F452858

General Info

Members Datasets Scaffolds Average Seq Length
483 309 464 229

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904690495|2904695481
Length 256
Sequence AAIAECPCALHLGASKAGLRHIDQASRMAATVTGISSMATRQILAELSRAFQNKTGHMVAIESVGGVDAAKRVRAGETFDIVVLADDVMTQLDADGFLRPGSRAGFAKSAMAVAVGAQANRPDLSNEASLQAAVLAARSIGYSTGPSGTHLLDLLRRWGIEQTVSDRLVKASPGVPVGTLVARGEAELGFQQLSEFLDVPGIAVAGPLPPEVQSTTLFACGVCATASNAAGAHDLIRHLTSAEADASKRRYGMEPA

Samples

Sample ID Description Type Environment
1 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
5 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
6 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
7 2738541337 Pelomonas sp. BT06 Isolate Unclassified
8 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
9 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
10 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
11 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
12 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
13 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
14 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
15 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
16 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
25 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
178 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
179 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
180 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
181 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
182 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
183 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
217 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
218 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
219 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
220 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
221 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
222 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
223 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
224 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
283 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
284 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
285 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
286 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
287 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
301 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
302 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
303 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
304 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
307 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
308 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
309 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 0.41
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.01
Nodule 0.83
Rhizoplane 2.69
Rhizosphere 75.36
Stem 0
Stem Tuber 0
Unclassified 9.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10004727 3300003203 Bacteria 6337
2 JGI25406J46586_10007846 3300003203 Bacteria 4856
3 JGI25153J46596_10000540 3300003215 Bacteria 23618
4 rootH1_10000900 3300003316 Bacteria 45745
5 rootH1_10056519 3300003316 Bacteria 1622
6 rootL2_10009014 3300003322 Bacteria 15136
7 rootL2_10196686 3300003322 Bacteria 1766
8 rootL2_10211567 3300003322 Bacteria 1392
9 rootH1_10034842 3300003316 Bacteria 2433
10 rootH1_10034842 3300003323 Bacteria 1690
11 Ga0006562J51391_1179351 3300003578 Bacteria 852
12 JGI25404J52841_10014926 3300003659 Bacteria 1686
13 JGI25404J52841_10015874 3300003659 Bacteria 1633
14 JGI25404J52841_10016611 3300003659 Bacteria 1596
15 Ga0055532_1000314 3300003758 Bacteria 29382
16 Ga0055527_1000055 3300003760 Bacteria 97952
17 Ga0055535_1000083 3300003761 Bacteria 104680
18 Ga0055542_1005996 3300003762 Bacteria 2656
19 Ga0055530_10002401 3300003791 Bacteria 12128
20 Ga0055540_1000016 3300003792 Bacteria 232942
21 Ga0055531_10005969 3300003794 Bacteria 6996
22 Ga0055531_10009059 3300003794 Bacteria 5139
23 Ga0065165_1000864 3300005262 Bacteria 39604
24 Ga0070676_10049235 3300005328 Bacteria 2466
25 Ga0070676_10121656 3300005328 Bacteria 1639
26 Ga0070676_10251329 3300005328 Bacteria 1180
27 Ga0070690_100116027 3300005330 Bacteria 1792
28 Ga0070670_100001673 3300005331 Bacteria 17995
29 Ga0070670_100018340 3300005331 Bacteria 6004
30 Ga0070670_100018930 3300005331 Bacteria 5906
31 Ga0070670_100068556 3300005331 Bacteria 3044
32 Ga0068869_100227104 3300005334 Bacteria 1482
33 Ga0070682_100012280 3300005337 Bacteria 4906
34 Ga0070682_100025861 3300005337 Bacteria 3507
35 Ga0068868_100216757 3300005338 Bacteria 1601
36 Ga0068868_100483259 3300005338 Bacteria 1082
37 Ga0070691_10239957 3300005341 Bacteria 968
38 Ga0070661_100055053 3300005344 Bacteria 2913
39 Ga0070668_100330829 3300005347 Bacteria 1285
40 Ga0070669_100064000 3300005353 Bacteria 2708
41 Ga0070669_100479688 3300005353 Bacteria 1029
42 Ga0070675_100011272 3300005354 Bacteria 6998
43 Ga0070675_100262099 3300005354 Bacteria 1515
44 Ga0070675_100723530 3300005354 Bacteria 907
45 Ga0070671_100432624 3300005355 Bacteria 1128
46 Ga0070674_100153436 3300005356 Bacteria 1740
47 Ga0070673_100190363 3300005364 Bacteria 1762
48 Ga0070673_100316151 3300005364 Bacteria 1378
49 Ga0070673_100321716 3300005364 Bacteria 1366
50 Ga0070673_100471611 3300005364 Bacteria 1132
51 Ga0070673_100625360 3300005364 Bacteria 984
52 Ga0070688_100190226 3300005365 Bacteria 1429
53 Ga0070688_100400703 3300005365 Bacteria 1015
54 Ga0070659_100236989 3300005366 Bacteria 1509
55 Ga0070659_100253896 3300005366 Bacteria 1458
56 Ga0070667_100017248 3300005367 Bacteria 5981
57 Ga0070709_10000424 3300005434 Bacteria 25604
58 Ga0070714_100026321 3300005435 Bacteria 4807
59 Ga0070713_100663153 3300005436 Bacteria 994
60 Ga0070710_10021505 3300005437 Bacteria 3363
61 Ga0070711_100010642 3300005439 Bacteria 5700
62 Ga0070663_100039925 3300005455 Bacteria 3283
63 Ga0070663_100308217 3300005455 Bacteria 1269
64 Ga0070678_100023906 3300005456 Bacteria 4081
65 Ga0070678_100448015 3300005456 Bacteria 1130
66 Ga0070678_100610197 3300005456 Bacteria 975
67 Ga0070662_100105308 3300005457 Bacteria 2141
68 Ga0068867_100001563 3300005459 Bacteria 15894
69 Ga0068867_100005891 3300005459 Bacteria 8697
70 Ga0068867_100031822 3300005459 Bacteria 3811
71 Ga0068867_100072681 3300005459 Bacteria 2575
72 Ga0070698_100538452 3300005471 Bacteria 1107
73 Ga0070684_100077838 3300005535 Bacteria 2929
74 Ga0068853_100034801 3300005539 Bacteria 4277
75 Ga0068853_100087815 3300005539 Bacteria 2729
76 Ga0068853_100215152 3300005539 Bacteria 1753
77 Ga0068853_100312300 3300005539 Bacteria 1455
78 Ga0068853_100581387 3300005539 Bacteria 1063
79 Ga0070672_100014528 3300005543 Bacteria 5582
80 Ga0070672_100157825 3300005543 Bacteria 1880
81 Ga0070672_100401761 3300005543 Bacteria 1175
82 Ga0070695_100072008 3300005545 Bacteria 2265
83 Ga0068855_101227133 3300005563 Unclassified 779
84 Ga0070664_100020607 3300005564 Bacteria 5430
85 Ga0070664_100164205 3300005564 Bacteria 1967
86 Ga0070664_100349169 3300005564 Bacteria 1345
87 Ga0068857_100012412 3300005577 Bacteria 7417
88 Ga0068854_100037840 3300005578 Bacteria 3388
89 Ga0068854_100252707 3300005578 Bacteria 1408
90 Ga0068852_100069880 3300005616 Bacteria 3079
91 Ga0068852_100210124 3300005616 Bacteria 1846
92 Ga0068859_100033265 3300005617 Bacteria 5178
93 Ga0068864_100005574 3300005618 Bacteria 10321
94 Ga0068864_100037177 3300005618 Bacteria 4154
95 Ga0068866_10149016 3300005718 Bacteria 1352
96 Ga0068861_100000654 3300005719 Bacteria 20566
97 Ga0068851_10028764 3300005834 Bacteria 2746
98 Ga0068863_100014739 3300005841 Bacteria 7521
99 Ga0068863_100026587 3300005841 Bacteria 5518
100 Ga0068863_100037388 3300005841 Bacteria 4622
101 Ga0068858_100042577 3300005842 Bacteria 4210
102 Ga0068858_100505390 3300005842 Bacteria 1168
103 Ga0068860_100000602 3300005843 Bacteria 42928
104 Ga0068860_100579052 3300005843 Bacteria 1126
105 Ga0068862_100004504 3300005844 Bacteria 11751
106 Ga0068862_100032137 3300005844 Bacteria 4434
107 Ga0068862_100054203 3300005844 Bacteria 3434
108 Ga0068862_100720178 3300005844 Bacteria 968
109 Ga0081455_10008730 3300005937 Bacteria 10495
110 Ga0081455_10012116 3300005937 Bacteria 8619
111 Ga0081455_10027965 3300005937 Bacteria 5158
112 Ga0081455_10327256 3300005937 Bacteria 1089
113 Ga0081455_10378492 3300005937 Bacteria 990
114 Ga0081540_1003649 3300005983 Bacteria 12076
115 Ga0081540_1008233 3300005983 Bacteria 7307
116 Ga0081540_1050753 3300005983 Bacteria 2057
117 Ga0081539_10000220 3300005985 Bacteria 133834
118 Ga0081539_10002585 3300005985 Bacteria 24951
119 Ga0081539_10082396 3300005985 Bacteria 1686
120 Ga0075365_10381602 3300006038 Bacteria 994
121 Ga0075368_10081859 3300006042 Bacteria 1314
122 Ga0075368_10197263 3300006042 Bacteria 851
123 Ga0075363_100053017 3300006048 Bacteria 2166
124 Ga0070715_10312589 3300006163 Bacteria 845
125 Ga0070712_100046031 3300006175 Bacteria 3015
126 Ga0075362_10159496 3300006177 Bacteria 1085
127 Ga0075367_10202123 3300006178 Bacteria 1241
128 Ga0075369_10013170 3300006186 Bacteria 3276
129 Ga0075366_10018496 3300006195 Bacteria 4024
130 Ga0075366_10117035 3300006195 Bacteria 1605
131 Ga0075366_10264931 3300006195 Bacteria 1049
132 Ga0075370_10003026 3300006353 Bacteria 7925
133 Ga0075370_10272745 3300006353 Bacteria 1004
134 Ga0068871_100009508 3300006358 Bacteria 7050
135 Ga0068871_100188197 3300006358 Bacteria 1777
136 Ga0068871_101069273 3300006358 Unclassified 754
137 Ga0075430_100017933 3300006846 Bacteria 6024
138 Ga0068865_100002296 3300006881 Bacteria 11265
139 Ga0068865_100244363 3300006881 Bacteria 1414
140 Ga0097620_100033265 3300006931 Bacteria 5178
141 Ga0099823_1057802 3300006944 Bacteria 2117
142 Ga0111539_10167839 3300009094 Bacteria 2565
143 Ga0111539_10172582 3300009094 Bacteria 2526
144 Ga0105243_10015365 3300009148 Bacteria 5791
145 Ga0105243_10060162 3300009148 Bacteria 3034
146 Ga0105243_10219105 3300009148 Bacteria 1681
147 Ga0105242_10053903 3300009176 Bacteria 3285
148 Ga0105242_10070771 3300009176 Bacteria 2893
149 Ga0105242_10432828 3300009176 Bacteria 1236
150 Ga0105248_10011339 3300009177 Bacteria 9823
151 Ga0105248_10234568 3300009177 Bacteria 2065
152 Ga0105248_10610311 3300009177 Bacteria 1231
153 Ga0105237_10006549 3300009545 Bacteria 12884
154 Ga0105238_10090876 3300009551 Bacteria 3041
155 Ga0105238_10338268 3300009551 Unclassified 1493
156 Ga0105238_10512882 3300009551 Bacteria 1201
157 Ga0105249_10034747 3300009553 Bacteria 4568
158 Ga0105239_10598597 3300010375 Bacteria 1257
159 Ga0157370_10003812 3300013104 Bacteria 17590
160 Ga0157370_10159625 3300013104 Bacteria 2098
161 Ga0157369_10044991 3300013105 Bacteria 4803
162 Ga0157374_10031793 3300013296 Bacteria 4801
163 Ga0157378_10001074 3300013297 Bacteria 24973
164 Ga0163162_10025716 3300013306 Bacteria 5820
165 Ga0163162_10028459 3300013306 Bacteria 5530
166 Ga0163162_10869768 3300013306 Bacteria 1016
167 Ga0157372_10052274 3300013307 Bacteria 4549
168 Ga0157372_10055986 3300013307 Bacteria 4406
169 Ga0157372_10259302 3300013307 Bacteria 2019
170 Ga0157375_10034633 3300013308 Bacteria 4812
171 Ga0157375_10194797 3300013308 Bacteria 2182
172 Ga0163163_10053517 3300014325 Bacteria 3985
173 Ga0163163_10127406 3300014325 Bacteria 2584
174 Ga0157380_10057669 3300014326 Bacteria 3094
175 Ga0157380_10555122 3300014326 Bacteria 1127
176 Ga0157377_10316592 3300014745 Bacteria 1035
177 Ga0157379_10001219 3300014968 Bacteria 20902
178 Ga0157379_10029133 3300014968 Bacteria 4911
179 Ga0157379_10158232 3300014968 Bacteria 2044
180 Ga0157379_10425495 3300014968 Bacteria 1223
181 Ga0157376_10016372 3300014969 Bacteria 5628
182 Ga0157376_10033493 3300014969 Bacteria 4137
183 Ga0157376_10483081 3300014969 Bacteria 1214
184 Ga0182005_1046803 3300015265 Bacteria 1175
185 Ga0163161_10081492 3300017792 Bacteria 2383
186 Ga0163161_10107821 3300017792 Bacteria 2079
187 Ga0163161_10359700 3300017792 Bacteria 1159
188 Ga0213876_10003562 3300021384 Bacteria 8865
189 Ga0209672_100040 3300025228 Bacteria 278858
190 Ga0209147_100048 3300025229 Bacteria 278858
191 Ga0209258_100070 3300025242 Bacteria 278858
192 Ga0209677_100303 3300025253 Bacteria 32409
193 Ga0209148_1000284 3300025254 Bacteria 77768
194 Ga0209759_1001239 3300025256 Bacteria 15516
195 Ga0209233_1009018 3300025261 Bacteria 3053
196 Ga0209455_1000178 3300025272 Bacteria 104960
197 Ga0209455_1007607 3300025272 Bacteria 3036
198 Ga0209455_1008518 3300025272 Bacteria 2781
199 Ga0209673_1009213 3300025273 Bacteria 4304
200 Ga0209675_1002042 3300025291 Bacteria 10779
201 Ga0209758_1000122 3300025297 Bacteria 190970
202 Ga0209758_1032466 3300025297 Bacteria 2118
203 Ga0209050_1000082 3300025298 Bacteria 266864
204 Ga0209050_1002975 3300025298 Bacteria 13196
205 Ga0209256_1000840 3300025299 Bacteria 38531
206 Ga0209051_1000029 3300025303 Bacteria 403675
207 Ga0209257_1000030 3300025304 Bacteria 689812
208 Ga0209257_1004031 3300025304 Bacteria 11813
209 Ga0207656_10032412 3300025321 Bacteria 2170
210 Ga0207656_10066814 3300025321 Unclassified 1590
211 Ga0207682_10134656 3300025893 Bacteria 1105
212 Ga0207692_10000738 3300025898 Bacteria 11534
213 Ga0207642_10112458 3300025899 Bacteria 1389
214 Ga0207699_10114423 3300025906 Bacteria 1735
215 Ga0207645_10240121 3300025907 Bacteria 1197
216 Ga0207671_10087956 3300025914 Bacteria 2337
217 Ga0207693_10003980 3300025915 Bacteria 12554
218 Ga0207663_10097635 3300025916 Bacteria 1965
219 Ga0207660_10592415 3300025917 Bacteria 903
220 Ga0207657_10014696 3300025919 Bacteria 7624
221 Ga0207649_10128122 3300025920 Bacteria 1720
222 Ga0207681_10004876 3300025923 Bacteria 8247
223 Ga0207681_10039259 3300025923 Bacteria 3142
224 Ga0207681_10405680 3300025923 Bacteria 1102
225 Ga0207694_10133747 3300025924 Bacteria 1989
226 Ga0207650_10024020 3300025925 Bacteria 4328
227 Ga0207650_10200233 3300025925 Bacteria 1599
228 Ga0207659_10077370 3300025926 Bacteria 2449
229 Ga0207659_10198738 3300025926 Bacteria 1600
230 Ga0207700_10157012 3300025928 Bacteria 1886
231 Ga0207700_10347346 3300025928 Bacteria 1291
232 Ga0207700_10487405 3300025928 Bacteria 1090
233 Ga0207664_10010239 3300025929 Bacteria 6622
234 Ga0207690_10130814 3300025932 Bacteria 1837
235 Ga0207690_10205160 3300025932 Bacteria 1500
236 Ga0207686_10028467 3300025934 Bacteria 3285
237 Ga0207686_10114357 3300025934 Bacteria 1826
238 Ga0207709_10017417 3300025935 Bacteria 4010
239 Ga0207709_10458587 3300025935 Bacteria 987
240 Ga0207669_10129704 3300025937 Bacteria 1730
241 Ga0207669_10228711 3300025937 Bacteria 1371
242 Ga0207704_10020997 3300025938 Bacteria 3468
243 Ga0207691_10012884 3300025940 Bacteria 8006
244 Ga0207691_10020338 3300025940 Bacteria 6275
245 Ga0207691_10117224 3300025940 Bacteria 2363
246 Ga0207691_10172506 3300025940 Bacteria 1893
247 Ga0207711_10009278 3300025941 Bacteria 8214
248 Ga0207711_10156229 3300025941 Bacteria 2062
249 Ga0207679_10377360 3300025945 Bacteria 1242
250 Ga0207679_10695467 3300025945 Unclassified 922
251 Ga0207679_10704189 3300025945 Bacteria 917
252 Ga0207651_10155013 3300025960 Bacteria 1788
253 Ga0207651_10263637 3300025960 Bacteria 1416
254 Ga0207668_10288243 3300025972 Bacteria 1350
255 Ga0207668_10294255 3300025972 Bacteria 1337
256 Ga0207640_10017542 3300025981 Bacteria 4191
257 Ga0207640_10242517 3300025981 Bacteria 1393
258 Ga0207658_10006530 3300025986 Bacteria 7958
259 Ga0207677_10040842 3300026023 Bacteria 3062
260 Ga0207677_10434918 3300026023 Bacteria 1121
261 Ga0207677_10450743 3300026023 Bacteria 1102
262 Ga0207639_10231840 3300026041 Bacteria 1601
263 Ga0207639_10495116 3300026041 Bacteria 1116
264 Ga0207678_10009973 3300026067 Bacteria 8335
265 Ga0207678_10045241 3300026067 Bacteria 3807
266 Ga0207641_10307327 3300026088 Bacteria 1500
267 Ga0207641_10373441 3300026088 Bacteria 1364
268 Ga0207641_10718667 3300026088 Bacteria 985
269 Ga0207648_10000582 3300026089 Bacteria 40973
270 Ga0207648_10018204 3300026089 Bacteria 6363
271 Ga0207648_10022764 3300026089 Bacteria 5623
272 Ga0207648_10371344 3300026089 Bacteria 1292
273 Ga0207676_10187634 3300026095 Bacteria 1816
274 Ga0207674_10010615 3300026116 Bacteria 10420
275 Ga0207675_100000601 3300026118 Bacteria 35110
276 Ga0207683_10043661 3300026121 Bacteria 3918
277 Ga0207683_10044697 3300026121 Bacteria 3872
278 Ga0207683_10349693 3300026121 Bacteria 1356
279 Ga0207683_10566176 3300026121 Bacteria 1051
280 Ga0209998_10046414 3300027717 Bacteria 997
281 Ga0209813_10109827 3300027866 Bacteria 949
282 Ga0207428_10033976 3300027907 Bacteria 4182
283 Ga0268265_10003246 3300028380 Bacteria 11804
284 Ga0268265_10227031 3300028380 Bacteria 1638
285 Ga0268265_10376191 3300028380 Bacteria 1305
286 Ga0268264_10001438 3300028381 Bacteria 22260
287 Ga0268264_10101872 3300028381 Bacteria 2497
288 Ga0265337_1048304 3300028556 Bacteria 1204
289 Ga0265319_1007532 3300028563 Bacteria 4881
290 Ga0265334_10015225 3300028573 Bacteria 3198
291 Ga0265318_10007739 3300028577 Bacteria 4831
292 Ga0265323_10001387 3300028653 Bacteria 11970
293 Ga0265322_10059546 3300028654 Bacteria 1083
294 Ga0265336_10000269 3300028666 Bacteria 36400
295 Ga0307517_10001421 3300028786 Bacteria 40285
296 Ga0307515_10355713 3300028794 Bacteria 1108
297 Ga0265338_10000076 3300028800 Bacteria 180204
298 Ga0265324_10003018 3300029957 Bacteria 8226
299 Ga0265327_10005550 3300031251 Bacteria 10474
300 Ga0265327_10082161 3300031251 Bacteria 1589
301 Ga0307509_10000135 3300031507 Bacteria 109066
302 Ga0307509_10062217 3300031507 Bacteria 3936
303 Ga0307408_100109503 3300031548 Bacteria 2119
304 Ga0307408_100257721 3300031548 Bacteria 1442
305 Ga0307508_10000282 3300031616 Bacteria 62510
306 Ga0307508_10014131 3300031616 Bacteria 7284
307 Ga0307514_10017292 3300031649 Bacteria 5937
308 Ga0307405_10134131 3300031731 Bacteria 1716
309 Ga0307406_10230388 3300031901 Bacteria 1383
310 Ga0307412_10035132 3300031911 Bacteria 3200
311 Ga0307416_100451871 3300032002 Bacteria 1338
312 Ga0307416_100560629 3300032002 Bacteria 1217
313 Ga0307414_10028351 3300032004 Bacteria 3631
314 Ga0307411_10021264 3300032005 Bacteria 3792
315 Ga0307510_10008203 3300033180 Bacteria 12440
316 Ga0307510_10066040 3300033180 Bacteria 3656
317 Ga0373944_0052020 3300035089 Bacteria 1293
318 Ga0373953_0014913 3300035117 Bacteria 2805
319 Ga0373954_0040291 3300035118 Bacteria 2176
320 Ga0373956_0003655 3300035119 Bacteria 6213
321 Ga0373956_0215931 3300035119 Bacteria 910
322 Ga0373957_0035285 3300035120 Bacteria 1857
323 Ga0373957_0226723 3300035120 Bacteria 783
324 Ga0373946_0064130 3300035171 Bacteria 1571
325 Ga0373955_0008222 3300035172 Bacteria 4836
326 Ga0373933_0133536 3300035724 Bacteria 1562
327 Ga0373933_0283502 3300035724 Bacteria 1070
328 Ga0373937_0004472 3300036401 Bacteria 11874
329 Ga0373937_0143870 3300036401 Bacteria 2231
330 Ga0373937_0264229 3300036401 Bacteria 1623
331 Ga0373937_0284815 3300036401 Bacteria 1561
332 Ga0373937_0509427 3300036401 Bacteria 1143
333 Ga0373937_0773704 3300036401 Bacteria 908
334 Ga0373925_0004343 3300037068 Bacteria 10729
335 Ga0373925_0017278 3300037068 Bacteria 5226
336 Ga0373925_0028261 3300037068 Bacteria 4108
337 Ga0395899_0149132 3300037312 Bacteria 1658
338 Ga0395905_0002341 3300037471 Bacteria 21134
339 Ga0395905_0006240 3300037471 Bacteria 12037
340 Ga0395905_0009530 3300037471 Bacteria 9485
341 Ga0395905_0118549 3300037471 Bacteria 2488
342 Ga0395901_0205568 3300038443 Bacteria 2063
343 Ga0395901_0754935 3300038443 Bacteria 965
344 Ga0395901_0982686 3300038443 Bacteria 821
345 Ga0436365_0523972 3300039437 Bacteria 7205
346 Ga0436365_1723898 3300039437 Bacteria 3325
347 Ga0436360_0204324 3300039438 Bacteria 1284
348 Ga0436360_1280861 3300039438 Unclassified 1044
349 Ga0436363_1222566 3300039450 Bacteria 2446
350 Ga0436362_0198186 3300039453 Bacteria 3385
351 Ga0439461_0008936 3300041410 Bacteria 1808
352 Ga0439445_0038063 3300042004 Bacteria 1271
353 Ga0450919_001148 3300042121 Bacteria 3442
354 Ga0450888_000540 3300042126 Bacteria 3567
355 Ga0450891_000178 3300042129 Bacteria 6142
356 Ga0450903_004712 3300042138 Bacteria 2310
357 Ga0450905_032236 3300042142 Bacteria 811
358 Ga0450918_011527 3300042531 Bacteria 1540
359 Ga0451577_0012576 3300042876 Bacteria 7946
360 Ga0451577_0135131 3300042876 Bacteria 2214
361 Ga0466972_0000079 3300044658 Bacteria 90348
362 Ga0466972_0017197 3300044658 Bacteria 3618
363 Ga0466965_0061319 3300044683 Bacteria 1880
364 Ga0466966_0013652 3300044684 Bacteria 5374
365 Ga0466963_0185797 3300044694 Bacteria 1452
366 Ga0466963_0369143 3300044694 Bacteria 1011
367 Ga0453684_0112153 3300044712 Bacteria 3311
368 Ga0466968_0125307 3300044735 Bacteria 1165
369 Ga0466970_0045405 3300044765 Bacteria 2339
370 Ga0466957_0046198 3300044842 Bacteria 2643
371 Ga0466957_0083523 3300044842 Bacteria 1992
372 Ga0466959_0057803 3300045049 Bacteria 2827
373 Ga0466959_0092203 3300045049 Bacteria 2175
374 Ga0466959_0146617 3300045049 Bacteria 1665
375 Ga0466959_0429188 3300045049 Bacteria 897
376 Ga0466959_0663567 3300045049 Bacteria 700
377 Ga0495592_0008157 3300046454 Bacteria 7867
378 Ga0495629_0035780 3300046459 Bacteria 3507
379 Ga0495629_0255590 3300046459 Bacteria 1205
380 Ga0495629_0314544 3300046459 Bacteria 1071
381 Ga0495580_0149956 3300046472 Bacteria 1615
382 Ga0495582_0054871 3300046473 Bacteria 2196
383 Ga0495594_0259380 3300046499 Bacteria 990
384 Ga0495618_0161591 3300046514 Bacteria 1428
385 Ga0495632_0121200 3300046519 Bacteria 1222
386 Ga0495654_0000586 3300046530 Bacteria 29145
387 Ga0495586_0080516 3300046535 Bacteria 1789
388 Ga0495656_0172040 3300046615 Bacteria 1060
389 Ga0495668_0075965 3300046616 Bacteria 1845
390 Ga0495635_0135825 3300046663 Bacteria 1676
391 Ga0495635_0299819 3300046663 Bacteria 1078
392 Ga0495588_0041557 3300046674 Bacteria 2348
393 Ga0495657_0403603 3300046675 Bacteria 804
394 Ga0495658_0050482 3300046683 Bacteria 2353
395 Ga0495658_0162096 3300046683 Bacteria 1380
396 Ga0495658_0172500 3300046683 Bacteria 1339
397 Ga0495613_0376946 3300046689 Bacteria 971
398 Ga0495624_0470511 3300046690 Unclassified 753
399 Ga0495600_0131939 3300046809 Bacteria 1624
400 Ga0495604_0368877 3300047317 Bacteria 951
401 Ga0495674_0225259 3300047319 Bacteria 1549
402 Ga0495680_0075847 3300047322 Bacteria 2551
403 Ga0495680_0265549 3300047322 Bacteria 1213
404 Ga0495684_0004197 3300047471 Bacteria 11254
405 Ga0496100_0092040 3300048903 Bacteria 2071
406 Ga0496101_0114617 3300048904 Bacteria 2032
407 Ga0496101_0400210 3300048904 Bacteria 1081
408 Ga0496102_0011155 3300048905 Bacteria 7739
409 Ga0496103_0070477 3300048906 Bacteria 2187
410 Ga0496104_0092955 3300048907 Bacteria 2884
411 Ga0496105_0105424 3300048908 Bacteria 2327
412 Ga0496107_0370965 3300048910 Bacteria 1064
413 Ga0496109_0827142 3300048912 Unclassified 864
414 Ga0496110_0094647 3300048913 Bacteria 2675
415 Ga0496110_0230245 3300048913 Bacteria 1685
416 Ga0496113_0492575 3300048916 Bacteria 984
417 Ga0496114_0140453 3300048917 Bacteria 2091
418 Ga0496116_0041207 3300048919 Bacteria 3171
419 Ga0496117_0141382 3300048920 Bacteria 1441
420 Ga0496118_0025908 3300048921 Bacteria 5013
421 Ga0496118_0059587 3300048921 Bacteria 2841
422 Ga0496121_0004163 3300048924 Bacteria 19776
423 Ga0496121_0007979 3300048924 Bacteria 12640
424 Ga0496121_0205578 3300048924 Bacteria 1399
425 Ga0496122_0001063 3300048925 Bacteria 47771
426 Ga0496123_0000246 3300048926 Bacteria 109397
427 Ga0496124_0005008 3300048927 Bacteria 15151
428 Ga0496124_0121720 3300048927 Bacteria 2084
429 Ga0496125_0006367 3300048928 Bacteria 12800
430 Ga0501310_016830 3300049130 Bacteria 880
431 Ga0501034_0292029 3300049571 Bacteria 1568
432 Ga0501047_0068370 3300049581 Bacteria 3421
433 Ga0501067_0023296 3300049583 Bacteria 3431
434 Ga0501070_0006327 3300049586 Bacteria 10076
435 Ga0501072_0031356 3300049588 Bacteria 4160
436 Ga0501198_000048 3300049649 Bacteria 39888
437 Ga0501222_000032 3300049662 Bacteria 55723
438 Ga0501249_015933 3300049679 Bacteria 1611
439 Ga0501253_019534 3300049683 Bacteria 1171
440 Ga0501221_010419 3300049704 Bacteria 1651
441 Ga0501229_000131 3300049706 Bacteria 7802
442 Ga0501035_0316260 3300049822 Bacteria 1313
443 nmdc:mga03683_97077_c1 3300050489 Bacteria 1291
444 nmdc:mga0yw44_202106_c1 3300050492 Bacteria 1312
445 nmdc:mga0yw44_47163_c1 3300050492 Bacteria 2592
446 nmdc:mga0k408_15217_c1 3300050493 Bacteria 4251
447 nmdc:mga0k408_153380_c1 3300050493 Bacteria 1372
448 nmdc:mga0k408_50428_c1 3300050493 Bacteria 2410
449 nmdc:mga0k408_6999_c1 3300050493 Bacteria 6018
450 nmdc:mga06z11_51599_c1 3300050494 Bacteria 2107
451 nmdc:mga04h51_7830_c1 3300050495 Bacteria 2838
452 nmdc:mga07m45_19775_c1 3300050496 Bacteria 3651
453 nmdc:mga07m45_212911_c1 3300050496 Bacteria 1124
454 nmdc:mga0qj67_18883_c1 3300050509 Bacteria 5260
455 nmdc:mga08y16_16301_c1 3300050511 Bacteria 7813
456 nmdc:mga0n895_525766_c1 3300050512 Bacteria 1190
457 nmdc:mga0a205_37871_c1 3300050515 Bacteria 4637
458 Ga0495619_0072795 3300053085 Bacteria 2302
459 Ga0500572_003464 3300053111 Bacteria 3607
460 Ga0500658_0002588 3300053134 Bacteria 6994
461 Ga0500559_0000843 3300053136 Bacteria 19834
462 Ga0500639_138480 3300053163 Bacteria 1141
463 Ga0500596_004635 3300053735 Bacteria 2505
464 Ga0501084_0071889 3300054114 Bacteria 2897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0827142 Ga0496109_0827142_251_817 185
2 3300031251 Ga0265327_10082161 Ga0265327_100821612 190
3 3300046514 Ga0495618_0161591 Ga0495618_0161591_352_1131 190
4 3300047317 Ga0495604_0368877 Ga0495604_0368877_151_930 190
5 3300047322 Ga0495680_0265549 Ga0495680_0265549_424_1203 190
6 3300005364 Ga0070673_100190363 Ga0070673_1001903632 192
7 3300009551 Ga0105238_10512882 Ga0105238_105128822 192
8 3300015265 Ga0182005_1046803 Ga0182005_10468032 192
9 3300017792 Ga0163161_10107821 Ga0163161_101078212 193
10 3300046615 Ga0495656_0172040 Ga0495656_0172040_270_968 193
11 3300046663 Ga0495635_0299819 Ga0495635_0299819_329_1021 193
12 3300046689 Ga0495613_0376946 Ga0495613_0376946_47_826 193
13 3300005367 Ga0070667_100017248 Ga0070667_1000172482 194
14 3300005456 Ga0070678_100610197 Ga0070678_1006101971 194
15 3300013306 Ga0163162_10028459 Ga0163162_100284593 194
16 3300026023 Ga0207677_10450743 Ga0207677_104507431 194
17 3300026121 Ga0207683_10566176 Ga0207683_105661761 194
18 3300048903 Ga0496100_0092040 Ga0496100_0092040_545_1333 194
19 3300048904 Ga0496101_0114617 Ga0496101_0114617_92_880 194
20 3300048905 Ga0496102_0011155 Ga0496102_0011155_6602_7390 194
21 3300048906 Ga0496103_0070477 Ga0496103_0070477_381_1169 194
22 3300048907 Ga0496104_0092955 Ga0496104_0092955_1159_1947 194
23 3300048908 Ga0496105_0105424 Ga0496105_0105424_358_1146 194
24 3300048910 Ga0496107_0370965 Ga0496107_0370965_221_1009 194
25 3300048913 Ga0496110_0230245 Ga0496110_0230245_683_1471 194
26 3300048916 Ga0496113_0492575 Ga0496113_0492575_225_926 194
27 3300048917 Ga0496114_0140453 Ga0496114_0140453_545_1333 194
28 3300005331 Ga0070670_100068556 Ga0070670_1000685563 198
29 3300009094 Ga0111539_10172582 Ga0111539_101725823 200
30 3300025926 Ga0207659_10198738 Ga0207659_101987382 200
31 3300027907 Ga0207428_10033976 Ga0207428_100339763 200
32 3300050511 nmdc:mga08y16_16301_c1 nmdc:mga08y16_16301_c1_6492_7187 200
33 3300050492 nmdc:mga0yw44_202106_c1 nmdc:mga0yw44_202106_c1_544_1242 202
34 3300025291 Ga0209675_1002042 Ga0209675_10020423 203
35 3300025297 Ga0209758_1032466 Ga0209758_10324662 203
36 3300005334 Ga0068869_100227104 Ga0068869_1002271042 205
37 3300005545 Ga0070695_100072008 Ga0070695_1000720083 205
38 3300044842 Ga0466957_0046198 Ga0466957_0046198_1407_2108 205
39 3300006846 Ga0075430_100017933 Ga0075430_1000179334 206
40 3300014745 Ga0157377_10316592 Ga0157377_103165922 206
41 3300032002 Ga0307416_100451871 Ga0307416_1004518712 206
42 3300048928 Ga0496125_0006367 Ga0496125_0006367_319_1008 206
43 3300044712 Ga0453684_0112153 Ga0453684_0112153_1615_2367 207
44 3300049679 Ga0501249_015933 Ga0501249_015933_451_1110 209
45 3300005262 Ga0065165_1000864 Ga0065165_100086422 210
46 3300049649 Ga0501198_000048 Ga0501198_000048_793_1485 211
47 3300049662 Ga0501222_000032 Ga0501222_000032_15624_16316 211
48 3300003578 Ga0006562J51391_1179351 Ga0006562J51391_11793511 213
49 3300005341 Ga0070691_10239957 Ga0070691_102399571 214
50 3300005564 Ga0070664_100020607 Ga0070664_1000206073 214
51 3300046459 Ga0495629_0314544 Ga0495629_0314544_109_807 214
52 3300046674 Ga0495588_0041557 Ga0495588_0041557_441_1139 214
53 3300005344 Ga0070661_100055053 Ga0070661_1000550532 215
54 3300005563 Ga0068855_101227133 Ga0068855_1012271331 215
55 3300005937 Ga0081455_10327256 Ga0081455_103272562 215
56 3300044658 Ga0466972_0017197 Ga0466972_0017197_505_1212 215
57 3300044684 Ga0466966_0013652 Ga0466966_0013652_2652_3359 215
58 3300044765 Ga0466970_0045405 Ga0466970_0045405_1150_1857 215
59 3300045049 Ga0466959_0663567 Ga0466959_0663567_26_682 215
60 3300003791 Ga0055530_10002401 Ga0055530_100024012 216
61 3300003792 Ga0055540_1000016 Ga0055540_100001682 216
62 3300003794 Ga0055531_10009059 Ga0055531_100090592 216
63 3300005364 Ga0070673_100471611 Ga0070673_1004716112 216
64 3300005366 Ga0070659_100236989 Ga0070659_1002369892 216
65 3300005436 Ga0070713_100663153 Ga0070713_1006631531 216
66 3300005455 Ga0070663_100039925 Ga0070663_1000399253 216
67 3300005456 Ga0070678_100023906 Ga0070678_1000239065 216
68 3300005459 Ga0068867_100031822 Ga0068867_1000318223 216
69 3300005539 Ga0068853_100034801 Ga0068853_1000348016 216
70 3300005564 Ga0070664_100349169 Ga0070664_1003491692 216
71 3300005841 Ga0068863_100026587 Ga0068863_1000265873 216
72 3300005842 Ga0068858_100505390 Ga0068858_1005053902 216
73 3300005843 Ga0068860_100579052 Ga0068860_1005790522 216
74 3300006042 Ga0075368_10197263 Ga0075368_101972632 216
75 3300006163 Ga0070715_10312589 Ga0070715_103125891 216
76 3300006175 Ga0070712_100046031 Ga0070712_1000460312 216
77 3300006353 Ga0075370_10003026 Ga0075370_100030266 216
78 3300006358 Ga0068871_100188197 Ga0068871_1001881972 216
79 3300006881 Ga0068865_100244363 Ga0068865_1002443632 216
80 3300025298 Ga0209050_1000082 Ga0209050_1000082123 216
81 3300025303 Ga0209051_1000029 Ga0209051_1000029123 216
82 3300025304 Ga0209257_1000030 Ga0209257_1000030116 216
83 3300025914 Ga0207671_10087956 Ga0207671_100879562 216
84 3300025915 Ga0207693_10003980 Ga0207693_100039809 216
85 3300025928 Ga0207700_10157012 Ga0207700_101570122 216
86 3300025929 Ga0207664_10010239 Ga0207664_100102395 216
87 3300025932 Ga0207690_10205160 Ga0207690_102051602 216
88 3300025934 Ga0207686_10114357 Ga0207686_101143571 216
89 3300025935 Ga0207709_10017417 Ga0207709_100174175 216
90 3300025937 Ga0207669_10129704 Ga0207669_101297042 216
91 3300025938 Ga0207704_10020997 Ga0207704_100209975 216
92 3300025940 Ga0207691_10117224 Ga0207691_101172242 216
93 3300025960 Ga0207651_10263637 Ga0207651_102636372 216
94 3300025972 Ga0207668_10288243 Ga0207668_102882432 216
95 3300026041 Ga0207639_10495116 Ga0207639_104951161 216
96 3300026067 Ga0207678_10045241 Ga0207678_100452412 216
97 3300026088 Ga0207641_10307327 Ga0207641_103073272 216
98 3300026088 Ga0207641_10718667 Ga0207641_107186671 216
99 3300026089 Ga0207648_10018204 Ga0207648_100182044 216
100 3300026121 Ga0207683_10043661 Ga0207683_100436615 216
101 3300028381 Ga0268264_10101872 Ga0268264_101018723 216
102 3300031731 Ga0307405_10134131 Ga0307405_101341311 216
103 3300031901 Ga0307406_10230388 Ga0307406_102303882 216
104 3300031911 Ga0307412_10035132 Ga0307412_100351322 216
105 3300037068 Ga0373925_0017278 Ga0373925_0017278_3706_4365 216
106 3300037471 Ga0395905_0002341 Ga0395905_0002341_4500_5159 216
107 3300037471 Ga0395905_0006240 Ga0395905_0006240_10949_11608 216
108 3300038443 Ga0395901_0982686 Ga0395901_0982686_68_727 216
109 3300045049 Ga0466959_0429188 Ga0466959_0429188_31_738 216
110 3300046683 Ga0495658_0172500 Ga0495658_0172500_25_684 216
111 3300048924 Ga0496121_0205578 Ga0496121_0205578_538_1197 216
112 3300049571 Ga0501034_0292029 Ga0501034_0292029_338_1060 216
113 3300049581 Ga0501047_0068370 Ga0501047_0068370_260_982 216
114 3300049586 Ga0501070_0006327 Ga0501070_0006327_4292_5014 216
115 3300049588 Ga0501072_0031356 Ga0501072_0031356_1236_1958 216
116 3300049822 Ga0501035_0316260 Ga0501035_0316260_352_1074 216
117 3300050509 nmdc:mga0qj67_18883_c1 nmdc:mga0qj67_18883_c1_2657_3349 216
118 3300009094 Ga0111539_10167839 Ga0111539_101678393 217
119 3300039438 Ga0436360_0204324 Ga0436360_0204324_318_983 217
120 3300050515 nmdc:mga0a205_37871_c1 nmdc:mga0a205_37871_c1_3420_4088 217
121 3300026121 Ga0207683_10349693 Ga0207683_103496932 218
122 iso_pu_bacteria 2821268502 2821271519 218
123 3300026088 Ga0207641_10373441 Ga0207641_103734412 219
124 3300003215 JGI25153J46596_10000540 JGI25153J46596_1000054015 220
125 3300003322 rootL2_10211567 rootL2_102115672 220
126 3300027717 Ga0209998_10046414 Ga0209998_100464141 220
127 3300046690 Ga0495624_0470511 Ga0495624_0470511_34_723 220
128 3300049704 Ga0501221_010419 Ga0501221_010419_443_1135 220
129 3300003322 rootL2_10196686 rootL2_101966862 222
130 3300005338 Ga0068868_100483259 Ga0068868_1004832591 222
131 3300005354 Ga0070675_100723530 Ga0070675_1007235301 222
132 3300005355 Ga0070671_100432624 Ga0070671_1004326242 222
133 3300005356 Ga0070674_100153436 Ga0070674_1001534361 222
134 3300005364 Ga0070673_100625360 Ga0070673_1006253602 222
135 3300005543 Ga0070672_100157825 Ga0070672_1001578253 222
136 3300013296 Ga0157374_10031793 Ga0157374_100317933 222
137 3300014969 Ga0157376_10033493 Ga0157376_100334933 222
138 3300014969 Ga0157376_10483081 Ga0157376_104830812 222
139 3300017792 Ga0163161_10359700 Ga0163161_103597001 222
140 3300025920 Ga0207649_10128122 Ga0207649_101281222 222
141 3300025940 Ga0207691_10172506 Ga0207691_101725062 222
142 3300025960 Ga0207651_10155013 Ga0207651_101550132 222
143 3300048913 Ga0496110_0094647 Ga0496110_0094647_270_1001 222
144 iso_pu_bacteria 2643221724 2644680794 222
145 iso_pu_bacteria 2808606384 2808968879 222
146 iso_pu_bacteria 2808606390 2809003710 222
147 iso_pu_bacteria 2808606391 2809010987 222
148 iso_pu_bacteria 2908756301 2908757473 222
149 iso_pu_bacteria 8006926726 8006930743 222
150 3300025917 Ga0207660_10592415 Ga0207660_105924152 223
151 3300025937 Ga0207669_10228711 Ga0207669_102287112 223
152 iso_pu_bacteria 2643221644 2644243914 223
153 iso_pu_bacteria 2738541337 2739053717 223
154 3300005331 Ga0070670_100018340 Ga0070670_1000183405 224
155 3300005354 Ga0070675_100011272 Ga0070675_1000112725 224
156 3300006042 Ga0075368_10081859 Ga0075368_100818592 224
157 3300006048 Ga0075363_100053017 Ga0075363_1000530172 224
158 3300006177 Ga0075362_10159496 Ga0075362_101594962 224
159 3300006178 Ga0075367_10202123 Ga0075367_102021232 224
160 3300006186 Ga0075369_10013170 Ga0075369_100131701 224
161 3300006358 Ga0068871_100009508 Ga0068871_1000095081 224
162 3300013308 Ga0157375_10194797 Ga0157375_101947972 224
163 3300014325 Ga0163163_10053517 Ga0163163_100535174 224
164 3300014969 Ga0157376_10016372 Ga0157376_100163722 224
165 3300025925 Ga0207650_10200233 Ga0207650_102002332 224
166 3300025940 Ga0207691_10020338 Ga0207691_100203385 224
167 3300026121 Ga0207683_10044697 Ga0207683_100446973 224
168 3300027866 Ga0209813_10109827 Ga0209813_101098271 224
169 3300035119 Ga0373956_0215931 Ga0373956_0215931_202_885 224
170 3300038443 Ga0395901_0205568 Ga0395901_0205568_1076_1759 224
171 3300050492 nmdc:mga0yw44_47163_c1 nmdc:mga0yw44_47163_c1_1130_1819 224
172 3300050493 nmdc:mga0k408_6999_c1 nmdc:mga0k408_6999_c1_4556_5245 224
173 3300050494 nmdc:mga06z11_51599_c1 nmdc:mga06z11_51599_c1_606_1295 224
174 3300050495 nmdc:mga04h51_7830_c1 nmdc:mga04h51_7830_c1_1766_2455 224
175 iso_pu_bacteria 2643221639 2644222254 224
176 iso_pu_bacteria 2643221646 2644258139 224
177 3300005328 Ga0070676_10121656 Ga0070676_101216561 225
178 3300005330 Ga0070690_100116027 Ga0070690_1001160271 225
179 3300005331 Ga0070670_100001673 Ga0070670_1000016732 225
180 3300005365 Ga0070688_100400703 Ga0070688_1004007032 225
181 3300005455 Ga0070663_100308217 Ga0070663_1003082172 225
182 3300005457 Ga0070662_100105308 Ga0070662_1001053082 225
183 3300005459 Ga0068867_100005891 Ga0068867_1000058917 225
184 3300005539 Ga0068853_100215152 Ga0068853_1002151522 225
185 3300005577 Ga0068857_100012412 Ga0068857_1000124126 225
186 3300005618 Ga0068864_100005574 Ga0068864_1000055749 225
187 3300005618 Ga0068864_100037177 Ga0068864_1000371772 225
188 3300005841 Ga0068863_100014739 Ga0068863_1000147396 225
189 3300005841 Ga0068863_100037388 Ga0068863_1000373884 225
190 3300005842 Ga0068858_100042577 Ga0068858_1000425773 225
191 3300005844 Ga0068862_100032137 Ga0068862_1000321371 225
192 3300005985 Ga0081539_10002585 Ga0081539_100025855 225
193 3300006195 Ga0075366_10264931 Ga0075366_102649312 225
194 3300009176 Ga0105242_10053903 Ga0105242_100539034 225
195 3300013104 Ga0157370_10003812 Ga0157370_100038126 225
196 3300013104 Ga0157370_10159625 Ga0157370_101596251 225
197 3300013105 Ga0157369_10044991 Ga0157369_100449912 225
198 3300013307 Ga0157372_10052274 Ga0157372_100522742 225
199 3300013307 Ga0157372_10259302 Ga0157372_102593022 225
200 3300014325 Ga0163163_10127406 Ga0163163_101274062 225
201 3300014326 Ga0157380_10555122 Ga0157380_105551222 225
202 3300014968 Ga0157379_10001219 Ga0157379_1000121910 225
203 3300014968 Ga0157379_10425495 Ga0157379_104254952 225
204 3300021384 Ga0213876_10003562 Ga0213876_100035627 225
205 3300025919 Ga0207657_10014696 Ga0207657_100146968 225
206 3300025923 Ga0207681_10039259 Ga0207681_100392592 225
207 3300025925 Ga0207650_10024020 Ga0207650_100240204 225
208 3300025934 Ga0207686_10028467 Ga0207686_100284672 225
209 3300025986 Ga0207658_10006530 Ga0207658_100065306 225
210 3300026089 Ga0207648_10022764 Ga0207648_100227645 225
211 3300026095 Ga0207676_10187634 Ga0207676_101876342 225
212 3300026116 Ga0207674_10010615 Ga0207674_100106154 225
213 3300028794 Ga0307515_10355713 Ga0307515_103557132 225
214 3300031507 Ga0307509_10062217 Ga0307509_100622173 225
215 3300031616 Ga0307508_10014131 Ga0307508_100141316 225
216 3300032002 Ga0307416_100560629 Ga0307416_1005606292 225
217 3300032004 Ga0307414_10028351 Ga0307414_100283514 225
218 3300032005 Ga0307411_10021264 Ga0307411_100212642 225
219 3300033180 Ga0307510_10066040 Ga0307510_100660404 225
220 3300037471 Ga0395905_0009530 Ga0395905_0009530_4065_4784 225
221 3300039437 Ga0436365_0523972 Ga0436365_0523972_4486_5172 225
222 3300039450 Ga0436363_1222566 Ga0436363_1222566_769_1455 225
223 3300039453 Ga0436362_0198186 Ga0436362_0198186_1068_1754 225
224 3300042876 Ga0451577_0135131 Ga0451577_0135131_511_1197 225
225 3300050493 nmdc:mga0k408_15217_c1 nmdc:mga0k408_15217_c1_3104_3790 225
226 3300054114 Ga0501084_0071889 Ga0501084_0071889_915_1637 225
227 iso_pu_bacteria 2643221544 2643746369 225
228 iso_pu_bacteria 2932422444 2932422650 225
229 3300003316 rootH1_10056519 rootH1_100565192 226
230 3300003323 rootH1_10034842 rootH1_100348421 226
231 3300003758 Ga0055532_1000314 Ga0055532_100031419 226
232 3300003760 Ga0055527_1000055 Ga0055527_100005564 226
233 3300003761 Ga0055535_1000083 Ga0055535_100008364 226
234 3300003762 Ga0055542_1005996 Ga0055542_10059962 226
235 3300005328 Ga0070676_10251329 Ga0070676_102513292 226
236 3300005337 Ga0070682_100025861 Ga0070682_1000258613 226
237 3300005347 Ga0070668_100330829 Ga0070668_1003308292 226
238 3300005353 Ga0070669_100479688 Ga0070669_1004796881 226
239 3300005354 Ga0070675_100262099 Ga0070675_1002620992 226
240 3300005364 Ga0070673_100316151 Ga0070673_1003161512 226
241 3300005434 Ga0070709_10000424 Ga0070709_1000042422 226
242 3300005435 Ga0070714_100026321 Ga0070714_1000263212 226
243 3300005437 Ga0070710_10021505 Ga0070710_100215054 226
244 3300005439 Ga0070711_100010642 Ga0070711_1000106423 226
245 3300005456 Ga0070678_100448015 Ga0070678_1004480152 226
246 3300005459 Ga0068867_100001563 Ga0068867_1000015637 226
247 3300005459 Ga0068867_100072681 Ga0068867_1000726813 226
248 3300005471 Ga0070698_100538452 Ga0070698_1005384522 226
249 3300005539 Ga0068853_100087815 Ga0068853_1000878152 226
250 3300005539 Ga0068853_100581387 Ga0068853_1005813872 226
251 3300005543 Ga0070672_100014528 Ga0070672_1000145285 226
252 3300005543 Ga0070672_100401761 Ga0070672_1004017612 226
253 3300005564 Ga0070664_100164205 Ga0070664_1001642054 226
254 3300005617 Ga0068859_100033265 Ga0068859_1000332652 226
255 3300005719 Ga0068861_100000654 Ga0068861_1000006546 226
256 3300005843 Ga0068860_100000602 Ga0068860_10000060238 226
257 3300005844 Ga0068862_100004504 Ga0068862_1000045048 226
258 3300005844 Ga0068862_100054203 Ga0068862_1000542032 226
259 3300005844 Ga0068862_100720178 Ga0068862_1007201782 226
260 3300006195 Ga0075366_10018496 Ga0075366_100184962 226
261 3300006195 Ga0075366_10117035 Ga0075366_101170352 226
262 3300006353 Ga0075370_10272745 Ga0075370_102727451 226
263 3300006358 Ga0068871_101069273 Ga0068871_1010692731 226
264 3300006881 Ga0068865_100002296 Ga0068865_1000022969 226
265 3300006931 Ga0097620_100033265 Ga0097620_1000332652 226
266 3300009148 Ga0105243_10060162 Ga0105243_100601624 226
267 3300009148 Ga0105243_10219105 Ga0105243_102191052 226
268 3300009176 Ga0105242_10070771 Ga0105242_100707712 226
269 3300009176 Ga0105242_10432828 Ga0105242_104328281 226
270 3300009177 Ga0105248_10011339 Ga0105248_100113396 226
271 3300009177 Ga0105248_10234568 Ga0105248_102345681 226
272 3300009177 Ga0105248_10610311 Ga0105248_106103112 226
273 3300009545 Ga0105237_10006549 Ga0105237_100065499 226
274 3300009551 Ga0105238_10090876 Ga0105238_100908762 226
275 3300009553 Ga0105249_10034747 Ga0105249_100347472 226
276 3300010375 Ga0105239_10598597 Ga0105239_105985971 226
277 3300013297 Ga0157378_10001074 Ga0157378_1000107410 226
278 3300013306 Ga0163162_10025716 Ga0163162_100257167 226
279 3300013306 Ga0163162_10869768 Ga0163162_108697682 226
280 3300013308 Ga0157375_10034633 Ga0157375_100346336 226
281 3300014326 Ga0157380_10057669 Ga0157380_100576694 226
282 3300014968 Ga0157379_10029133 Ga0157379_100291333 226
283 3300014968 Ga0157379_10158232 Ga0157379_101582322 226
284 3300017792 Ga0163161_10081492 Ga0163161_100814922 226
285 3300025228 Ga0209672_100040 Ga0209672_10004063 226
286 3300025229 Ga0209147_100048 Ga0209147_10004863 226
287 3300025242 Ga0209258_100070 Ga0209258_10007063 226
288 3300025253 Ga0209677_100303 Ga0209677_10030327 226
289 3300025254 Ga0209148_1000284 Ga0209148_100028419 226
290 3300025256 Ga0209759_1001239 Ga0209759_10012395 226
291 3300025261 Ga0209233_1009018 Ga0209233_10090184 226
292 3300025272 Ga0209455_1000178 Ga0209455_100017825 226
293 3300025272 Ga0209455_1007607 Ga0209455_10076072 226
294 3300025272 Ga0209455_1008518 Ga0209455_10085182 226
295 3300025893 Ga0207682_10134656 Ga0207682_101346561 226
296 3300025898 Ga0207692_10000738 Ga0207692_1000073813 226
297 3300025906 Ga0207699_10114423 Ga0207699_101144231 226
298 3300025907 Ga0207645_10240121 Ga0207645_102401212 226
299 3300025916 Ga0207663_10097635 Ga0207663_100976352 226
300 3300025923 Ga0207681_10405680 Ga0207681_104056802 226
301 3300025924 Ga0207694_10133747 Ga0207694_101337474 226
302 3300025926 Ga0207659_10077370 Ga0207659_100773702 226
303 3300025928 Ga0207700_10347346 Ga0207700_103473462 226
304 3300025928 Ga0207700_10487405 Ga0207700_104874051 226
305 3300025940 Ga0207691_10012884 Ga0207691_100128843 226
306 3300025941 Ga0207711_10009278 Ga0207711_100092785 226
307 3300025941 Ga0207711_10156229 Ga0207711_101562291 226
308 3300025945 Ga0207679_10704189 Ga0207679_107041891 226
309 3300025972 Ga0207668_10294255 Ga0207668_102942552 226
310 3300026089 Ga0207648_10000582 Ga0207648_1000058231 226
311 3300026089 Ga0207648_10371344 Ga0207648_103713442 226
312 3300026118 Ga0207675_100000601 Ga0207675_10000060129 226
313 3300028380 Ga0268265_10003246 Ga0268265_100032467 226
314 3300028380 Ga0268265_10227031 Ga0268265_102270312 226
315 3300028380 Ga0268265_10376191 Ga0268265_103761912 226
316 3300028381 Ga0268264_10001438 Ga0268264_1000143816 226
317 3300028556 Ga0265337_1048304 Ga0265337_10483042 226
318 3300028563 Ga0265319_1007532 Ga0265319_10075325 226
319 3300028573 Ga0265334_10015225 Ga0265334_100152252 226
320 3300028577 Ga0265318_10007739 Ga0265318_100077398 226
321 3300028653 Ga0265323_10001387 Ga0265323_1000138710 226
322 3300028654 Ga0265322_10059546 Ga0265322_100595461 226
323 3300028666 Ga0265336_10000269 Ga0265336_100002697 226
324 3300028800 Ga0265338_10000076 Ga0265338_1000007687 226
325 3300029957 Ga0265324_10003018 Ga0265324_100030183 226
326 3300031251 Ga0265327_10005550 Ga0265327_100055508 226
327 3300031548 Ga0307408_100257721 Ga0307408_1002577212 226
328 3300031616 Ga0307508_10000282 Ga0307508_1000028236 226
329 3300035089 Ga0373944_0052020 Ga0373944_0052020_332_1033 226
330 3300035117 Ga0373953_0014913 Ga0373953_0014913_466_1176 226
331 3300035118 Ga0373954_0040291 Ga0373954_0040291_679_1389 226
332 3300035119 Ga0373956_0003655 Ga0373956_0003655_4104_4814 226
333 3300035120 Ga0373957_0035285 Ga0373957_0035285_95_805 226
334 3300035120 Ga0373957_0226723 Ga0373957_0226723_51_740 226
335 3300035171 Ga0373946_0064130 Ga0373946_0064130_721_1410 226
336 3300035172 Ga0373955_0008222 Ga0373955_0008222_3090_3800 226
337 3300035724 Ga0373933_0133536 Ga0373933_0133536_670_1359 226
338 3300035724 Ga0373933_0283502 Ga0373933_0283502_265_975 226
339 3300036401 Ga0373937_0004472 Ga0373937_0004472_611_1321 226
340 3300036401 Ga0373937_0143870 Ga0373937_0143870_1283_1972 226
341 3300036401 Ga0373937_0264229 Ga0373937_0264229_565_1272 226
342 3300036401 Ga0373937_0509427 Ga0373937_0509427_174_863 226
343 3300036401 Ga0373937_0773704 Ga0373937_0773704_83_805 226
344 3300037068 Ga0373925_0004343 Ga0373925_0004343_4242_4943 226
345 3300037312 Ga0395899_0149132 Ga0395899_0149132_892_1590 226
346 3300037471 Ga0395905_0118549 Ga0395905_0118549_1319_2017 226
347 3300038443 Ga0395901_0754935 Ga0395901_0754935_227_925 226
348 3300039438 Ga0436360_1280861 Ga0436360_1280861_314_1006 226
349 3300042142 Ga0450905_032236 Ga0450905_032236_23_712 226
350 3300044658 Ga0466972_0000079 Ga0466972_0000079_15162_15851 226
351 3300044683 Ga0466965_0061319 Ga0466965_0061319_308_997 226
352 3300044694 Ga0466963_0185797 Ga0466963_0185797_295_1017 226
353 3300044735 Ga0466968_0125307 Ga0466968_0125307_191_880 226
354 3300044842 Ga0466957_0083523 Ga0466957_0083523_881_1603 226
355 3300045049 Ga0466959_0057803 Ga0466959_0057803_211_918 226
356 3300045049 Ga0466959_0092203 Ga0466959_0092203_1057_1746 226
357 3300045049 Ga0466959_0146617 Ga0466959_0146617_484_1173 226
358 3300046459 Ga0495629_0255590 Ga0495629_0255590_352_1059 226
359 3300046530 Ga0495654_0000586 Ga0495654_0000586_7508_8197 226
360 3300046535 Ga0495586_0080516 Ga0495586_0080516_581_1282 226
361 3300046675 Ga0495657_0403603 Ga0495657_0403603_13_723 226
362 3300046683 Ga0495658_0162096 Ga0495658_0162096_663_1352 226
363 3300047319 Ga0495674_0225259 Ga0495674_0225259_84_773 226
364 3300047322 Ga0495680_0075847 Ga0495680_0075847_1777_2487 226
365 3300048904 Ga0496101_0400210 Ga0496101_0400210_26_727 226
366 3300048919 Ga0496116_0041207 Ga0496116_0041207_1228_1929 226
367 3300048920 Ga0496117_0141382 Ga0496117_0141382_703_1392 226
368 3300048921 Ga0496118_0025908 Ga0496118_0025908_2394_3095 226
369 3300048921 Ga0496118_0059587 Ga0496118_0059587_1467_2156 226
370 3300048924 Ga0496121_0004163 Ga0496121_0004163_8891_9580 226
371 3300048924 Ga0496121_0007979 Ga0496121_0007979_6022_6711 226
372 3300050489 nmdc:mga03683_97077_c1 nmdc:mga03683_97077_c1_191_880 226
373 3300050493 nmdc:mga0k408_153380_c1 nmdc:mga0k408_153380_c1_540_1259 226
374 3300050493 nmdc:mga0k408_50428_c1 nmdc:mga0k408_50428_c1_1648_2376 226
375 3300050496 nmdc:mga07m45_19775_c1 nmdc:mga07m45_19775_c1_1937_2626 226
376 3300050496 nmdc:mga07m45_212911_c1 nmdc:mga07m45_212911_c1_320_1057 226
377 3300053085 Ga0495619_0072795 Ga0495619_0072795_939_1649 226
378 3300053111 Ga0500572_003464 Ga0500572_003464_1234_1923 226
379 3300053134 Ga0500658_0002588 Ga0500658_0002588_5379_6074 226
380 3300053136 Ga0500559_0000843 Ga0500559_0000843_715_1404 226
381 3300053163 Ga0500639_138480 Ga0500639_138480_89_778 226
382 3300053735 Ga0500596_004635 Ga0500596_004635_1015_1704 226
383 iso_pu_bacteria 2515154122 2515682114 226
384 iso_pu_bacteria 2885270888 2885274408 226
385 iso_pu_bacteria 2902682994 2902685525 226
386 iso_pu_bacteria 2904690495 2904695481 226
387 iso_pu_bacteria 8020938398 8020940225 226
388 iso_pu_bacteria 8020953355 8020955396 226
389 iso_pu_bacteria 8039098773 8039099927 226
390 3300005328 Ga0070676_10049235 Ga0070676_100492352 227
391 3300005331 Ga0070670_100018930 Ga0070670_1000189304 227
392 3300005338 Ga0068868_100216757 Ga0068868_1002167572 227
393 3300005353 Ga0070669_100064000 Ga0070669_1000640002 227
394 3300005364 Ga0070673_100321716 Ga0070673_1003217161 227
395 3300005366 Ga0070659_100253896 Ga0070659_1002538961 227
396 3300005535 Ga0070684_100077838 Ga0070684_1000778381 227
397 3300005539 Ga0068853_100312300 Ga0068853_1003123001 227
398 3300005578 Ga0068854_100037840 Ga0068854_1000378402 227
399 3300005616 Ga0068852_100069880 Ga0068852_1000698804 227
400 3300005718 Ga0068866_10149016 Ga0068866_101490162 227
401 3300005834 Ga0068851_10028764 Ga0068851_100287642 227
402 3300006038 Ga0075365_10381602 Ga0075365_103816022 227
403 3300009148 Ga0105243_10015365 Ga0105243_100153652 227
404 3300009551 Ga0105238_10338268 Ga0105238_103382682 227
405 3300013307 Ga0157372_10055986 Ga0157372_100559863 227
406 3300025297 Ga0209758_1000122 Ga0209758_100012227 227
407 3300025321 Ga0207656_10032412 Ga0207656_100324123 227
408 3300025321 Ga0207656_10066814 Ga0207656_100668141 227
409 3300025899 Ga0207642_10112458 Ga0207642_101124582 227
410 3300025923 Ga0207681_10004876 Ga0207681_100048768 227
411 3300025932 Ga0207690_10130814 Ga0207690_101308142 227
412 3300025935 Ga0207709_10458587 Ga0207709_104585871 227
413 3300025945 Ga0207679_10377360 Ga0207679_103773602 227
414 3300025945 Ga0207679_10695467 Ga0207679_106954671 227
415 3300025981 Ga0207640_10017542 Ga0207640_100175424 227
416 3300026023 Ga0207677_10040842 Ga0207677_100408422 227
417 3300026023 Ga0207677_10434918 Ga0207677_104349182 227
418 3300026041 Ga0207639_10231840 Ga0207639_102318402 227
419 3300026067 Ga0207678_10009973 Ga0207678_100099732 227
420 3300031548 Ga0307408_100109503 Ga0307408_1001095032 227
421 3300037068 Ga0373925_0028261 Ga0373925_0028261_2425_3150 227
422 3300039437 Ga0436365_1723898 Ga0436365_1723898_1369_2097 227
423 3300041410 Ga0439461_0008936 Ga0439461_0008936_219_920 227
424 3300042004 Ga0439445_0038063 Ga0439445_0038063_330_1031 227
425 3300042121 Ga0450919_001148 Ga0450919_001148_634_1335 227
426 3300042531 Ga0450918_011527 Ga0450918_011527_791_1492 227
427 3300042876 Ga0451577_0012576 Ga0451577_0012576_2402_3097 227
428 3300046459 Ga0495629_0035780 Ga0495629_0035780_2429_3154 227
429 3300046472 Ga0495580_0149956 Ga0495580_0149956_67_792 227
430 3300046473 Ga0495582_0054871 Ga0495582_0054871_1055_1780 227
431 3300046663 Ga0495635_0135825 Ga0495635_0135825_331_1056 227
432 3300046683 Ga0495658_0050482 Ga0495658_0050482_1056_1781 227
433 3300046809 Ga0495600_0131939 Ga0495600_0131939_28_753 227
434 3300047471 Ga0495684_0004197 Ga0495684_0004197_694_1419 227
435 3300048925 Ga0496122_0001063 Ga0496122_0001063_13663_14370 227
436 3300048926 Ga0496123_0000246 Ga0496123_0000246_53284_53991 227
437 3300048927 Ga0496124_0121720 Ga0496124_0121720_1115_1822 227
438 3300003316 rootH1_10000900 rootH1_100009003 228
439 3300003322 rootL2_10009014 rootL2_1000901412 228
440 3300005337 Ga0070682_100012280 Ga0070682_1000122804 228
441 3300031507 Ga0307509_10000135 Ga0307509_1000013587 228
442 3300031649 Ga0307514_10017292 Ga0307514_100172922 228
443 3300033180 Ga0307510_10008203 Ga0307510_1000820311 228
444 3300042126 Ga0450888_000540 Ga0450888_000540_495_1202 228
445 3300042129 Ga0450891_000178 Ga0450891_000178_367_1074 228
446 3300042138 Ga0450903_004712 Ga0450903_004712_1194_1901 228
447 3300049130 Ga0501310_016830 Ga0501310_016830_26_742 228
448 3300049683 Ga0501253_019534 Ga0501253_019534_67_783 228
449 3300049706 Ga0501229_000131 Ga0501229_000131_6427_7143 228
450 3300036401 Ga0373937_0284815 Ga0373937_0284815_703_1404 229
451 3300046454 Ga0495592_0008157 Ga0495592_0008157_6361_7086 229
452 3300003203 JGI25406J46586_10004727 JGI25406J46586_100047275 230
453 3300003203 JGI25406J46586_10007846 JGI25406J46586_100078462 230
454 3300003659 JGI25404J52841_10014926 JGI25404J52841_100149262 230
455 3300003659 JGI25404J52841_10015874 JGI25404J52841_100158742 230
456 3300003659 JGI25404J52841_10016611 JGI25404J52841_100166112 230
457 3300003794 Ga0055531_10005969 Ga0055531_100059693 230
458 3300005365 Ga0070688_100190226 Ga0070688_1001902262 230
459 3300005578 Ga0068854_100252707 Ga0068854_1002527072 230
460 3300005616 Ga0068852_100210124 Ga0068852_1002101242 230
461 3300005937 Ga0081455_10008730 Ga0081455_100087302 230
462 3300005937 Ga0081455_10012116 Ga0081455_1001211612 230
463 3300005937 Ga0081455_10027965 Ga0081455_100279655 230
464 3300005937 Ga0081455_10378492 Ga0081455_103784922 230
465 3300005983 Ga0081540_1003649 Ga0081540_10036497 230
466 3300005983 Ga0081540_1008233 Ga0081540_10082335 230
467 3300005983 Ga0081540_1050753 Ga0081540_10507533 230
468 3300005985 Ga0081539_10000220 Ga0081539_1000022010 230
469 3300005985 Ga0081539_10082396 Ga0081539_100823961 230
470 3300006944 Ga0099823_1057802 Ga0099823_10578022 230
471 3300025273 Ga0209673_1009213 Ga0209673_10092132 230
472 3300025298 Ga0209050_1002975 Ga0209050_10029754 230
473 3300025299 Ga0209256_1000840 Ga0209256_100084022 230
474 3300025304 Ga0209257_1004031 Ga0209257_10040314 230
475 3300025981 Ga0207640_10242517 Ga0207640_102425172 230
476 3300028786 Ga0307517_10001421 Ga0307517_1000142113 230
477 3300044694 Ga0466963_0369143 Ga0466963_0369143_245_955 230
478 3300046499 Ga0495594_0259380 Ga0495594_0259380_132_833 230
479 3300046519 Ga0495632_0121200 Ga0495632_0121200_249_980 230
480 3300046616 Ga0495668_0075965 Ga0495668_0075965_57_758 230
481 3300048927 Ga0496124_0005008 Ga0496124_0005008_104_865 230
482 3300049583 Ga0501067_0023296 Ga0501067_0023296_1700_2401 230
483 3300050512 nmdc:mga0n895_525766_c1 nmdc:mga0n895_525766_c1_386_1087 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

32

254

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.8756 5 226
3axf-assembly3.cif.gz_C perrhenate binding to a11c/r153c moda mutant 0.8466 5 226
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.8441 5 226
2h5y-assembly2.cif.gz_B crystallographic structure of the molybdate-binding protein of xanthomonas citri at 1.7 ang resolution bound to molybdate 0.8423 1 226
4xxu-assembly1.cif.gz_B moda - chromate bound 0.8423 5 226
ID Description Score Start End Superfamily
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9313 4 227 3.40.190.10
4rxlA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9264 5 80 3.40.190.10
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.924 4 227 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8928 1 226 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8858 1 226 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A520GGA9-F1-model_v4 ABC transporter substrate-binding protein 0.9726 35 226 GO:0015689
GO:0030973
AF-A0A127F477-F1-model_v4 ABC transporter periplasmic substrate-binding protein 0.9712 5 226 GO:0015689
GO:0030973
AF-A0A2V1HEX1-F1-model_v4 deleted 0.9691 5 226
AF-A0A536SAY7-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9627 9 226 GO:0015689
GO:0030973
AF-A0A2V8BZU3-F1-model_v4 ABC transporter substrate-binding protein 0.9617 5 227 GO:0030246
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.16 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map