F452852

General Info

Members Datasets Scaffolds Average Seq Length
483 335 966 225

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_000849|Ga0500618_000849_13301_13981
Length 205
Sequence MTHLLDRPAWNALVTVHADFAEGSALARRYDPSIVLFAAPADDTPESLAALAALPAASEVLLLVEAGPITVPPGLEITLESVLVQMLAEKTFLATLTKPGPFTLKAQALGTFWGIRVDGRIVAMCGQRMRQLGFSELSGLCVHPDFQGKGLGKLMLRFVAGEISARNEAVYLHAYKTNTGAIALYQSLGFAIRADMNMKVVKRAG

Samples

Sample ID Description Type Environment
1 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
46 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
50 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
78 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
88 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
89 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
90 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
91 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
92 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
93 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
94 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
95 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
96 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
97 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
98 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
101 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
181 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
182 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
183 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
184 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
187 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
191 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
192 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
196 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
197 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
198 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
199 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
200 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
201 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
202 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
203 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
204 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
205 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
206 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
207 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
208 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
209 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
210 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
211 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
212 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
213 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
214 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
215 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
216 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
217 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
218 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
219 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
220 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
221 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
222 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
223 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
224 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
225 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
226 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
227 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
228 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
229 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
230 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
231 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
232 2718217882 Rhizobium sp. N741 Isolate Nodule
233 2718218009 Rhizobium sp. N561 Isolate Nodule
234 2718218363 Rhizobium sp. N113 Isolate Nodule
235 2718218365 Rhizobium sp. N731 Isolate Nodule
236 2718218366 Rhizobium sp. N621 Isolate Nodule
237 2721755514 Rhizobium sp. N6212 Isolate Nodule
238 2721755810 Rhizobium sp. N871 Isolate Nodule
239 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
240 2728369365 Rhizobium sp. N1341 Isolate Nodule
241 2728369397 Rhizobium sp. N1314 Isolate Nodule
242 2738541293 Rhizobium sp. GV031 Isolate Unclassified
243 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
244 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
245 2791355256 Rhizobium sp. M10 Isolate Nodule
246 2791355260 Rhizobium sp. L9 Isolate Nodule
247 2791355261 Rhizobium sp. J15 Isolate Nodule
248 2791355262 Rhizobium sp. M1 Isolate Nodule
249 2791355264 Rhizobium sp. S9 Isolate Nodule
250 2791355265 Rhizobium sp. H4 Isolate Nodule
251 2791355267 Rhizobium sp. L18 Isolate Nodule
252 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
253 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
254 2802429633 Rhizobium anhuiense J3 Isolate Nodule
255 2802429634 Rhizobium anhuiense S10 Isolate Nodule
256 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
257 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
258 2802429637 Rhizobium anhuiense C15 Isolate Nodule
259 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
260 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
261 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
262 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
263 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
264 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
265 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
266 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
267 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
268 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
269 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
270 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
271 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
272 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
273 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
274 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
275 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
276 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
277 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
278 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
279 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
280 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
281 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
282 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
283 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
284 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
285 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
286 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
287 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
288 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
289 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
290 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
291 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
292 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
293 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
294 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
295 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
296 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
297 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
298 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
299 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
300 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
301 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
302 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
303 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
304 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
305 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
306 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
307 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
308 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
309 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
310 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
311 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
312 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
313 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
314 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
315 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
316 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
317 8005382845 Rhizobium sp. R634 Isolate Nodule
318 8005395548 Rhizobium sp. R339 Isolate Nodule
319 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
320 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
321 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
322 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
323 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
324 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
325 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
326 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
327 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
328 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
329 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
330 8024501048 Rhizobium sp. H4 Isolate Nodule
331 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
332 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
333 8056382006 Rhizobium croatiense 13T Isolate Nodule
334 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
335 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.6
Metatranscriptomes 0
Isolates 29.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.67
Nodule 23.6
Rhizoplane 2.48
Rhizosphere 27.95
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500618_000849 3300053125 Bacteria 16428
2 JGI25155J39150_1000016 3300002704 Bacteria 163128
3 JGI25156J39149_1000018 3300002705 Bacteria 163121
4 JGI25156J39149_1000046 3300002705 Bacteria 102206
5 JGI25162J39368_1000804 3300002737 Bacteria 20830
6 JGI25154J39366_1000018 3300002738 Bacteria 251612
7 JGI25158J39367_1000499 3300002739 Bacteria 7922
8 JGI25157J39369_1000022 3300002741 Bacteria 163121
9 JGI25157J39369_1000215 3300002741 Bacteria 47335
10 JGI25152J39213_1002412 3300002773 Bacteria 7127
11 JGI25152J39213_1004429 3300002773 Bacteria 4424
12 JGI25152J39213_1012339 3300002773 Bacteria 1841
13 JGI25150J39212_1006674 3300002774 Bacteria 2364
14 JGI25159J45721_1004319 3300002987 Bacteria 4748
15 JGI25151J46595_10000146 3300003187 Bacteria 93373
16 JGI25151J46595_10000464 3300003187 Bacteria 38808
17 JGI25151J46595_10005849 3300003187 Bacteria 6291
18 JGI25151J46595_10056076 3300003187 Bacteria 1295
19 JGI25165J46597_1000416 3300003214 Bacteria 44195
20 JGI25165J46597_1005261 3300003214 Bacteria 2540
21 JGI25153J46596_10007382 3300003215 Bacteria 5419
22 JGI25153J46596_10007595 3300003215 Bacteria 5303
23 JGI25153J46596_10011015 3300003215 Bacteria 4033
24 JGI25153J46596_10030503 3300003215 Bacteria 1834
25 rootH1_10122008 3300003323 Bacteria 3238
26 rootH1_10326835 3300003323 Bacteria 2406
27 JGI25160J50197_1000053 3300003354 Bacteria 127632
28 JGI25160J50197_1001340 3300003354 Bacteria 12419
29 JGI25161J50226_1000039 3300003374 Bacteria 127632
30 JGI25161J50226_1000283 3300003374 Bacteria 28981
31 Ga0055526_1000946 3300003771 Bacteria 21518
32 Ga0055526_1028082 3300003771 Bacteria 1713
33 Ga0055524_1004489 3300003775 Bacteria 6431
34 Ga0055524_1008553 3300003775 Bacteria 4243
35 Ga0055524_1011912 3300003775 Bacteria 3367
36 Ga0055528_1000549 3300003790 Bacteria 28640
37 Ga0055528_1006146 3300003790 Bacteria 5481
38 Ga0055540_1000177 3300003792 Bacteria 62976
39 Ga0055540_1005952 3300003792 Bacteria 4961
40 Ga0055543_1000015 3300004625 Bacteria 177197
41 Ga0055543_1000060 3300004625 Bacteria 98330
42 Ga0055543_1000839 3300004625 Bacteria 14922
43 Ga0065165_1000361 3300005262 Bacteria 74514
44 Ga0065165_1015662 3300005262 Bacteria 2882
45 Ga0065165_1026792 3300005262 Bacteria 1890
46 Ga0070670_100041278 3300005331 Bacteria 3966
47 Ga0070667_100412650 3300005367 Bacteria 1230
48 Ga0070663_100157506 3300005455 Bacteria 1746
49 Ga0070665_100042163 3300005548 Bacteria 4587
50 Ga0070665_101084482 3300005548 Bacteria 812
51 Ga0068855_100157125 3300005563 Bacteria 2583
52 Ga0075365_10008623 3300006038 Bacteria 5805
53 Ga0075363_100048591 3300006048 Bacteria 2257
54 Ga0075362_10006188 3300006177 Bacteria 4444
55 Ga0075369_10027804 3300006186 Bacteria 2366
56 Ga0075366_10008373 3300006195 Bacteria 5745
57 Ga0075370_10085385 3300006353 Bacteria 1817
58 Ga0079104_1000884 3300006946 Bacteria 24591
59 Ga0105244_10156467 3300009036 Bacteria 1090
60 Ga0105240_10000013 3300009093 Bacteria 483458
61 Ga0105248_10386608 3300009177 Bacteria 1575
62 Ga0105237_10000949 3300009545 Bacteria 38978
63 Ga0105238_10082733 3300009551 Bacteria 3200
64 Ga0105239_10010104 3300010375 Bacteria 10579
65 Ga0157370_10004388 3300013104 Bacteria 16193
66 Ga0163162_10319833 3300013306 Bacteria 1684
67 Ga0182008_10008431 3300014497 Bacteria 5626
68 Ga0182007_10004002 3300015262 Bacteria 6800
69 Ga0209435_100017 3300025206 Bacteria 303699
70 Ga0209436_100061 3300025208 Bacteria 58629
71 Ga0207427_109037 3300025231 Bacteria 1086
72 Ga0209437_100104 3300025233 Bacteria 220736
73 Ga0207425_1000046 3300025245 Bacteria 189433
74 Ga0207425_1003220 3300025245 Bacteria 5331
75 Ga0207425_1014621 3300025245 Bacteria 1778
76 Ga0209646_1000048 3300025246 Bacteria 303808
77 Ga0209026_1000035 3300025250 Bacteria 303808
78 Ga0209677_101582 3300025253 Bacteria 9653
79 Ga0209148_1015760 3300025254 Bacteria 1313
80 Ga0209759_1000027 3300025256 Bacteria 303808
81 Ga0209129_1000171 3300025258 Bacteria 95724
82 Ga0209129_1000307 3300025258 Bacteria 44447
83 Ga0209129_1001327 3300025258 Bacteria 13978
84 Ga0209129_1003217 3300025258 Bacteria 7286
85 Ga0209129_1009623 3300025258 Bacteria 2516
86 Ga0209233_1000054 3300025261 Bacteria 439669
87 Ga0209233_1000646 3300025261 Bacteria 17234
88 Ga0209673_1000010 3300025273 Bacteria 596656
89 Ga0209673_1002016 3300025273 Bacteria 15617
90 Ga0209673_1002085 3300025273 Bacteria 15030
91 Ga0209673_1006098 3300025273 Bacteria 5910
92 Ga0209130_1000020 3300025284 Bacteria 379297
93 Ga0209130_1000038 3300025284 Bacteria 264226
94 Ga0209675_1031225 3300025291 Bacteria 1261
95 Ga0209676_1022446 3300025292 Bacteria 2091
96 Ga0209025_1000137 3300025294 Bacteria 190136
97 Ga0209025_1000563 3300025294 Bacteria 68086
98 Ga0209025_1000927 3300025294 Bacteria 44856
99 Ga0209025_1002842 3300025294 Bacteria 17370
100 Ga0209025_1014918 3300025294 Bacteria 4733
101 Ga0209564_1000265 3300025295 Bacteria 110606
102 Ga0209564_1004995 3300025295 Bacteria 7800
103 Ga0209564_1008091 3300025295 Bacteria 5262
104 Ga0209758_1000123 3300025297 Bacteria 190136
105 Ga0209758_1000534 3300025297 Bacteria 60556
106 Ga0209758_1001457 3300025297 Bacteria 27782
107 Ga0209758_1012652 3300025297 Bacteria 4696
108 Ga0209758_1012944 3300025297 Bacteria 4607
109 Ga0209758_1013086 3300025297 Bacteria 4562
110 Ga0209758_1029593 3300025297 Bacteria 2285
111 Ga0209758_1045599 3300025297 Bacteria 1590
112 Ga0209050_1018608 3300025298 Bacteria 2687
113 Ga0209256_1000655 3300025299 Bacteria 47114
114 Ga0209256_1002077 3300025299 Bacteria 17609
115 Ga0209256_1009344 3300025299 Bacteria 4320
116 Ga0207426_1000008 3300025302 Bacteria 848730
117 Ga0207426_1000081 3300025302 Bacteria 304502
118 Ga0207426_1000408 3300025302 Bacteria 72326
119 Ga0209051_1000125 3300025303 Bacteria 142863
120 Ga0209051_1004790 3300025303 Bacteria 8163
121 Ga0209051_1031143 3300025303 Bacteria 2057
122 Ga0209051_1052492 3300025303 Bacteria 1346
123 Ga0209257_1003624 3300025304 Bacteria 12995
124 Ga0209257_1027402 3300025304 Bacteria 1897
125 Ga0207647_10151210 3300025904 Bacteria 1357
126 Ga0207695_10000044 3300025913 Bacteria 440819
127 Ga0207671_10000043 3300025914 Bacteria 206915
128 Ga0207694_10053250 3300025924 Bacteria 3137
129 Ga0207650_10000911 3300025925 Bacteria 22288
130 Ga0207711_10266675 3300025941 Bacteria 1575
131 Ga0207640_10204548 3300025981 Bacteria 1499
132 Ga0207658_10343890 3300025986 Bacteria 1297
133 Ga0209281_1000034 3300027111 Bacteria 382562
134 Ga0209371_1002516 3300027312 Bacteria 10152
135 Ga0268266_10029374 3300028379 Bacteria 4674
136 Ga0268266_10643208 3300028379 Bacteria 1020
137 Ga0307515_10010740 3300028794 Bacteria 17490
138 Ga0268256_1016462 3300030500 Bacteria 2118
139 Ga0307513_10036226 3300031456 Bacteria 5509
140 Ga0307405_10016982 3300031731 Bacteria 3984
141 Ga0307405_10195234 3300031731 Bacteria 1465
142 Ga0307406_10026280 3300031901 Bacteria 3494
143 Ga0307412_10039612 3300031911 Bacteria 3044
144 Ga0436365_0686133 3300039437 Bacteria 883
145 Ga0439465_0010315 3300041413 Bacteria 2937
146 Ga0439465_0193945 3300041413 Bacteria 738
147 Ga0451797_0254921 3300041453 Bacteria 1026
148 Ga0451798_0596649 3300041458 Bacteria 1982
149 Ga0451833_0190634 3300041491 Bacteria 2524
150 Ga0451837_0542867 3300041494 Bacteria 1363
151 Ga0451839_0259588 3300041496 Bacteria 4166
152 Ga0451839_0892333 3300041496 Bacteria 2403
153 Ga0451841_0098319 3300041498 Bacteria 5327
154 Ga0451841_0167886 3300041498 Bacteria 4373
155 Ga0451845_0002142 3300041501 Bacteria 3819
156 Ga0451845_0418311 3300041501 Bacteria 4918
157 Ga0451847_0106237 3300041503 Bacteria 3525
158 Ga0451847_0311569 3300041503 Bacteria 3654
159 Ga0451849_1037098 3300041505 Bacteria 4012
160 Ga0451851_0495644 3300041507 Bacteria 2824
161 Ga0451851_0598815 3300041507 Bacteria 3863
162 Ga0451843_0576612 3300041509 Bacteria 3756
163 Ga0451853_3429884 3300041512 Bacteria 1254
164 Ga0439462_0084994 3300042015 Bacteria 866
165 Ga0450906_025589 3300042145 Bacteria 1049
166 Ga0466965_0097330 3300044683 Bacteria 1502
167 Ga0466966_0031156 3300044684 Bacteria 3459
168 Ga0466963_0035063 3300044694 Bacteria 3267
169 Ga0466970_0000095 3300044765 Bacteria 37807
170 Ga0466958_0006038 3300045836 Bacteria 6564
171 Ga0466967_0015530 3300045976 Bacteria 5971
172 Ga0495592_0205476 3300046454 Bacteria 1326
173 Ga0495629_0020115 3300046459 Bacteria 4766
174 Ga0495638_0001134 3300046460 Bacteria 25773
175 Ga0495638_0073604 3300046460 Bacteria 2085
176 Ga0495605_0039934 3300046474 Bacteria 2347
177 Ga0495605_0088914 3300046474 Bacteria 1434
178 Ga0495662_0035439 3300046476 Bacteria 2407
179 Ga0495664_0263859 3300046477 Bacteria 1041
180 Ga0495583_0032746 3300046506 Bacteria 2507
181 Ga0495583_0098862 3300046506 Bacteria 1247
182 Ga0495606_0004697 3300046507 Bacteria 13488
183 Ga0495606_0011961 3300046507 Bacteria 7012
184 Ga0495606_0253404 3300046507 Bacteria 975
185 Ga0495606_0327092 3300046507 Bacteria 821
186 Ga0495606_0347973 3300046507 Bacteria 787
187 Ga0495610_0003664 3300046512 Bacteria 11821
188 Ga0495610_0060894 3300046512 Bacteria 1795
189 Ga0495610_0148904 3300046512 Bacteria 1001
190 Ga0495610_0164868 3300046512 Bacteria 934
191 Ga0495620_0055183 3300046515 Bacteria 1675
192 Ga0495620_0112557 3300046515 Bacteria 1077
193 Ga0495628_0413944 3300046516 Bacteria 983
194 Ga0495631_0001584 3300046518 Bacteria 13671
195 Ga0495632_0003362 3300046519 Bacteria 11400
196 Ga0495632_0031652 3300046519 Bacteria 2732
197 Ga0495632_0031708 3300046519 Bacteria 2729
198 Ga0495643_0004123 3300046522 Bacteria 10335
199 Ga0495643_0026735 3300046522 Bacteria 3251
200 Ga0495643_0054395 3300046522 Bacteria 2143
201 Ga0495648_0030039 3300046524 Bacteria 3600
202 Ga0495654_0001572 3300046530 Bacteria 15496
203 Ga0495654_0056018 3300046530 Bacteria 1907
204 Ga0495654_0070811 3300046530 Bacteria 1653
205 Ga0495640_0446461 3300046533 Bacteria 790
206 Ga0495609_0035524 3300046538 Bacteria 2256
207 Ga0495597_0051667 3300046542 Bacteria 1811
208 Ga0495656_0043153 3300046615 Bacteria 1892
209 Ga0495668_0009467 3300046616 Bacteria 5984
210 Ga0495668_0084573 3300046616 Bacteria 1740
211 Ga0495625_0002255 3300046660 Bacteria 21195
212 Ga0495625_0018027 3300046660 Bacteria 5517
213 Ga0495661_0209498 3300046665 Bacteria 1016
214 Ga0495661_0266090 3300046665 Bacteria 869
215 Ga0495658_0011233 3300046683 Bacteria 4498
216 Ga0495613_0319820 3300046689 Bacteria 1071
217 Ga0495624_0378285 3300046690 Bacteria 851
218 Ga0495670_0059899 3300046691 Bacteria 1912
219 Ga0495671_0101947 3300046692 Bacteria 1403
220 Ga0495671_0136282 3300046692 Bacteria 1197
221 Ga0495649_0091785 3300046694 Bacteria 1618
222 Ga0495649_0130693 3300046694 Bacteria 1325
223 Ga0495600_0026997 3300046809 Bacteria 3709
224 Ga0495660_0047145 3300046810 Bacteria 2361
225 Ga0495660_0076627 3300046810 Bacteria 1761
226 Ga0495672_0005525 3300047320 Bacteria 10005
227 Ga0495683_0072067 3300047323 Bacteria 1695
228 Ga0495686_0001486 3300047472 Bacteria 25489
229 Ga0495686_0007917 3300047472 Bacteria 7892
230 Ga0495686_0010881 3300047472 Bacteria 6442
231 Ga0495686_0112203 3300047472 Bacteria 1633
232 Ga0495686_0128317 3300047472 Bacteria 1506
233 Ga0495686_0141523 3300047472 Bacteria 1419
234 Ga0495602_0597879 3300048088 Bacteria 759
235 Ga0496100_0013013 3300048903 Bacteria 4787
236 Ga0496101_0061362 3300048904 Bacteria 2730
237 Ga0496102_0010779 3300048905 Bacteria 7873
238 Ga0496103_0005838 3300048906 Bacteria 7349
239 Ga0496105_0452896 3300048908 Bacteria 1013
240 Ga0496106_0006078 3300048909 Bacteria 8935
241 Ga0496110_0055542 3300048913 Bacteria 3485
242 Ga0496111_0061856 3300048914 Bacteria 2714
243 Ga0496113_0040164 3300048916 Bacteria 3447
244 Ga0496116_0004457 3300048919 Bacteria 13343
245 Ga0496116_0008842 3300048919 Bacteria 8671
246 Ga0496116_0015899 3300048919 Bacteria 5919
247 Ga0496116_0020164 3300048919 Bacteria 5072
248 Ga0496116_0023490 3300048919 Bacteria 4589
249 Ga0496116_0052473 3300048919 Bacteria 2701
250 Ga0496116_0052554 3300048919 Bacteria 2698
251 Ga0496116_0199364 3300048919 Bacteria 1049
252 Ga0496116_0254635 3300048919 Unclassified 871
253 Ga0496117_0003614 3300048920 Bacteria 17814
254 Ga0496117_0010221 3300048920 Bacteria 8599
255 Ga0496117_0030997 3300048920 Bacteria 4091
256 Ga0496117_0033189 3300048920 Bacteria 3907
257 Ga0496118_0004165 3300048921 Bacteria 17449
258 Ga0496118_0031163 3300048921 Bacteria 4429
259 Ga0496118_0086457 3300048921 Bacteria 2178
260 Ga0496119_0012204 3300048922 Bacteria 7008
261 Ga0496119_0019452 3300048922 Bacteria 5000
262 Ga0496120_0007611 3300048923 Bacteria 8028
263 Ga0496120_0159058 3300048923 Bacteria 1128
264 Ga0496121_0003229 3300048924 Bacteria 23446
265 Ga0496121_0006258 3300048924 Bacteria 14896
266 Ga0496121_0019047 3300048924 Bacteria 6886
267 Ga0496121_0026147 3300048924 Bacteria 5512
268 Ga0496121_0028214 3300048924 Bacteria 5230
269 Ga0496121_0033896 3300048924 Bacteria 4608
270 Ga0496121_0150838 3300048924 Bacteria 1710
271 Ga0496121_0180278 3300048924 Bacteria 1525
272 Ga0496121_0197188 3300048924 Bacteria 1438
273 Ga0496121_0329968 3300048924 Bacteria 1024
274 Ga0496121_0389473 3300048924 Unclassified 916
275 Ga0496122_0010069 3300048925 Bacteria 9817
276 Ga0496122_0014317 3300048925 Bacteria 7678
277 Ga0496122_0022687 3300048925 Bacteria 5571
278 Ga0496122_0047979 3300048925 Bacteria 3290
279 Ga0496122_0195074 3300048925 Bacteria 1190
280 Ga0496122_0284097 3300048925 Bacteria 902
281 Ga0496123_0008910 3300048926 Bacteria 9124
282 Ga0496123_0014316 3300048926 Bacteria 6584
283 Ga0496123_0024054 3300048926 Bacteria 4642
284 Ga0496123_0048132 3300048926 Bacteria 2871
285 Ga0496123_0058181 3300048926 Bacteria 2510
286 Ga0496123_0059301 3300048926 Bacteria 2475
287 Ga0496123_0186543 3300048926 Bacteria 1077
288 Ga0496124_0002089 3300048927 Bacteria 26962
289 Ga0496124_0015523 3300048927 Bacteria 7292
290 Ga0496124_0018624 3300048927 Bacteria 6496
291 Ga0496124_0048384 3300048927 Bacteria 3634
292 Ga0496124_0091403 3300048927 Bacteria 2480
293 Ga0496125_0014106 3300048928 Bacteria 7803
294 Ga0496125_0015361 3300048928 Bacteria 7412
295 Ga0496125_0021913 3300048928 Bacteria 5944
296 Ga0496126_0062814 3300048929 Bacteria 3331
297 Ga0496126_0523397 3300048929 Unclassified 945
298 Ga0495678_002029 3300049459 Bacteria 14513
299 Ga0495678_025749 3300049459 Bacteria 2522
300 Ga0501032_0122522 3300049569 Bacteria 1718
301 Ga0501036_0158754 3300049572 Bacteria 1907
302 Ga0501039_0070439 3300049575 Bacteria 2717
303 Ga0501043_0090628 3300049579 Bacteria 2404
304 Ga0501046_0421503 3300049580 Bacteria 962
305 Ga0501047_0110528 3300049581 Bacteria 2631
306 Ga0501047_0279300 3300049581 Bacteria 1515
307 Ga0501067_0002286 3300049583 Bacteria 10584
308 Ga0501035_0134686 3300049822 Bacteria 2152
309 Ga0501044_0323965 3300049823 Bacteria 1465
310 nmdc:mga03683_18149_c3 3300050489 Bacteria 1285
311 nmdc:mga0k408_7049_c1 3300050493 Bacteria 6001
312 nmdc:mga06z11_498181_c1 3300050494 Bacteria 738
313 nmdc:mga0sz30_11965_c2 3300050516 Bacteria 2347
314 Ga0500610_0183196 3300053079 Bacteria 1023
315 Ga0495619_0289471 3300053085 Bacteria 1135
316 Ga0500651_0054028 3300053093 Bacteria 2519
317 Ga0500651_0127637 3300053093 Bacteria 1540
318 Ga0500557_000501 3300053105 Bacteria 5231
319 Ga0500562_033737 3300053108 Bacteria 1353
320 Ga0500569_025601 3300053109 Bacteria 1608
321 Ga0500569_027736 3300053109 Bacteria 1563
322 Ga0500594_0003894 3300053118 Bacteria 3288
323 Ga0500618_000875 3300053125 Bacteria 16083
324 Ga0500618_033550 3300053125 Bacteria 1197
325 Ga0500658_0000638 3300053134 Bacteria 14548
326 Ga0500658_0154991 3300053134 Bacteria 1034
327 Ga0500568_0001714 3300053139 Bacteria 13653
328 Ga0500568_0003195 3300053139 Bacteria 9316
329 Ga0500568_0041065 3300053139 Bacteria 1860
330 Ga0500577_0219671 3300053142 Bacteria 822
331 Ga0500590_005712 3300053148 Bacteria 6004
332 Ga0500616_0000576 3300053153 Bacteria 44650
333 Ga0500616_0005531 3300053153 Bacteria 8558
334 Ga0500616_0017972 3300053153 Bacteria 4003
335 Ga0500622_0003878 3300053156 Bacteria 9707
336 Ga0500622_0051610 3300053156 Bacteria 2116
337 Ga0500627_0050362 3300053158 Bacteria 1814
338 Ga0500636_0163711 3300053177 Bacteria 1210
339 Ga0500645_045941 3300053730 Bacteria 1282
340 Ga0501084_0052322 3300054114 Bacteria 3417
341 Ga0501082_0259561 3300060353 Bacteria 1511
342 2510133070 2510065019 Bacteria 6903379
343 2510894434 2510461076 Bacteria 8618824
344 2510899460 2510461076 Bacteria 8618824
345 2511199243 2510917030 Bacteria 7460662
346 2513569850 2513237084 Bacteria 7231967
347 2513575117 2513237085 Bacteria 7695351
348 2513635584 2513237093 Bacteria 7545552
349 2513713472 2513237103 Bacteria 7647401
350 2513925190 2513237146 Bacteria 7166346
351 2514021875 2513237162 Bacteria 7468464
352 2515112020 2515075009 Bacteria 7288508
353 2515635506 2515154113 Bacteria 7807172
354 2515645015 2515154114 Bacteria 7848616
355 2515660160 2515154116 Bacteria 7552979
356 2515738803 2515154134 Bacteria 7220242
357 2517035757 2516653077 Bacteria 7555578
358 2517076175 2516653085 Bacteria 7346596
359 2517094920 2517093000 Bacteria 7412387
360 2517406553 2517287029 Bacteria 6905599
361 2524457726 2524023209 Bacteria 6679728
362 2530645324 2529292951 Bacteria 6916614
363 2585223073 2582581298 Bacteria 7315509
364 2585258276 2582581304 Bacteria 5831370
365 2585279744 2582581308 Bacteria 7413247
366 2585326717 2582581315 Bacteria 7318924
367 2585334931 2582581316 Bacteria 7774528
368 2585528331 2585427526 Bacteria 7258840
369 2585531853 2585427527 Bacteria 7273426
370 2585540512 2585427528 Bacteria 6842387
371 2585545656 2585427529 Bacteria 7395659
372 2585551200 2585427530 Bacteria 7383882
373 2585838728 2585427593 Bacteria 7141551
374 2585843464 2585427594 Bacteria 6180594
375 2599417097 2599185170 Bacteria 7295545
376 2599718758 2599185236 Bacteria 6875203
377 2616292670 2615840624 Bacteria 6557588
378 2616306534 2615840626 Bacteria 7921970
379 2616552844 2615840698 Bacteria 7319877
380 2719180976 2718217882 Bacteria 6556348
381 2719731725 2718218009 Bacteria 6478651
382 2721147070 2718218363 Bacteria 6524337
383 2721158598 2718218365 Bacteria 6274507
384 2721163988 2718218366 Bacteria 6425255
385 2722840158 2721755514 Bacteria 6424414
386 2724044481 2721755810 Bacteria 6479005
387 2725948717 2724679232 Bacteria 7646494
388 2730164213 2728369365 Bacteria 6555560
389 2730298230 2728369397 Bacteria 6274511
390 2738800315 2738541293 Bacteria 7065685
391 2739038008 2738541333 Bacteria 7106503
392 2766062950 2765235942 Bacteria 7445910
393 2793298236 2791355256 Bacteria 6798008
394 2793324311 2791355260 Bacteria 6598818
395 2793326476 2791355261 Bacteria 6661293
396 2793337072 2791355262 Bacteria 6774204
397 2793347507 2791355264 Bacteria 6429314
398 2793352427 2791355265 Bacteria 6539969
399 2793369640 2791355267 Bacteria 7222458
400 2805927756 2802429605 Bacteria 6875453
401 2805935664 2802429606 Bacteria 6346811
402 2806045367 2802429633 Bacteria 7341974
403 2806055440 2802429634 Bacteria 7083200
404 2806061483 2802429635 Bacteria 7650140
405 2806068057 2802429636 Bacteria 7597525
406 2806072595 2802429637 Bacteria 7067217
407 2819638631 2818991453 Bacteria 7181617
408 2819685150 2818991461 Bacteria 7026071
409 2821125725 2821123053 Bacteria 7836056
410 2837680538 2837678835 Bacteria 5252418
411 2838038696 2838035591 Bacteria 7166484
412 2838661382 2838661181 Bacteria 7385261
413 2838670203 2838668709 Bacteria 6671819
414 2838689248 2838686498 Bacteria 7807632
415 2838702574 2838701080 Bacteria 6669771
416 2838730596 2838729681 Bacteria 7400765
417 2838737824 2838736955 Bacteria 5760694
418 2838743537 2838742623 Bacteria 7396178
419 2841841807 2841840854 Bacteria 5761912
420 2841854787 2841851746 Bacteria 7532261
421 2842110725 2842110456 Bacteria 7656360
422 2842141585 2842140634 Bacteria 5759631
423 2842146881 2842146304 Bacteria 5957337
424 2842157650 2842156927 Bacteria 6894975
425 2842164848 2842163707 Bacteria 6916235
426 2842180765 2842180545 Bacteria 6888678
427 2842196864 2842192696 Bacteria 6147454
428 2842206259 2842205361 Bacteria 6340321
429 2842222949 2842217011 Bacteria 7497767
430 2842231177 2842229732 Bacteria 7475766
431 2842244716 2842243621 Bacteria 7421798
432 2842251946 2842250916 Bacteria 6579627
433 2842258529 2842257432 Bacteria 7401195
434 2842273268 2842271015 Bacteria 7807131
435 2842279716 2842278818 Bacteria 6340002
436 2842287362 2842285085 Bacteria 6011953
437 2842300659 2842298080 Bacteria 6123127
438 2842310070 2842304105 Bacteria 7023636
439 2842318130 2842317721 Bacteria 6793725
440 2842358223 2842357229 Bacteria 6485165
441 2842405108 2842402390 Bacteria 6681310
442 2842411691 2842409023 Bacteria 6687331
443 2842417859 2842415677 Bacteria 6596907
444 2842485382 2842482326 Bacteria 7212537
445 2842492905 2842489311 Bacteria 6620893
446 2842496400 2842495871 Bacteria 6820686
447 2842509413 2842509118 Bacteria 6850950
448 2844459397 2844454524 Bacteria 7952546
449 2857518488 2857516855 Bacteria 7787325
450 2857532286 2857531043 Bacteria 6754041
451 2919106241 2919100787 Bacteria 7710546
452 2933018201 2933016740 Bacteria 6355406
453 2933576569 2933570622 Bacteria 7023390
454 2933586751 2933586486 Bacteria 7667493
455 2935904506 2935901341 Bacteria 7341747
456 2936372966 2936367885 Bacteria 7324495
457 2936381118 2936375103 Bacteria 6652732
458 3005414346 3005409236 Bacteria 7188837
459 3005448666 3005445848 Bacteria 6906074
460 639648305 639633055 Bacteria 7751309
461 8005294927 8005289223 Bacteria 6634003
462 8005306908 8005301065 Bacteria 6614431
463 8005314293 8005307578 Bacteria 7395396
464 8005378954 8005376324 Bacteria 6590079
465 8005388135 8005382845 Bacteria 6732062
466 8005396908 8005395548 Bacteria 6806915
467 8005462679 8005460587 Bacteria 7157962
468 8005485928 8005484373 Bacteria 6297373
469 8005557964 8005556819 Bacteria 6908598
470 8005569137 8005563573 Bacteria 7153261
471 8005575580 8005570704 Bacteria 6957481
472 8005683727 8005682033 Bacteria 6726518
473 8005694826 8005688590 Bacteria 6610080
474 8018129696 8018127388 Bacteria 7351159
475 8018168256 8018163183 Bacteria 7277977
476 8023681113 8023680758 Bacteria 7729763
477 8024485909 8024479707 Bacteria 6954785
478 8024505367 8024501048 Bacteria 6427847
479 8046769768 8046767195 Bacteria 7547379
480 8056377215 8056375014 Bacteria 7006639
481 8056388291 8056382006 Bacteria 6408074
482 8057577385 8057575449 Bacteria 7367519
483 8057875322 8057874678 Bacteria 7494653
484 Ga0500618_000849
485 JGI25155J39150_1000016
486 JGI25156J39149_1000018
487 JGI25156J39149_1000046
488 JGI25162J39368_1000804
489 JGI25154J39366_1000018
490 JGI25158J39367_1000499
491 JGI25157J39369_1000022
492 JGI25157J39369_1000215
493 JGI25152J39213_1002412
494 JGI25152J39213_1004429
495 JGI25152J39213_1012339
496 JGI25150J39212_1006674
497 JGI25159J45721_1004319
498 JGI25151J46595_10000146
499 JGI25151J46595_10000464
500 JGI25151J46595_10005849
501 JGI25151J46595_10056076
502 JGI25165J46597_1000416
503 JGI25165J46597_1005261
504 JGI25153J46596_10007382
505 JGI25153J46596_10007595
506 JGI25153J46596_10011015
507 JGI25153J46596_10030503
508 rootH1_10122008
509 rootH1_10326835
510 JGI25160J50197_1000053
511 JGI25160J50197_1001340
512 JGI25161J50226_1000039
513 JGI25161J50226_1000283
514 Ga0055526_1000946
515 Ga0055526_1028082
516 Ga0055524_1004489
517 Ga0055524_1008553
518 Ga0055524_1011912
519 Ga0055528_1000549
520 Ga0055528_1006146
521 Ga0055540_1000177
522 Ga0055540_1005952
523 Ga0055543_1000015
524 Ga0055543_1000060
525 Ga0055543_1000839
526 Ga0065165_1000361
527 Ga0065165_1015662
528 Ga0065165_1026792
529 Ga0070670_100041278
530 Ga0070667_100412650
531 Ga0070663_100157506
532 Ga0070665_100042163
533 Ga0070665_101084482
534 Ga0068855_100157125
535 Ga0075365_10008623
536 Ga0075363_100048591
537 Ga0075362_10006188
538 Ga0075369_10027804
539 Ga0075366_10008373
540 Ga0075370_10085385
541 Ga0079104_1000884
542 Ga0105244_10156467
543 Ga0105240_10000013
544 Ga0105248_10386608
545 Ga0105237_10000949
546 Ga0105238_10082733
547 Ga0105239_10010104
548 Ga0157370_10004388
549 Ga0163162_10319833
550 Ga0182008_10008431
551 Ga0182007_10004002
552 Ga0209435_100017
553 Ga0209436_100061
554 Ga0207427_109037
555 Ga0209437_100104
556 Ga0207425_1000046
557 Ga0207425_1003220
558 Ga0207425_1014621
559 Ga0209646_1000048
560 Ga0209026_1000035
561 Ga0209677_101582
562 Ga0209148_1015760
563 Ga0209759_1000027
564 Ga0209129_1000171
565 Ga0209129_1000307
566 Ga0209129_1001327
567 Ga0209129_1003217
568 Ga0209129_1009623
569 Ga0209233_1000054
570 Ga0209233_1000646
571 Ga0209673_1000010
572 Ga0209673_1002016
573 Ga0209673_1002085
574 Ga0209673_1006098
575 Ga0209130_1000020
576 Ga0209130_1000038
577 Ga0209675_1031225
578 Ga0209676_1022446
579 Ga0209025_1000137
580 Ga0209025_1000563
581 Ga0209025_1000927
582 Ga0209025_1002842
583 Ga0209025_1014918
584 Ga0209564_1000265
585 Ga0209564_1004995
586 Ga0209564_1008091
587 Ga0209758_1000123
588 Ga0209758_1000534
589 Ga0209758_1001457
590 Ga0209758_1012652
591 Ga0209758_1012944
592 Ga0209758_1013086
593 Ga0209758_1029593
594 Ga0209758_1045599
595 Ga0209050_1018608
596 Ga0209256_1000655
597 Ga0209256_1002077
598 Ga0209256_1009344
599 Ga0207426_1000008
600 Ga0207426_1000081
601 Ga0207426_1000408
602 Ga0209051_1000125
603 Ga0209051_1004790
604 Ga0209051_1031143
605 Ga0209051_1052492
606 Ga0209257_1003624
607 Ga0209257_1027402
608 Ga0207647_10151210
609 Ga0207695_10000044
610 Ga0207671_10000043
611 Ga0207694_10053250
612 Ga0207650_10000911
613 Ga0207711_10266675
614 Ga0207640_10204548
615 Ga0207658_10343890
616 Ga0209281_1000034
617 Ga0209371_1002516
618 Ga0268266_10029374
619 Ga0268266_10643208
620 Ga0307515_10010740
621 Ga0268256_1016462
622 Ga0307513_10036226
623 Ga0307405_10016982
624 Ga0307405_10195234
625 Ga0307406_10026280
626 Ga0307412_10039612
627 Ga0436365_0686133
628 Ga0439465_0010315
629 Ga0439465_0193945
630 Ga0451797_0254921
631 Ga0451798_0596649
632 Ga0451833_0190634
633 Ga0451837_0542867
634 Ga0451839_0259588
635 Ga0451839_0892333
636 Ga0451841_0098319
637 Ga0451841_0167886
638 Ga0451845_0002142
639 Ga0451845_0418311
640 Ga0451847_0106237
641 Ga0451847_0311569
642 Ga0451849_1037098
643 Ga0451851_0495644
644 Ga0451851_0598815
645 Ga0451843_0576612
646 Ga0451853_3429884
647 Ga0439462_0084994
648 Ga0450906_025589
649 Ga0466965_0097330
650 Ga0466966_0031156
651 Ga0466963_0035063
652 Ga0466970_0000095
653 Ga0466958_0006038
654 Ga0466967_0015530
655 Ga0495592_0205476
656 Ga0495629_0020115
657 Ga0495638_0001134
658 Ga0495638_0073604
659 Ga0495605_0039934
660 Ga0495605_0088914
661 Ga0495662_0035439
662 Ga0495664_0263859
663 Ga0495583_0032746
664 Ga0495583_0098862
665 Ga0495606_0004697
666 Ga0495606_0011961
667 Ga0495606_0253404
668 Ga0495606_0327092
669 Ga0495606_0347973
670 Ga0495610_0003664
671 Ga0495610_0060894
672 Ga0495610_0148904
673 Ga0495610_0164868
674 Ga0495620_0055183
675 Ga0495620_0112557
676 Ga0495628_0413944
677 Ga0495631_0001584
678 Ga0495632_0003362
679 Ga0495632_0031652
680 Ga0495632_0031708
681 Ga0495643_0004123
682 Ga0495643_0026735
683 Ga0495643_0054395
684 Ga0495648_0030039
685 Ga0495654_0001572
686 Ga0495654_0056018
687 Ga0495654_0070811
688 Ga0495640_0446461
689 Ga0495609_0035524
690 Ga0495597_0051667
691 Ga0495656_0043153
692 Ga0495668_0009467
693 Ga0495668_0084573
694 Ga0495625_0002255
695 Ga0495625_0018027
696 Ga0495661_0209498
697 Ga0495661_0266090
698 Ga0495658_0011233
699 Ga0495613_0319820
700 Ga0495624_0378285
701 Ga0495670_0059899
702 Ga0495671_0101947
703 Ga0495671_0136282
704 Ga0495649_0091785
705 Ga0495649_0130693
706 Ga0495600_0026997
707 Ga0495660_0047145
708 Ga0495660_0076627
709 Ga0495672_0005525
710 Ga0495683_0072067
711 Ga0495686_0001486
712 Ga0495686_0007917
713 Ga0495686_0010881
714 Ga0495686_0112203
715 Ga0495686_0128317
716 Ga0495686_0141523
717 Ga0495602_0597879
718 Ga0496100_0013013
719 Ga0496101_0061362
720 Ga0496102_0010779
721 Ga0496103_0005838
722 Ga0496105_0452896
723 Ga0496106_0006078
724 Ga0496110_0055542
725 Ga0496111_0061856
726 Ga0496113_0040164
727 Ga0496116_0004457
728 Ga0496116_0008842
729 Ga0496116_0015899
730 Ga0496116_0020164
731 Ga0496116_0023490
732 Ga0496116_0052473
733 Ga0496116_0052554
734 Ga0496116_0199364
735 Ga0496116_0254635
736 Ga0496117_0003614
737 Ga0496117_0010221
738 Ga0496117_0030997
739 Ga0496117_0033189
740 Ga0496118_0004165
741 Ga0496118_0031163
742 Ga0496118_0086457
743 Ga0496119_0012204
744 Ga0496119_0019452
745 Ga0496120_0007611
746 Ga0496120_0159058
747 Ga0496121_0003229
748 Ga0496121_0006258
749 Ga0496121_0019047
750 Ga0496121_0026147
751 Ga0496121_0028214
752 Ga0496121_0033896
753 Ga0496121_0150838
754 Ga0496121_0180278
755 Ga0496121_0197188
756 Ga0496121_0329968
757 Ga0496121_0389473
758 Ga0496122_0010069
759 Ga0496122_0014317
760 Ga0496122_0022687
761 Ga0496122_0047979
762 Ga0496122_0195074
763 Ga0496122_0284097
764 Ga0496123_0008910
765 Ga0496123_0014316
766 Ga0496123_0024054
767 Ga0496123_0048132
768 Ga0496123_0058181
769 Ga0496123_0059301
770 Ga0496123_0186543
771 Ga0496124_0002089
772 Ga0496124_0015523
773 Ga0496124_0018624
774 Ga0496124_0048384
775 Ga0496124_0091403
776 Ga0496125_0014106
777 Ga0496125_0015361
778 Ga0496125_0021913
779 Ga0496126_0062814
780 Ga0496126_0523397
781 Ga0495678_002029
782 Ga0495678_025749
783 Ga0501032_0122522
784 Ga0501036_0158754
785 Ga0501039_0070439
786 Ga0501043_0090628
787 Ga0501046_0421503
788 Ga0501047_0110528
789 Ga0501047_0279300
790 Ga0501067_0002286
791 Ga0501035_0134686
792 Ga0501044_0323965
793 nmdc:mga03683_18149_c3
794 nmdc:mga0k408_7049_c1
795 nmdc:mga06z11_498181_c1
796 nmdc:mga0sz30_11965_c2
797 Ga0500610_0183196
798 Ga0495619_0289471
799 Ga0500651_0054028
800 Ga0500651_0127637
801 Ga0500557_000501
802 Ga0500562_033737
803 Ga0500569_025601
804 Ga0500569_027736
805 Ga0500594_0003894
806 Ga0500618_000875
807 Ga0500618_033550
808 Ga0500658_0000638
809 Ga0500658_0154991
810 Ga0500568_0001714
811 Ga0500568_0003195
812 Ga0500568_0041065
813 Ga0500577_0219671
814 Ga0500590_005712
815 Ga0500616_0000576
816 Ga0500616_0005531
817 Ga0500616_0017972
818 Ga0500622_0003878
819 Ga0500622_0051610
820 Ga0500627_0050362
821 Ga0500636_0163711
822 Ga0500645_045941
823 Ga0501084_0052322
824 Ga0501082_0259561
825 2510133070
826 2510894434
827 2510899460
828 2511199243
829 2513569850
830 2513575117
831 2513635584
832 2513713472
833 2513925190
834 2514021875
835 2515112020
836 2515635506
837 2515645015
838 2515660160
839 2515738803
840 2517035757
841 2517076175
842 2517094920
843 2517406553
844 2524457726
845 2530645324
846 2585223073
847 2585258276
848 2585279744
849 2585326717
850 2585334931
851 2585528331
852 2585531853
853 2585540512
854 2585545656
855 2585551200
856 2585838728
857 2585843464
858 2599417097
859 2599718758
860 2616292670
861 2616306534
862 2616552844
863 2719180976
864 2719731725
865 2721147070
866 2721158598
867 2721163988
868 2722840158
869 2724044481
870 2725948717
871 2730164213
872 2730298230
873 2738800315
874 2739038008
875 2766062950
876 2793298236
877 2793324311
878 2793326476
879 2793337072
880 2793347507
881 2793352427
882 2793369640
883 2805927756
884 2805935664
885 2806045367
886 2806055440
887 2806061483
888 2806068057
889 2806072595
890 2819638631
891 2819685150
892 2821125725
893 2837680538
894 2838038696
895 2838661382
896 2838670203
897 2838689248
898 2838702574
899 2838730596
900 2838737824
901 2838743537
902 2841841807
903 2841854787
904 2842110725
905 2842141585
906 2842146881
907 2842157650
908 2842164848
909 2842180765
910 2842196864
911 2842206259
912 2842222949
913 2842231177
914 2842244716
915 2842251946
916 2842258529
917 2842273268
918 2842279716
919 2842287362
920 2842300659
921 2842310070
922 2842318130
923 2842358223
924 2842405108
925 2842411691
926 2842417859
927 2842485382
928 2842492905
929 2842496400
930 2842509413
931 2844459397
932 2857518488
933 2857532286
934 2919106241
935 2933018201
936 2933576569
937 2933586751
938 2935904506
939 2936372966
940 2936381118
941 3005414346
942 3005448666
943 639648305
944 8005294927
945 8005306908
946 8005314293
947 8005378954
948 8005388135
949 8005396908
950 8005462679
951 8005485928
952 8005557964
953 8005569137
954 8005575580
955 8005683727
956 8005694826
957 8018129696
958 8018168256
959 8023681113
960 8024485909
961 8024505367
962 8046769768
963 8056377215
964 8056388291
965 8057577385
966 8057875322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

112

199

0.92

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

82

199

0.86

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

83

190

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

108

192

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ec4-assembly2.cif.gz_B crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.9466 2 226
3ec4-assembly1.cif.gz_A crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.9445 2 226
3ec4-assembly2.cif.gz_B crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.9425 2 226
3ec4-assembly1.cif.gz_A crystal structure of putative acetyltransferase from the gnat family (yp_497011.1) from novosphingobium aromaticivorans dsm 12444 at 1.80 a resolution 0.9405 2 226
5i0c-assembly1.cif.gz_A crystal structure of predicted acyltransferase yjdj with acyl-coa n-acyltransferase domain from escherichia coli str. k-12 0.8981 133 193
ID Description Score Start End Superfamily
3ec4B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9354 2 226 3.40.630.30
3ec4B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9312 2 226 3.40.630.30
af_P76539_1_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8703 100 212 3.40.630.30
1y9kD01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8661 129 215 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8641 154 215 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4R9PBR3-F1-model_v4 GNAT family N-acetyltransferase 0.9976 95 189 GO:0016747
AF-A0A1E3GYP8-F1-model_v4 FR47-like protein 0.9942 1 225 GO:0003700
GO:0006950
GO:0016747
AF-A0A4R9PBR3-F1-model_v4 GNAT family N-acetyltransferase 0.9872 95 189 GO:0016747
AF-A0A6S6QRW0-F1-model_v4 GNAT family N-acetyltransferase 0.9843 1 225 GO:0016747
AF-A0A846MUL6-F1-model_v4 Putative GNAT family acetyltransferase 0.9838 2 225 GO:0016747

Map