga0500633_0001186 3300053160 Bacteria 4748
470 Ga0500634_0005815 3300053161 Bacteria 5904
471 Ga0500634_0066763 3300053161 Bacteria 1894
472 Ga0500656_000287 3300053732 Bacteria 3494
473 Ga0501084_0000139 3300054114 Bacteria 54829
474 Ga0501084_0008107 3300054114 Bacteria 8655
475 Ga0501082_0003568 3300060353 Bacteria 13582
476 Ga0501082_0103929 3300060353 Bacteria 2457
477 Ga0530510_0026317 3300061734 Bacteria 4163
478 2506866797 2506783011 Bacteria 5323186
479 2585311425 2582581313 Bacteria 10042643
480 2774906062 2773857933 Bacteria 5818019
481 2862391227 2862382967 Bacteria 10317375
482 2885196853 2885192300 Bacteria 5882526
483 8008558919 8008558824 Bacteria 10610750
484 Ga0500553_062531
485 JGI25152J39213_1001016
486 JGI25150J39212_1005855
487 JGI25406J46586_10000684
488 JGI25153J46596_10001423
489 Ga0055526_1001310
490 Ga0070676_10006190
491 Ga0070670_100021344
492 Ga0068869_100010776
493 Ga0068869_100072963
494 Ga0068869_100123197
495 Ga0068869_100143531
496 Ga0070680_100000065
497 Ga0070682_100000164
498 Ga0070660_100003516
499 Ga0070660_100068857
500 Ga0070691_10004996
501 Ga0070691_10014584
502 Ga0070691_10041364
503 Ga0070687_100009925
504 Ga0070661_100016200
505 Ga0070692_10002585
506 Ga0070692_10028803
507 Ga0070669_100030286
508 Ga0070688_100014780
509 Ga0070659_100000169
510 Ga0070703_10003946
511 Ga0070705_100009642
512 Ga0070705_100051999
513 Ga0070700_100025221
514 Ga0070694_100005950
515 Ga0070694_100006435
516 Ga0070694_100148692
517 Ga0070694_100171097
518 Ga0070708_100008089
519 Ga0070708_100034681
520 Ga0070708_100117783
521 Ga0070662_100020129
522 Ga0070681_10000731
523 Ga0070681_10024805
524 Ga0070681_10148699
525 Ga0068867_100000004
526 Ga0068867_100162078
527 Ga0070706_100008368
528 Ga0070706_100013972
529 Ga0070706_100018891
530 Ga0070707_100014267
531 Ga0070707_100015942
532 Ga0070707_100029453
533 Ga0070707_100089842
534 Ga0070707_100132996
535 Ga0070698_100006864
536 Ga0070698_100013383
537 Ga0070699_100009809
538 Ga0070699_100021956
539 Ga0070699_100033749
540 Ga0070699_100040354
541 Ga0070699_100147341
542 Ga0070679_100010828
543 Ga0070679_100046065
544 Ga0070684_100057728
545 Ga0070697_100029085
546 Ga0070697_100040428
547 Ga0070697_100078818
548 Ga0070697_100208587
549 Ga0068853_100036370
550 Ga0068853_100047904
551 Ga0070686_100025368
552 Ga0070686_100169132
553 Ga0070695_100002565
554 Ga0070695_100003297
555 Ga0070695_100007051
556 Ga0070696_100012914
557 Ga0070696_100084522
558 Ga0070693_100023993
559 Ga0070704_100014615
560 Ga0070704_100017305
561 Ga0068855_100015265
562 Ga0070664_100006179
563 Ga0068857_100042069
564 Ga0068857_100159298
565 Ga0068854_100003384
566 Ga0068856_100045382
567 Ga0068852_100043845
568 Ga0068852_100054875
569 Ga0068852_100235539
570 Ga0068859_100001246
571 Ga0068859_100010415
572 Ga0068864_100021269
573 Ga0068861_100002754
574 Ga0068870_10000862
575 Ga0068863_100069499
576 Ga0068863_100110648
577 Ga0068863_100255669
578 Ga0068858_100012936
579 Ga0068858_100066107
580 Ga0068860_100017033
581 Ga0068860_100088546
582 Ga0068862_100009164
583 Ga0068862_100078003
584 Ga0068862_100128198
585 Ga0081455_10000499
586 Ga0081455_10003200
587 Ga0081538_10011129
588 Ga0081540_1027106
589 Ga0081539_10000387
590 Ga0070712_100005995
591 Ga0070712_100079856
592 Ga0075366_10002875
593 Ga0068871_100201294
594 Ga0075430_100231439
595 Ga0075431_100001932
596 Ga0075431_100152745
597 Ga0075431_100469527
598 Ga0075433_10007865
599 Ga0075433_10013754
600 Ga0075433_10018652
601 Ga0075433_10027866
602 Ga0075434_100001051
603 Ga0075434_100002356
604 Ga0075434_100027581
605 Ga0075429_100092246
606 Ga0075429_100145194
607 Ga0075436_100123821
608 Ga0097620_100001246
609 Ga0097620_100010414
610 Ga0075435_100020646
611 Ga0075435_100022291
612 Ga0111539_10000557
613 Ga0111539_10050982
614 Ga0105245_10004383
615 Ga0114129_10402871
616 Ga0114129_10417402
617 Ga0105243_10010934
618 Ga0105241_10001622
619 Ga0105238_10033445
620 Ga0105249_10065854
621 Ga0157374_10002431
622 Ga0163162_10338857
623 Ga0157372_10024143
624 Ga0157375_10443623
625 Ga0163163_10013390
626 Ga0157380_10368051
627 Ga0157377_10000010
628 Ga0213876_10032129
629 Ga0207425_1000328
630 Ga0209129_1000035
631 Ga0209564_1000024
632 Ga0209758_1000066
633 Ga0209758_1000213
634 Ga0207653_10000554
635 Ga0207653_10004289
636 Ga0207688_10002237
637 Ga0207645_10012160
638 Ga0207643_10000105
639 Ga0207643_10009990
640 Ga0207705_10140858
641 Ga0207684_10001521
642 Ga0207684_10039524
643 Ga0207684_10142268
644 Ga0207707_10000034
645 Ga0207693_10010300
646 Ga0207663_10100431
647 Ga0207660_10000276
648 Ga0207662_10036409
649 Ga0207657_10000066
650 Ga0207657_10100484
651 Ga0207649_10001774
652 Ga0207652_10000245
653 Ga0207652_10235572
654 Ga0207646_10033493
655 Ga0207646_10043603
656 Ga0207646_10062922
657 Ga0207650_10005088
658 Ga0207687_10016456
659 Ga0207687_10036937
660 Ga0207690_10016489
661 Ga0207706_10020126
662 Ga0207709_10006216
663 Ga0207665_10054185
664 Ga0207691_10050425
665 Ga0207711_10073254
666 Ga0207689_10000153
667 Ga0207689_10022323
668 Ga0207689_10025422
669 Ga0207679_10001070
670 Ga0207667_10000790
671 Ga0207651_10106700
672 Ga0207712_10140232
673 Ga0207712_10242113
674 Ga0207640_10002816
675 Ga0207703_10018921
676 Ga0207639_10007488
677 Ga0207639_10018813
678 Ga0207708_10014033
679 Ga0207708_10015525
680 Ga0207702_10000483
681 Ga0207641_10062359
682 Ga0207641_10088802
683 Ga0207641_10129447
684 Ga0207641_10439107
685 Ga0207648_10000002
686 Ga0207674_10000050
687 Ga0207674_10048528
688 Ga0207675_100011318
689 Ga0207675_100130963
690 Ga0207698_10019109
691 Ga0207698_10065890
692 Ga0207698_10113344
693 Ga0209996_1001383
694 Ga0209995_1000387
695 Ga0209968_1000959
696 Ga0209982_1004143
697 Ga0209971_1000070
698 Ga0209966_1000680
699 Ga0209998_10000126
700 Ga0209974_10000121
701 Ga0207428_10000054
702 Ga0268265_10081371
703 Ga0268264_10065359
704 Ga0268264_10122839
705 Ga0307517_10004091
706 Ga0307517_10016993
707 Ga0307515_10002244
708 Ga0307515_10003048
709 Ga0307515_10013996
710 Ga0307515_10030200
711 Ga0265338_10000522
712 Ga0307511_10000585
713 Ga0307511_10002257
714 Ga0307511_10123987
715 Ga0307512_10042169
716 Ga0265330_10038865
717 Ga0265340_10014739
718 Ga0265316_10000422
719 Ga0265316_10004191
720 Ga0265316_10036248
721 Ga0307513_10011199
722 Ga0307513_10047851
723 Ga0307513_10123337
724 Ga0307509_10003613
725 Ga0307509_10013774
726 Ga0307509_10021186
727 Ga0307509_10023171
728 Ga0307509_10028397
729 Ga0307408_100044554
730 Ga0307508_10001755
731 Ga0307508_10009727
732 Ga0307508_10014007
733 Ga0307508_10017933
734 Ga0307508_10019331
735 Ga0307514_10003655
736 Ga0307514_10077985
737 Ga0265342_10040382
738 Ga0265342_10076280
739 Ga0307516_10006239
740 Ga0307516_10039202
741 Ga0307516_10067525
742 Ga0307516_10120165
743 Ga0307413_10119841
744 Ga0307412_10043000
745 Ga0307411_10113967
746 Ga0307507_10000140
747 Ga0307507_10028589
748 Ga0307510_10006872
749 Ga0307510_10039243
750 Ga0316214_1002087
751 Ga0373954_0001486
752 Ga0373956_0000055
753 Ga0373955_0016088
754 Ga0373955_0044133
755 Ga0373927_0000023
756 Ga0373933_0200300
757 Ga0373937_0227147
758 Ga0372808_000575
759 Ga0373925_0000343
760 Ga0395899_0025528
761 Ga0395900_0045811
762 Ga0395905_0007847
763 Ga0395901_0013986
764 Ga0439466_0007496
765 Ga0439465_0001080
766 Ga0451833_1305067
767 Ga0439431_0001562
768 Ga0439445_0000408
769 Ga0439448_0004198
770 Ga0439432_005149
771 Ga0439449_0001426
772 Ga0439449_0005212
773 Ga0439452_001192
774 Ga0439452_020722
775 Ga0439455_0001873
776 Ga0439457_007416
777 Ga0439457_009553
778 Ga0439462_0007876
779 Ga0439458_0003221
780 Ga0439460_0000911
781 Ga0451577_0000288
782 Ga0451577_0003499
783 Ga0451577_0031343
784 Ga0451577_0340373
785 Ga0453683_0019755
786 Ga0453683_0030886
787 Ga0453684_0062840
788 Ga0453684_0135621
789 Ga0453684_0140959
790 Ga0451576_0008536
791 Ga0451576_0252336
792 Ga0451576_0346494
793 Ga0495627_014922
794 Ga0495629_0001664
795 Ga0495629_0013922
796 Ga0495629_0129309
797 Ga0495651_0036072
798 Ga0495651_0102580
799 Ga0495653_0027555
800 Ga0495580_0115019
801 Ga0495582_0026506
802 Ga0495639_0002883
803 Ga0495662_0000567
804 Ga0495662_0017952
805 Ga0495664_0059257
806 Ga0495585_0004992
807 Ga0495608_0002615
808 Ga0495618_0063105
809 Ga0495628_0030486
810 Ga0495628_0156966
811 Ga0495630_0000359
812 Ga0495630_0051041
813 Ga0495631_0057553
814 Ga0495643_0002249
815 Ga0495648_0002107
816 Ga0495652_0001574
817 Ga0495652_0041027
818 Ga0495652_0106836
819 Ga0495652_0230983
820 Ga0495665_0009674
821 Ga0495640_0001812
822 Ga0495640_0080438
823 Ga0495586_0009232
824 Ga0495586_0085682
825 Ga0495587_0043951
826 Ga0495587_0128887
827 Ga0495622_0000639
828 Ga0495633_0035250
829 Ga0495667_0039327
830 Ga0495667_0049072
831 Ga0495668_0088301
832 Ga0495634_0000711
833 Ga0495634_0022103
834 Ga0495634_0134274
835 Ga0495625_0003686
836 Ga0495635_0009141
837 Ga0495635_0037691
838 Ga0495635_0059336
839 Ga0495635_0101093
840 Ga0495588_0007983
841 Ga0495657_0007162
842 Ga0495657_0018617
843 Ga0495599_0026551
844 Ga0495623_0014071
845 Ga0495646_0010771
846 Ga0495613_0007385
847 Ga0495613_0011746
848 Ga0495613_0017716
849 Ga0495670_0008729
850 Ga0495670_0020288
851 Ga0495671_0000820
852 Ga0495600_0052479
853 Ga0495600_0055085
854 Ga0495660_0029718
855 Ga0495660_0076180
856 Ga0495660_0076766
857 Ga0495581_0108662
858 Ga0495604_0011636
859 Ga0495604_0101177
860 Ga0495674_0042157
861 Ga0495674_0089542
862 Ga0495674_0090939
863 Ga0495676_0004221
864 Ga0495676_0015168
865 Ga0495680_0055374
866 Ga0495680_0124606
867 Ga0495683_0002620
868 Ga0495687_003659
869 Ga0495687_004919
870 Ga0495687_049374
871 Ga0495687_073723
872 Ga0495685_001290
873 Ga0495673_0001614
874 Ga0495681_0003678
875 Ga0495681_0005117
876 Ga0495686_0051407
877 Ga0495602_0045632
878 Ga0495614_0005003
879 Ga0495614_0009316
880 Ga0496102_0029828
881 Ga0496102_0118566
882 Ga0496106_0012835
883 Ga0496106_0029801
884 Ga0496108_0113922
885 Ga0501036_0075056
886 Ga0501038_0048015
887 Ga0501040_0007330
888 Ga0501041_0016587
889 Ga0501042_0026365
890 Ga0501042_0146227
891 Ga0501046_0000084
892 Ga0501047_0026457
893 Ga0501067_0063385
894 Ga0501068_0027333
895 Ga0501068_0046443
896 Ga0501072_0107596
897 Ga0501074_0004755
898 Ga0501074_0086462
899 Ga0501074_0095644
900 Ga0501075_0070970
901 Ga0501075_0090023
902 Ga0501076_0006353
903 Ga0501076_0054572
904 Ga0501076_0091825
905 Ga0501077_0011470
906 Ga0501077_0041712
907 Ga0501079_0002073
908 Ga0501079_0020570
909 Ga0501079_0054969
910 Ga0501080_0022486
911 Ga0501081_0001187
912 Ga0501081_0005445
913 Ga0501081_0016469
914 Ga0501083_0007029
915 Ga0501045_0002792
916 Ga0501045_0068618
917 Ga0501045_0075777
918 nmdc:mga05p37_240111_c1
919 nmdc:mga05p37_67379_c1
920 nmdc:mga09592_81949_c1
921 nmdc:mga06r32_21610_c1
922 nmdc:mga06r32_265107_c1
923 nmdc:mga08y16_7654_c1
924 nmdc:mga0n895_14276_c1
925 nmdc:mga0n895_148845_c1
926 nmdc:mga0rr50_137945_c1
927 nmdc:mga0rr50_9745_c1
928 nmdc:mga08x19_111402_c1
929 nmdc:mga0a205_14587_c1
930 nmdc:mga0a205_55512_c1
931 nmdc:mga0a205_7787_c1
932 Ga0495601_0000443
933 Ga0495612_0002016
934 Ga0500610_0000294
935 Ga0500610_0000321
936 Ga0495655_0003668
937 Ga0500578_0015320
938 Ga0500646_0015885
939 Ga0500556_0022021
940 Ga0500569_011479
941 Ga0500593_001339
942 Ga0500607_000992
943 Ga0500621_034195
944 Ga0500652_002124
945 Ga0500658_0004546
946 Ga0500561_0000834
947 Ga0500573_0027441
948 Ga0500573_0093171
949 Ga0500579_061561
950 Ga0500600_0009889
951 Ga0500616_0012592
952 Ga0500633_0001186
953 Ga0500634_0005815
954 Ga0500634_0066763
955 Ga0500656_000287
956 Ga0501084_0000139
957 Ga0501084_0008107
958 Ga0501082_0003568
959 Ga0501082_0103929
960 Ga0530510_0026317
961 2506866797
962 2585311425
963 2774906062
964 2862391227
965 2885196853
966 8008558919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

71

451

0.96

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

101

256

0.84

PF00155

Aminotran_1_2

Aminotransferase class I and II

114

278

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cja-assembly1.cif.gz_D crystal structure of cystathionine beta-lyase from legionella pneumophila philadelphia 1 in complex with alanyl-plp and serine 0.9615 8 375
6k1l-assembly1.cif.gz_B e53a mutant of a putative cystathionine gamma-lyase 0.9604 8 375
4iyo-assembly1.cif.gz_D crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. oryzae (xometc) in complex with e-site serine, a-site serine, a-site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates 0.9589 8 375
6k1m-assembly1.cif.gz_C engineered form of a putative cystathionine gamma-lyase 0.956 8 375
6nba-assembly1.cif.gz_D crystal structure of human cystathionine gamma lyase with s-3-carboxpropyl-l-cysteine 0.9524 8 377
ID Description Score Start End Superfamily
3e6gD01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9843 8 253 3.40.640.10
3e6gD01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9703 8 253 3.40.640.10
af_P32929_263_402_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9635 259 377 3.90.1150.10
af_Q55DV9_2_251_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9538 3 256 3.40.640.10
af_Q2G120_12_246_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9508 23 256 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A529ZDV4-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9948 90 200 GO:0003962
GO:0004123
GO:0005737
GO:0008483
GO:0019343
GO:0019346
GO:0030170
AF-A0A183DAI6-F1-model_v4 cystathionine gamma-lyase (EC 4.4.1.1) (Gamma-cystathionase) 0.9917 293 377 GO:0004123
GO:0005737
GO:0019343
GO:0019346
GO:0030170
AF-A0A7S2W7Z0-F1-model_v4 Cystathionine gamma-lyase 0.9854 125 218 GO:0005737
GO:0016846
GO:0019346
GO:0030170
AF-A0A0F9C274-F1-model_v4 Cystathionine gamma-synthase 0.9826 281 378 GO:0005737
GO:0016846
GO:0019346
GO:0030170
AF-R4G766-F1-model_v4 Cystathionine beta-lyase 0.9821 291 378 GO:0005737
GO:0016846
GO:0019346
GO:0030170

Map