F452890

General Info

Members Datasets Scaffolds Average Seq Length
484 308 470 453

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100002136|Ga0070705_1000021362
Length 488
Sequence MSQALPPVSVAERLAERIAALQAGTAALKSERGQNRAVPSPLVGEGQGGGESRRCGGEGRAQLSGAARQTCENLVLDVIGLCVAARNQPYMQAALAAWDDEGPCTAIGHGRTLSAAGAAFVNGTAAHGEDFDDTFEGGPVHAGAVVVPAVLAACERYARTGEAALLGIAVGAETLCRLSLVAPRLIHRAGFHPTAVLGAVGAAVGLDRRQIVDALGIAGSMASGIIEYLAEGAWTKRLHPGWAAQAGLRAALLAKHGFVGPRTVIEGTHGLFNAFAHTTAVDYDSLTEGFGERWLIETLAFKPYPCGTMTHPYIDCARRLAARGVAPGEIREMVCEAGEGTVHRLWEPLADKQRPPNGYAGKFSQPYCIARAFVRGNVGLDAFTDEAVRDSLVLELARKVSYVVDPANPYPRAFTGHIRVVLIDGRVVEERQPHIRGGAQEPLTRAEIEDKFRLCGRYGGWDDARTDAAVALARRLFDGESDLGVLRG

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
3 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
4 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
5 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
6 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
7 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
8 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
9 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
10 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
11 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
12 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
292 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
293 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
294 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
295 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
296 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
297 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
298 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
301 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
307 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
308 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.64
Nodule 0.62
Rhizoplane 7.02
Rhizosphere 83.06
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000010 3300003215 Bacteria 337769
2 JGI25160J50197_1000018 3300003354 Bacteria 239933
3 JGI25161J50226_1000020 3300003374 Bacteria 164844
4 Ga0055524_1003148 3300003775 Bacteria 8128
5 Ga0055528_1000721 3300003790 Bacteria 23354
6 Ga0055543_1000004 3300004625 Bacteria 239971
7 Ga0065165_1000065 3300005262 Bacteria 174075
8 Ga0070690_100019427 3300005330 Bacteria 4123
9 Ga0070690_100025142 3300005330 Bacteria 3666
10 Ga0070670_100125149 3300005331 Bacteria 2219
11 Ga0070670_100171971 3300005331 Bacteria 1879
12 Ga0068869_100028381 3300005334 Bacteria 3909
13 Ga0068868_100036161 3300005338 Bacteria 3820
14 Ga0070689_100022884 3300005340 Bacteria 4671
15 Ga0070691_10001323 3300005341 Bacteria 10537
16 Ga0070687_100056927 3300005343 Bacteria 2048
17 Ga0070692_10048226 3300005345 Bacteria 2206
18 Ga0070668_100084123 3300005347 Bacteria 2498
19 Ga0070669_100070123 3300005353 Bacteria 2591
20 Ga0070675_100046883 3300005354 Bacteria 3540
21 Ga0070688_100018515 3300005365 Bacteria 4020
22 Ga0070659_100077319 3300005366 Bacteria 2654
23 Ga0070714_100010606 3300005435 Bacteria 7290
24 Ga0070713_100058585 3300005436 Bacteria 3212
25 Ga0070701_10061068 3300005438 Bacteria 1987
26 Ga0070711_100013485 3300005439 Bacteria 5133
27 Ga0070705_100002136 3300005440 Bacteria 10059
28 Ga0070700_100013806 3300005441 Bacteria 4544
29 Ga0070694_100006148 3300005444 Bacteria 7288
30 Ga0070708_100000142 3300005445 Bacteria 49401
31 Ga0070663_100051932 3300005455 Bacteria 2922
32 Ga0070678_100032389 3300005456 Bacteria 3618
33 Ga0070678_100045899 3300005456 Bacteria 3129
34 Ga0070678_100200102 3300005456 Bacteria 1648
35 Ga0070685_10118106 3300005466 Bacteria 1643
36 Ga0070706_100108083 3300005467 Bacteria 2588
37 Ga0070707_100068960 3300005468 Bacteria 3404
38 Ga0070699_100003531 3300005518 Bacteria 13822
39 Ga0070699_100005255 3300005518 Bacteria 11370
40 Ga0070699_100169789 3300005518 Bacteria 1932
41 Ga0070679_100081126 3300005530 Bacteria 3233
42 Ga0070679_100122432 3300005530 Bacteria 2585
43 Ga0070697_100007169 3300005536 Bacteria 8673
44 Ga0070697_100126423 3300005536 Bacteria 2142
45 Ga0070697_100220492 3300005536 Bacteria 1616
46 Ga0068853_100058533 3300005539 Bacteria 3326
47 Ga0070672_100087235 3300005543 Bacteria 2511
48 Ga0070695_100005494 3300005545 Bacteria 7467
49 Ga0070695_100024759 3300005545 Bacteria 3701
50 Ga0070696_100004630 3300005546 Bacteria 9185
51 Ga0070665_100141860 3300005548 Bacteria 2405
52 Ga0070704_100062326 3300005549 Bacteria 2672
53 Ga0068855_100008088 3300005563 Bacteria 12708
54 Ga0068855_100013438 3300005563 Bacteria 9871
55 Ga0068857_100003412 3300005577 Bacteria 13243
56 Ga0068856_100052668 3300005614 Bacteria 4014
57 Ga0068856_100118286 3300005614 Bacteria 2651
58 Ga0070702_100009081 3300005615 Bacteria 4851
59 Ga0068852_100008649 3300005616 Bacteria 7522
60 Ga0068859_100031478 3300005617 Bacteria 5327
61 Ga0068859_100031649 3300005617 Bacteria 5312
62 Ga0068864_100049926 3300005618 Bacteria 3600
63 Ga0068864_100147420 3300005618 Bacteria 2129
64 Ga0068866_10013844 3300005718 Bacteria 3547
65 Ga0068870_10021984 3300005840 Bacteria 3130
66 Ga0068863_100021511 3300005841 Bacteria 6155
67 Ga0068860_100135925 3300005843 Bacteria 2361
68 Ga0068862_100021766 3300005844 Bacteria 5361
69 Ga0068862_100024885 3300005844 Bacteria 5023
70 Ga0081455_10015313 3300005937 Bacteria 7456
71 Ga0081455_10029876 3300005937 Bacteria 4963
72 Ga0081538_10007242 3300005981 Bacteria 9620
73 Ga0081540_1019281 3300005983 Bacteria 4152
74 Ga0081539_10000012 3300005985 Bacteria 440369
75 Ga0081539_10002229 3300005985 Bacteria 28273
76 Ga0075365_10008563 3300006038 Bacteria 5821
77 Ga0075365_10061537 3300006038 Bacteria 2507
78 Ga0075368_10022279 3300006042 Bacteria 2411
79 Ga0070715_10011087 3300006163 Bacteria 3234
80 Ga0070715_10051940 3300006163 Bacteria 1766
81 Ga0070716_100008399 3300006173 Bacteria 5121
82 Ga0068871_100063366 3300006358 Bacteria 3023
83 Ga0075428_100078334 3300006844 Bacteria 3608
84 Ga0075430_100015121 3300006846 Bacteria 6569
85 Ga0075431_100000995 3300006847 Bacteria 25251
86 Ga0075431_100178090 3300006847 Bacteria 2183
87 Ga0075433_10016463 3300006852 Bacteria 6096
88 Ga0075434_100001081 3300006871 Bacteria 22315
89 Ga0075434_100001146 3300006871 Bacteria 21889
90 Ga0075434_100046319 3300006871 Bacteria 4315
91 Ga0075434_100170356 3300006871 Bacteria 2197
92 Ga0075434_100178921 3300006871 Bacteria 2140
93 Ga0075436_100001269 3300006914 Bacteria 17145
94 Ga0075436_100004460 3300006914 Bacteria 9605
95 Ga0097620_100031478 3300006931 Bacteria 5327
96 Ga0097620_100031650 3300006931 Bacteria 5312
97 Ga0075435_100002439 3300007076 Bacteria 12345
98 Ga0099794_10001312 3300007265 Bacteria 8649
99 Ga0111539_10004506 3300009094 Bacteria 18215
100 Ga0111539_10021144 3300009094 Bacteria 8013
101 Ga0111539_10034808 3300009094 Bacteria 6102
102 Ga0111539_10149980 3300009094 Bacteria 2729
103 Ga0105247_10024302 3300009101 Bacteria 3650
104 Ga0114129_10013551 3300009147 Bacteria 11618
105 Ga0114129_10045213 3300009147 Bacteria 6190
106 Ga0114129_10071734 3300009147 Bacteria 4829
107 Ga0105243_10008030 3300009148 Bacteria 8102
108 Ga0105237_10047966 3300009545 Bacteria 4294
109 Ga0105238_10332295 3300009551 Bacteria 1507
110 Ga0105249_10063681 3300009553 Bacteria 3388
111 Ga0105249_10075583 3300009553 Bacteria 3120
112 Ga0157375_10046974 3300013308 Bacteria 4213
113 Ga0163163_10039234 3300014325 Bacteria 4621
114 Ga0157380_10030383 3300014326 Bacteria 4137
115 Ga0157380_10129727 3300014326 Bacteria 2149
116 Ga0157379_10038294 3300014968 Bacteria 4279
117 Ga0209455_1000494 3300025272 Bacteria 28781
118 Ga0209673_1000138 3300025273 Bacteria 158321
119 Ga0209130_1000035 3300025284 Bacteria 296161
120 Ga0209025_1006066 3300025294 Bacteria 9556
121 Ga0209564_1022721 3300025295 Bacteria 2204
122 Ga0209758_1000033 3300025297 Bacteria 469998
123 Ga0209256_1003268 3300025299 Bacteria 11623
124 Ga0207426_1000017 3300025302 Bacteria 577913
125 Ga0207653_10000916 3300025885 Bacteria 9775
126 Ga0207642_10003570 3300025899 Bacteria 4931
127 Ga0207710_10009678 3300025900 Bacteria 4051
128 Ga0207688_10000135 3300025901 Bacteria 31221
129 Ga0207647_10010263 3300025904 Bacteria 6617
130 Ga0207699_10079653 3300025906 Bacteria 2027
131 Ga0207645_10030498 3300025907 Bacteria 3474
132 Ga0207643_10004358 3300025908 Bacteria 7606
133 Ga0207684_10012097 3300025910 Bacteria 7514
134 Ga0207671_10146441 3300025914 Bacteria 1822
135 Ga0207663_10062138 3300025916 Bacteria 2373
136 Ga0207660_10036111 3300025917 Bacteria 3435
137 Ga0207662_10118737 3300025918 Bacteria 1656
138 Ga0207657_10073794 3300025919 Bacteria 2882
139 Ga0207649_10099177 3300025920 Bacteria 1924
140 Ga0207646_10119708 3300025922 Bacteria 2365
141 Ga0207694_10032128 3300025924 Bacteria 4016
142 Ga0207650_10008691 3300025925 Bacteria 6935
143 Ga0207650_10107676 3300025925 Bacteria 2153
144 Ga0207659_10026827 3300025926 Bacteria 3893
145 Ga0207700_10004698 3300025928 Bacteria 8093
146 Ga0207700_10064369 3300025928 Bacteria 2793
147 Ga0207690_10134090 3300025932 Bacteria 1816
148 Ga0207706_10044820 3300025933 Bacteria 3919
149 Ga0207709_10033321 3300025935 Bacteria 3024
150 Ga0207670_10007206 3300025936 Bacteria 6197
151 Ga0207704_10009950 3300025938 Bacteria 4614
152 Ga0207665_10006915 3300025939 Bacteria 7508
153 Ga0207691_10018822 3300025940 Bacteria 6540
154 Ga0207689_10011802 3300025942 Bacteria 7483
155 Ga0207661_10128409 3300025944 Bacteria 2168
156 Ga0207679_10038841 3300025945 Bacteria 3396
157 Ga0207667_10058895 3300025949 Bacteria 4026
158 Ga0207712_10009027 3300025961 Bacteria 6307
159 Ga0207658_10106840 3300025986 Bacteria 2205
160 Ga0207677_10014112 3300026023 Bacteria 4653
161 Ga0207703_10017422 3300026035 Bacteria 5607
162 Ga0207678_10001748 3300026067 Bacteria 19890
163 Ga0207678_10045581 3300026067 Bacteria 3792
164 Ga0207708_10000891 3300026075 Bacteria 22428
165 Ga0207708_10023443 3300026075 Bacteria 4665
166 Ga0207702_10085537 3300026078 Bacteria 2748
167 Ga0207641_10100254 3300026088 Bacteria 2550
168 Ga0207676_10020054 3300026095 Bacteria 4886
169 Ga0207676_10059460 3300026095 Bacteria 3018
170 Ga0207674_10002799 3300026116 Bacteria 21723
171 Ga0207675_100007361 3300026118 Bacteria 10400
172 Ga0207683_10007749 3300026121 Bacteria 9191
173 Ga0207683_10041191 3300026121 Bacteria 4032
174 Ga0207683_10044319 3300026121 Bacteria 3889
175 Ga0207698_10051289 3300026142 Bacteria 3153
176 Ga0207428_10008432 3300027907 Bacteria 9304
177 Ga0207428_10122313 3300027907 Bacteria 1995
178 Ga0268266_10070933 3300028379 Bacteria 3019
179 Ga0268265_10008198 3300028380 Bacteria 7058
180 Ga0268265_10039041 3300028380 Bacteria 3496
181 Ga0268264_10001838 3300028381 Bacteria 19352
182 Ga0268264_10104167 3300028381 Bacteria 2472
183 Ga0265337_1000691 3300028556 Bacteria 17795
184 Ga0265334_10002246 3300028573 Bacteria 9081
185 Ga0265338_10029750 3300028800 Bacteria 5405
186 Ga0307513_10058302 3300031456 Bacteria 4106
187 Ga0307513_10182493 3300031456 Bacteria 1960
188 Ga0265314_10001634 3300031711 Bacteria 24559
189 Ga0265342_10001205 3300031712 Bacteria 24521
190 Ga0373944_0003925 3300035089 Bacteria 3852
191 Ga0373923_0000267 3300035111 Bacteria 11360
192 Ga0373945_0029881 3300035116 Bacteria 1917
193 Ga0373954_0006992 3300035118 Bacteria 4925
194 Ga0373956_0023510 3300035119 Bacteria 2646
195 Ga0373943_0005794 3300035170 Bacteria 5549
196 Ga0373943_0044190 3300035170 Bacteria 2167
197 Ga0373946_0047892 3300035171 Bacteria 1777
198 Ga0373955_0000191 3300035172 Bacteria 25296
199 Ga0373955_0005711 3300035172 Bacteria 5604
200 Ga0373924_0000239 3300035410 Bacteria 16754
201 Ga0373931_0011661 3300035691 Bacteria 4247
202 Ga0373935_0004920 3300035692 Bacteria 7850
203 Ga0373935_0024476 3300035692 Bacteria 3716
204 Ga0373927_0012591 3300035695 Bacteria 5630
205 Ga0373927_0013334 3300035695 Bacteria 5464
206 Ga0373927_0030641 3300035695 Bacteria 3509
207 Ga0373927_0037033 3300035695 Bacteria 3171
208 Ga0373927_0062775 3300035695 Bacteria 2402
209 Ga0373933_0002903 3300035724 Bacteria 9576
210 Ga0373947_0019274 3300035725 Bacteria 3932
211 Ga0373947_0069935 3300035725 Bacteria 2149
212 Ga0373947_0154873 3300035725 Bacteria 1478
213 Ga0373937_0000030 3300036401 Bacteria 122176
214 Ga0373937_0015209 3300036401 Bacteria 6800
215 Ga0373937_0027771 3300036401 Bacteria 5120
216 Ga0373937_0255958 3300036401 Bacteria 1650
217 Ga0316584_0018811 3300036712 Bacteria 4987
218 Ga0373925_0000501 3300037068 Bacteria 39530
219 Ga0373925_0060415 3300037068 Bacteria 2846
220 Ga0373925_0093388 3300037068 Bacteria 2303
221 Ga0373925_0132563 3300037068 Bacteria 1944
222 Ga0395899_0000314 3300037312 Bacteria 62037
223 Ga0395900_0000408 3300037418 Bacteria 62036
224 Ga0395898_0000666 3300037466 Bacteria 62036
225 Ga0395905_0000392 3300037471 Bacteria 62036
226 Ga0395901_0000292 3300038443 Bacteria 62036
227 Ga0436360_0540813 3300039438 Bacteria 2557
228 Ga0436361_0468034 3300039447 Bacteria 3400
229 Ga0495592_0000046 3300046454 Bacteria 117345
230 Ga0495603_0100439 3300046455 Bacteria 1689
231 Ga0495629_0016126 3300046459 Bacteria 5364
232 Ga0495638_0000238 3300046460 Bacteria 75287
233 Ga0495651_0029859 3300046462 Bacteria 4250
234 Ga0495651_0105194 3300046462 Bacteria 2094
235 Ga0495653_0000036 3300046463 Bacteria 129776
236 Ga0495580_0035408 3300046472 Bacteria 3590
237 Ga0495582_0022666 3300046473 Bacteria 3436
238 Ga0495662_0011334 3300046476 Bacteria 4356
239 Ga0495662_0032042 3300046476 Bacteria 2539
240 Ga0495662_0069301 3300046476 Bacteria 1708
241 Ga0495664_0000002 3300046477 Bacteria 625183
242 Ga0495585_0013074 3300046492 Bacteria 4868
243 Ga0495594_0021861 3300046499 Bacteria 3417
244 Ga0495607_0090464 3300046501 Bacteria 1659
245 Ga0495606_0016858 3300046507 Bacteria 5548
246 Ga0495606_0033428 3300046507 Bacteria 3547
247 Ga0495608_0000006 3300046511 Bacteria 324334
248 Ga0495618_0000034 3300046514 Bacteria 104335
249 Ga0495628_0000077 3300046516 Bacteria 77338
250 Ga0495628_0252360 3300046516 Bacteria 1317
251 Ga0495630_0000516 3300046517 Bacteria 28537
252 Ga0495630_0003645 3300046517 Bacteria 10734
253 Ga0495644_0026632 3300046523 Bacteria 2193
254 Ga0495652_0000824 3300046529 Bacteria 35711
255 Ga0495665_0004116 3300046531 Bacteria 7842
256 Ga0495640_0000007 3300046533 Bacteria 265481
257 Ga0495640_0015825 3300046533 Bacteria 5661
258 Ga0495640_0036579 3300046533 Bacteria 3468
259 Ga0495587_0001165 3300046536 Bacteria 17314
260 Ga0495598_0000802 3300046537 Bacteria 6003
261 Ga0495645_0000116 3300046543 Bacteria 54286
262 Ga0495667_0000129 3300046559 Bacteria 54274
263 Ga0495667_0131065 3300046559 Bacteria 1617
264 Ga0495656_0044183 3300046615 Bacteria 1874
265 Ga0495634_0001134 3300046642 Bacteria 24604
266 Ga0495635_0000021 3300046663 Bacteria 164643
267 Ga0495659_0040961 3300046664 Bacteria 1653
268 Ga0495657_0000521 3300046675 Bacteria 35776
269 Ga0495599_0000001 3300046678 Bacteria 537563
270 Ga0495623_0000237 3300046679 Bacteria 35677
271 Ga0495646_0000007 3300046680 Bacteria 236764
272 Ga0495647_0035555 3300046681 Bacteria 1871
273 Ga0495658_0024071 3300046683 Bacteria 3239
274 Ga0495658_0033634 3300046683 Bacteria 2809
275 Ga0495613_0024619 3300046689 Bacteria 4486
276 Ga0495624_0036758 3300046690 Bacteria 3155
277 Ga0495600_0000190 3300046809 Bacteria 35746
278 Ga0495604_0000005 3300047317 Bacteria 424516
279 Ga0495604_0076640 3300047317 Bacteria 2515
280 Ga0495604_0080347 3300047317 Bacteria 2443
281 Ga0495604_0158817 3300047317 Bacteria 1599
282 Ga0495674_0000014 3300047319 Bacteria 241211
283 Ga0495674_0044058 3300047319 Bacteria 3968
284 Ga0495674_0076876 3300047319 Bacteria 2871
285 Ga0495674_0130098 3300047319 Bacteria 2121
286 Ga0495674_0186816 3300047319 Bacteria 1724
287 Ga0495672_0021489 3300047320 Bacteria 4209
288 Ga0495672_0048737 3300047320 Bacteria 2511
289 Ga0495680_0000580 3300047322 Bacteria 41033
290 Ga0495680_0026193 3300047322 Bacteria 4812
291 Ga0495675_0000573 3300047444 Bacteria 23696
292 Ga0495675_0112910 3300047444 Bacteria 1695
293 Ga0495684_0000390 3300047471 Bacteria 35768
294 Ga0495686_0000594 3300047472 Bacteria 50426
295 Ga0495593_0011849 3300047673 Bacteria 5000
296 Ga0495602_0000211 3300048088 Bacteria 54539
297 Ga0495602_0058791 3300048088 Bacteria 3363
298 Ga0495602_0060818 3300048088 Bacteria 3289
299 Ga0496100_0009346 3300048903 Bacteria 5508
300 Ga0496101_0002598 3300048904 Bacteria 11096
301 Ga0496101_0122380 3300048904 Bacteria 1968
302 Ga0496102_0005580 3300048905 Bacteria 10687
303 Ga0496102_0010961 3300048905 Bacteria 7810
304 Ga0496102_0045445 3300048905 Bacteria 3987
305 Ga0496103_0015561 3300048906 Bacteria 4530
306 Ga0496103_0032948 3300048906 Bacteria 3164
307 Ga0496104_0000351 3300048907 Bacteria 41200
308 Ga0496104_0088471 3300048907 Bacteria 2958
309 Ga0496105_0001783 3300048908 Bacteria 15381
310 Ga0496105_0003346 3300048908 Bacteria 11852
311 Ga0496105_0006479 3300048908 Bacteria 8999
312 Ga0496105_0130177 3300048908 Bacteria 2075
313 Ga0496106_0021558 3300048909 Bacteria 4784
314 Ga0496106_0064799 3300048909 Bacteria 2781
315 Ga0496106_0207405 3300048909 Bacteria 1560
316 Ga0496107_0027242 3300048910 Bacteria 4057
317 Ga0496108_0046305 3300048911 Bacteria 3633
318 Ga0496109_0000340 3300048912 Bacteria 43565
319 Ga0496109_0011906 3300048912 Bacteria 7488
320 Ga0496109_0092824 3300048912 Bacteria 2792
321 Ga0496110_0038863 3300048913 Bacteria 4142
322 Ga0496110_0179030 3300048913 Bacteria 1925
323 Ga0496111_0052113 3300048914 Bacteria 2954
324 Ga0496112_0001843 3300048915 Bacteria 16682
325 Ga0496112_0011291 3300048915 Bacteria 8148
326 Ga0496113_0004318 3300048916 Bacteria 8711
327 Ga0496113_0040569 3300048916 Bacteria 3430
328 Ga0496114_0016716 3300048917 Bacteria 5916
329 Ga0496115_0005904 3300048918 Bacteria 8925
330 Ga0496115_0013526 3300048918 Bacteria 6174
331 Ga0496121_0006722 3300048924 Bacteria 14118
332 Ga0501032_0002590 3300049569 Bacteria 14149
333 Ga0501032_0094891 3300049569 Bacteria 1978
334 Ga0501033_0002032 3300049570 Bacteria 17592
335 Ga0501033_0018516 3300049570 Bacteria 5262
336 Ga0501034_0005104 3300049571 Bacteria 14411
337 Ga0501034_0146901 3300049571 Bacteria 2335
338 Ga0501034_0158621 3300049571 Bacteria 2235
339 Ga0501036_0008366 3300049572 Bacteria 8478
340 Ga0501036_0015524 3300049572 Bacteria 6363
341 Ga0501036_0080770 3300049572 Bacteria 2748
342 Ga0501036_0185040 3300049572 Bacteria 1753
343 Ga0501037_0008103 3300049573 Bacteria 7698
344 Ga0501038_0005721 3300049574 Bacteria 11528
345 Ga0501038_0020771 3300049574 Bacteria 5902
346 Ga0501038_0057022 3300049574 Bacteria 3355
347 Ga0501038_0068575 3300049574 Bacteria 3014
348 Ga0501038_0269853 3300049574 Bacteria 1342
349 Ga0501039_0020110 3300049575 Bacteria 5118
350 Ga0501039_0068451 3300049575 Bacteria 2756
351 Ga0501040_0016063 3300049576 Bacteria 4951
352 Ga0501040_0030440 3300049576 Bacteria 3646
353 Ga0501040_0045848 3300049576 Bacteria 2983
354 Ga0501040_0090109 3300049576 Bacteria 2131
355 Ga0501040_0210263 3300049576 Bacteria 1383
356 Ga0501041_0005445 3300049577 Bacteria 7452
357 Ga0501042_0004874 3300049578 Bacteria 8581
358 Ga0501042_0007297 3300049578 Bacteria 7233
359 Ga0501042_0158260 3300049578 Bacteria 1634
360 Ga0501043_0009950 3300049579 Bacteria 7456
361 Ga0501043_0016232 3300049579 Bacteria 5841
362 Ga0501046_0029943 3300049580 Bacteria 4422
363 Ga0501046_0040889 3300049580 Bacteria 3702
364 Ga0501046_0075974 3300049580 Bacteria 2604
365 Ga0501046_0091361 3300049580 Bacteria 2342
366 Ga0501047_0012203 3300049581 Bacteria 8134
367 Ga0501047_0023529 3300049581 Bacteria 5912
368 Ga0501047_0052372 3300049581 Bacteria 3945
369 Ga0501047_0054538 3300049581 Bacteria 3866
370 Ga0501048_0016010 3300049582 Bacteria 5530
371 Ga0501048_0016091 3300049582 Bacteria 5515
372 Ga0501048_0027846 3300049582 Bacteria 4104
373 Ga0501048_0033466 3300049582 Bacteria 3713
374 Ga0501067_0022532 3300049583 Bacteria 3486
375 Ga0501067_0056196 3300049583 Bacteria 2181
376 Ga0501067_0103593 3300049583 Bacteria 1581
377 Ga0501068_0003107 3300049584 Bacteria 8871
378 Ga0501068_0009385 3300049584 Bacteria 5473
379 Ga0501069_0010067 3300049585 Bacteria 4999
380 Ga0501070_0021221 3300049586 Bacteria 5452
381 Ga0501070_0028747 3300049586 Bacteria 4661
382 Ga0501070_0035633 3300049586 Bacteria 4157
383 Ga0501071_0000281 3300049587 Bacteria 24250
384 Ga0501071_0245152 3300049587 Bacteria 1351
385 Ga0501072_0003765 3300049588 Bacteria 11453
386 Ga0501072_0003943 3300049588 Bacteria 11230
387 Ga0501072_0041485 3300049588 Bacteria 3615
388 Ga0501073_0022572 3300049589 Bacteria 4529
389 Ga0501073_0034945 3300049589 Bacteria 3574
390 Ga0501074_0020487 3300049590 Bacteria 4806
391 Ga0501074_0091371 3300049590 Bacteria 2180
392 Ga0501075_0003249 3300049591 Bacteria 10884
393 Ga0501076_0018424 3300049592 Bacteria 5323
394 Ga0501077_0003465 3300049593 Bacteria 9472
395 Ga0501077_0027254 3300049593 Bacteria 3628
396 Ga0501079_0011227 3300049741 Bacteria 6833
397 Ga0501079_0064322 3300049741 Bacteria 2829
398 Ga0501080_0001953 3300049742 Bacteria 17807
399 Ga0501080_0041567 3300049742 Bacteria 4283
400 Ga0501080_0054449 3300049742 Bacteria 3725
401 Ga0501080_0055392 3300049742 Bacteria 3693
402 Ga0501081_0012015 3300049743 Bacteria 5676
403 Ga0501081_0016250 3300049743 Bacteria 4919
404 Ga0501081_0092004 3300049743 Bacteria 2134
405 Ga0501083_0006236 3300049744 Bacteria 8459
406 Ga0501083_0012078 3300049744 Bacteria 6047
407 Ga0501083_0013372 3300049744 Bacteria 5737
408 Ga0501083_0140730 3300049744 Bacteria 1580
409 Ga0501035_0007827 3300049822 Bacteria 9987
410 Ga0501035_0058371 3300049822 Bacteria 3438
411 Ga0501044_0030859 3300049823 Bacteria 5644
412 Ga0501044_0038754 3300049823 Bacteria 4975
413 Ga0501044_0114871 3300049823 Bacteria 2697
414 Ga0501044_0162280 3300049823 Bacteria 2211
415 Ga0501045_0000893 3300049824 Bacteria 19395
416 nmdc:mga00v17_34852_c1 3300050491 Bacteria 2993
417 nmdc:mga00v17_6660_c1 3300050491 Bacteria 6135
418 nmdc:mga05p37_121859_c1 3300050507 Bacteria 3203
419 nmdc:mga05p37_145938_c1 3300050507 Bacteria 2898
420 nmdc:mga05p37_234781_c1 3300050507 Bacteria 2208
421 nmdc:mga05p37_44868_c1 3300050507 Bacteria 5438
422 nmdc:mga05p37_45816_c1 3300050507 Bacteria 5378
423 nmdc:mga09592_79857_c1 3300050508 Bacteria 2785
424 nmdc:mga08y16_120561_c1 3300050511 Bacteria 2729
425 nmdc:mga08y16_21013_c1 3300050511 Bacteria 6891
426 nmdc:mga08y16_26580_c1 3300050511 Bacteria 6101
427 nmdc:mga08y16_49765_c1 3300050511 Bacteria 4385
428 nmdc:mga08y16_6645_c1 3300050511 Bacteria 12132
429 nmdc:mga0n895_320536_c1 3300050512 Bacteria 1571
430 nmdc:mga0n895_36436_c1 3300050512 Bacteria 4750
431 nmdc:mga0n895_69893_c1 3300050512 Bacteria 3479
432 nmdc:mga0n895_702_c1 3300050512 Bacteria 23535
433 nmdc:mga0rr50_2586_c1 3300050513 Bacteria 10250
434 nmdc:mga08x19_12614_c1 3300050514 Bacteria 5096
435 nmdc:mga0a205_471_c1 3300050515 Bacteria 20085
436 Ga0495601_0000008 3300053077 Bacteria 362152
437 Ga0495601_0000549 3300053077 Bacteria 19855
438 Ga0495612_0000026 3300053078 Bacteria 111627
439 Ga0495595_0000096 3300053084 Bacteria 41512
440 Ga0495595_0045294 3300053084 Bacteria 2023
441 Ga0495619_0000033 3300053085 Bacteria 138925
442 Ga0495619_0002288 3300053085 Bacteria 12629
443 Ga0500578_0023005 3300053086 Bacteria 4003
444 Ga0500643_003082 3300053087 Bacteria 8191
445 Ga0500644_0000584 3300053088 Bacteria 13962
446 Ga0500651_0006148 3300053093 Bacteria 6895
447 Ga0500555_001552 3300053103 Bacteria 6952
448 Ga0500593_000206 3300053117 Bacteria 24090
449 Ga0500595_000010 3300053119 Bacteria 275806
450 Ga0500595_003087 3300053119 Bacteria 7900
451 Ga0500642_0000617 3300053130 Bacteria 10607
452 Ga0500642_0002225 3300053130 Bacteria 5654
453 Ga0500658_0041528 3300053134 Bacteria 1845
454 Ga0500568_0000001 3300053139 Bacteria 988705
455 Ga0500568_0000295 3300053139 Bacteria 40681
456 Ga0500577_0005391 3300053142 Bacteria 3443
457 Ga0500616_0000001 3300053153 Bacteria 1986011
458 Ga0500616_0001084 3300053153 Bacteria 28373
459 Ga0500645_000015 3300053730 Bacteria 150140
460 Ga0501084_0001270 3300054114 Bacteria 19890
461 Ga0501084_0009647 3300054114 Bacteria 7986
462 Ga0501084_0010604 3300054114 Bacteria 7625
463 Ga0501084_0012071 3300054114 Bacteria 7155
464 Ga0501084_0041587 3300054114 Bacteria 3845
465 Ga0501082_0000013 3300060353 Bacteria 119623
466 Ga0501082_0009289 3300060353 Bacteria 8476
467 Ga0501082_0016557 3300060353 Bacteria 6347
468 Ga0501082_0049899 3300060353 Bacteria 3608
469 Ga0530510_0004776 3300061734 Bacteria 9381
470 Ga0530510_0054627 3300061734 Bacteria 2886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0252360 Ga0495628_0252360_156_1304 353
2 3300047444 Ga0495675_0112910 Ga0495675_0112910_447_1685 356
3 3300049574 Ga0501038_0269853 Ga0501038_0269853_60_1322 365
4 3300046455 Ga0495603_0100439 Ga0495603_0100439_304_1500 369
5 3300049580 Ga0501046_0091361 Ga0501046_0091361_1007_2329 375
6 3300049576 Ga0501040_0016063 Ga0501040_0016063_351_1613 391
7 3300049590 Ga0501074_0091371 Ga0501074_0091371_713_1975 391
8 3300049743 Ga0501081_0012015 Ga0501081_0012015_942_2204 391
9 3300014326 Ga0157380_10129727 Ga0157380_101297272 392
10 3300005614 Ga0068856_100118286 Ga0068856_1001182863 397
11 3300005843 Ga0068860_100135925 Ga0068860_1001359252 397
12 3300006914 Ga0075436_100001269 Ga0075436_10000126916 397
13 3300007076 Ga0075435_100002439 Ga0075435_10000243913 397
14 3300047320 Ga0495672_0048737 Ga0495672_0048737_202_1485 397
15 3300050511 nmdc:mga08y16_26580_c1 nmdc:mga08y16_26580_c1_3959_5314 397
16 3300050513 nmdc:mga0rr50_2586_c1 nmdc:mga0rr50_2586_c1_7154_8509 397
17 3300050514 nmdc:mga08x19_12614_c1 nmdc:mga08x19_12614_c1_3785_5065 397
18 3300005456 Ga0070678_100200102 Ga0070678_1002001022 398
19 3300026121 Ga0207683_10041191 Ga0207683_100411915 398
20 3300035116 Ga0373945_0029881 Ga0373945_0029881_28_1314 399
21 3300049576 Ga0501040_0210263 Ga0501040_0210263_75_1364 400
22 3300049587 Ga0501071_0245152 Ga0501071_0245152_26_1315 400
23 3300036401 Ga0373937_0027771 Ga0373937_0027771_3472_4851 401
24 3300046462 Ga0495651_0105194 Ga0495651_0105194_205_1584 401
25 3300047317 Ga0495604_0080347 Ga0495604_0080347_766_2145 401
26 3300047319 Ga0495674_0044058 Ga0495674_0044058_2233_3612 401
27 3300047322 Ga0495680_0026193 Ga0495680_0026193_1943_3322 401
28 3300048088 Ga0495602_0060818 Ga0495602_0060818_1460_2839 401
29 3300053077 Ga0495601_0000549 Ga0495601_0000549_2537_3916 401
30 3300053084 Ga0495595_0045294 Ga0495595_0045294_251_1630 401
31 3300053085 Ga0495619_0002288 Ga0495619_0002288_6338_7717 401
32 3300009147 Ga0114129_10071734 Ga0114129_100717342 402
33 3300036712 Ga0316584_0018811 Ga0316584_0018811_1073_2455 402
34 3300050507 nmdc:mga05p37_145938_c1 nmdc:mga05p37_145938_c1_1088_2461 402
35 3300049572 Ga0501036_0185040 Ga0501036_0185040_285_1679 404
36 3300035691 Ga0373931_0011661 Ga0373931_0011661_760_2151 409
37 3300049574 Ga0501038_0068575 Ga0501038_0068575_824_2230 409
38 3300049581 Ga0501047_0023529 Ga0501047_0023529_2150_3556 409
39 3300049586 Ga0501070_0028747 Ga0501070_0028747_1168_2574 409
40 3300049823 Ga0501044_0030859 Ga0501044_0030859_1249_2655 409
41 3300006871 Ga0075434_100001146 Ga0075434_10000114613 410
42 3300009094 Ga0111539_10034808 Ga0111539_100348085 410
43 3300050512 nmdc:mga0n895_702_c1 nmdc:mga0n895_702_c1_5489_6844 410
44 3300050515 nmdc:mga0a205_471_c1 nmdc:mga0a205_471_c1_13011_14366 410
45 3300005445 Ga0070708_100000142 Ga0070708_1000001422 413
46 3300005536 Ga0070697_100126423 Ga0070697_1001264232 415
47 3300049743 Ga0501081_0092004 Ga0501081_0092004_683_2017 415
48 3300050507 nmdc:mga05p37_121859_c1 nmdc:mga05p37_121859_c1_789_2150 415
49 3300050512 nmdc:mga0n895_320536_c1 nmdc:mga0n895_320536_c1_60_1421 415
50 3300061734 Ga0530510_0054627 Ga0530510_0054627_323_1657 415
51 3300047319 Ga0495674_0186816 Ga0495674_0186816_234_1631 416
52 3300050512 nmdc:mga0n895_36436_c1 nmdc:mga0n895_36436_c1_1743_3095 417
53 3300006871 Ga0075434_100178921 Ga0075434_1001789212 418
54 3300035170 Ga0373943_0044190 Ga0373943_0044190_128_1471 418
55 3300035172 Ga0373955_0005711 Ga0373955_0005711_3690_5033 418
56 3300047317 Ga0495604_0158817 Ga0495604_0158817_57_1400 418
57 iso_pu_bacteria 2841911363 2841914623 418
58 iso_pu_bacteria 2841917233 2841920212 418
59 3300005985 Ga0081539_10002229 Ga0081539_1000222914 419
60 3300005545 Ga0070695_100024759 Ga0070695_1000247592 420
61 3300006871 Ga0075434_100001081 Ga0075434_10000108116 420
62 3300009094 Ga0111539_10021144 Ga0111539_100211443 420
63 3300036401 Ga0373937_0255958 Ga0373937_0255958_113_1486 420
64 3300046476 Ga0495662_0011334 Ga0495662_0011334_1786_3135 420
65 3300046517 Ga0495630_0003645 Ga0495630_0003645_7763_9112 420
66 3300046533 Ga0495640_0015825 Ga0495640_0015825_760_2109 420
67 3300046559 Ga0495667_0131065 Ga0495667_0131065_206_1579 420
68 3300047317 Ga0495604_0076640 Ga0495604_0076640_760_2133 420
69 3300047319 Ga0495674_0076876 Ga0495674_0076876_735_2084 420
70 3300048088 Ga0495602_0058791 Ga0495602_0058791_1524_2897 420
71 3300050512 nmdc:mga0n895_69893_c1 nmdc:mga0n895_69893_c1_1597_2970 420
72 iso_pu_bacteria 2839993093 2839997694 420
73 3300007265 Ga0099794_10001312 Ga0099794_100013127 421
74 3300037068 Ga0373925_0132563 Ga0373925_0132563_214_1587 421
75 3300049576 Ga0501040_0030440 Ga0501040_0030440_739_2091 421
76 3300049582 Ga0501048_0027846 Ga0501048_0027846_2014_3366 421
77 iso_pu_bacteria 2510917026 2511169152 421
78 iso_pu_bacteria 2599185236 2599717848 421
79 iso_pu_bacteria 2765235802 2765466666 421
80 iso_pu_bacteria 2840764183 2840765973 421
81 iso_pu_bacteria 2894652903 2894657117 421
82 iso_pu_bacteria 2904578770 2904581822 421
83 iso_pu_bacteria 2919119836 2919123490 421
84 iso_pu_bacteria 3005409236 3005413870 421
85 3300005436 Ga0070713_100058585 Ga0070713_1000585852 422
86 3300005468 Ga0070707_100068960 Ga0070707_1000689602 422
87 3300005518 Ga0070699_100169789 Ga0070699_1001697891 422
88 3300005536 Ga0070697_100220492 Ga0070697_1002204921 422
89 3300006847 Ga0075431_100178090 Ga0075431_1001780902 422
90 3300006852 Ga0075433_10016463 Ga0075433_100164633 422
91 3300025910 Ga0207684_10012097 Ga0207684_100120974 422
92 3300025922 Ga0207646_10119708 Ga0207646_101197082 422
93 3300025928 Ga0207700_10064369 Ga0207700_100643693 422
94 3300027907 Ga0207428_10122313 Ga0207428_101223132 422
95 3300039438 Ga0436360_0540813 Ga0436360_0540813_425_1798 422
96 3300039447 Ga0436361_0468034 Ga0436361_0468034_249_1622 422
97 3300050507 nmdc:mga05p37_44868_c1 nmdc:mga05p37_44868_c1_1588_2946 422
98 iso_pu_bacteria 8001845381 8001849558 422
99 3300006038 Ga0075365_10008563 Ga0075365_100085633 423
100 3300006042 Ga0075368_10022279 Ga0075368_100222792 423
101 3300025986 Ga0207658_10106840 Ga0207658_101068402 423
102 3300050491 nmdc:mga00v17_6660_c1 nmdc:mga00v17_6660_c1_4448_5812 423
103 3300060353 Ga0501082_0000013 Ga0501082_0000013_84045_85403 423
104 3300005618 Ga0068864_100147420 Ga0068864_1001474202 424
105 3300031456 Ga0307513_10058302 Ga0307513_100583023 424
106 3300049588 Ga0501072_0003943 Ga0501072_0003943_1443_2804 424
107 3300003775 Ga0055524_1003148 Ga0055524_10031486 425
108 3300003790 Ga0055528_1000721 Ga0055528_10007219 425
109 3300005981 Ga0081538_10007242 Ga0081538_100072422 425
110 3300006847 Ga0075431_100000995 Ga0075431_10000099524 425
111 3300025273 Ga0209673_1000138 Ga0209673_100013881 425
112 3300025294 Ga0209025_1006066 Ga0209025_10060663 425
113 3300025295 Ga0209564_1022721 Ga0209564_10227211 425
114 3300025299 Ga0209256_1003268 Ga0209256_10032682 425
115 3300049574 Ga0501038_0020771 Ga0501038_0020771_2693_4069 425
116 3300049575 Ga0501039_0020110 Ga0501039_0020110_2158_3534 425
117 3300049576 Ga0501040_0045848 Ga0501040_0045848_1430_2806 425
118 3300049577 Ga0501041_0005445 Ga0501041_0005445_1670_3046 425
119 3300049578 Ga0501042_0007297 Ga0501042_0007297_5168_6544 425
120 3300049580 Ga0501046_0075974 Ga0501046_0075974_329_1705 425
121 3300049582 Ga0501048_0016091 Ga0501048_0016091_2756_4132 425
122 3300049587 Ga0501071_0000281 Ga0501071_0000281_18811_20187 425
123 3300049588 Ga0501072_0003765 Ga0501072_0003765_7275_8651 425
124 3300049591 Ga0501075_0003249 Ga0501075_0003249_479_1855 425
125 3300049593 Ga0501077_0003465 Ga0501077_0003465_1399_2775 425
126 3300049742 Ga0501080_0041567 Ga0501080_0041567_318_1694 425
127 3300049743 Ga0501081_0016250 Ga0501081_0016250_1178_2551 425
128 3300049822 Ga0501035_0007827 Ga0501035_0007827_577_1953 425
129 3300053142 Ga0500577_0005391 Ga0500577_0005391_741_2117 425
130 3300054114 Ga0501084_0012071 Ga0501084_0012071_2741_4117 425
131 3300061734 Ga0530510_0004776 Ga0530510_0004776_3047_4423 425
132 iso_pu_bacteria 2852387548 2852394846 425
133 iso_pu_bacteria 8057575449 8057576177 425
134 3300053103 Ga0500555_001552 Ga0500555_001552_243_1622 426
135 3300053119 Ga0500595_003087 Ga0500595_003087_163_1542 426
136 3300053130 Ga0500642_0000617 Ga0500642_0000617_5623_7002 426
137 3300053130 Ga0500642_0002225 Ga0500642_0002225_1756_3135 426
138 3300053134 Ga0500658_0041528 Ga0500658_0041528_162_1541 426
139 3300006871 Ga0075434_100046319 Ga0075434_1000463194 427
140 3300006914 Ga0075436_100004460 Ga0075436_1000044609 427
141 3300049570 Ga0501033_0018516 Ga0501033_0018516_3188_4594 427
142 3300049572 Ga0501036_0015524 Ga0501036_0015524_2049_3419 427
143 3300049576 Ga0501040_0090109 Ga0501040_0090109_461_1831 427
144 3300049582 Ga0501048_0016010 Ga0501048_0016010_3946_5316 427
145 3300049586 Ga0501070_0021221 Ga0501070_0021221_4026_5405 427
146 3300049741 Ga0501079_0011227 Ga0501079_0011227_2951_4321 427
147 3300049824 Ga0501045_0000893 Ga0501045_0000893_6223_7593 427
148 3300053086 Ga0500578_0023005 Ga0500578_0023005_1154_2533 427
149 3300054114 Ga0501084_0009647 Ga0501084_0009647_3867_5237 427
150 3300005330 Ga0070690_100019427 Ga0070690_1000194273 428
151 3300005330 Ga0070690_100025142 Ga0070690_1000251422 428
152 3300005331 Ga0070670_100125149 Ga0070670_1001251491 428
153 3300005331 Ga0070670_100171971 Ga0070670_1001719712 428
154 3300005334 Ga0068869_100028381 Ga0068869_1000283812 428
155 3300005338 Ga0068868_100036161 Ga0068868_1000361612 428
156 3300005340 Ga0070689_100022884 Ga0070689_1000228841 428
157 3300005341 Ga0070691_10001323 Ga0070691_100013238 428
158 3300005343 Ga0070687_100056927 Ga0070687_1000569272 428
159 3300005345 Ga0070692_10048226 Ga0070692_100482262 428
160 3300005347 Ga0070668_100084123 Ga0070668_1000841232 428
161 3300005353 Ga0070669_100070123 Ga0070669_1000701232 428
162 3300005354 Ga0070675_100046883 Ga0070675_1000468833 428
163 3300005365 Ga0070688_100018515 Ga0070688_1000185153 428
164 3300005366 Ga0070659_100077319 Ga0070659_1000773192 428
165 3300005435 Ga0070714_100010606 Ga0070714_1000106063 428
166 3300005438 Ga0070701_10061068 Ga0070701_100610682 428
167 3300005439 Ga0070711_100013485 Ga0070711_1000134854 428
168 3300005440 Ga0070705_100002136 Ga0070705_1000021362 428
169 3300005441 Ga0070700_100013806 Ga0070700_1000138063 428
170 3300005444 Ga0070694_100006148 Ga0070694_1000061482 428
171 3300005455 Ga0070663_100051932 Ga0070663_1000519323 428
172 3300005456 Ga0070678_100032389 Ga0070678_1000323893 428
173 3300005466 Ga0070685_10118106 Ga0070685_101181061 428
174 3300005467 Ga0070706_100108083 Ga0070706_1001080832 428
175 3300005518 Ga0070699_100003531 Ga0070699_1000035318 428
176 3300005518 Ga0070699_100005255 Ga0070699_10000525510 428
177 3300005530 Ga0070679_100081126 Ga0070679_1000811262 428
178 3300005530 Ga0070679_100122432 Ga0070679_1001224321 428
179 3300005536 Ga0070697_100007169 Ga0070697_1000071696 428
180 3300005539 Ga0068853_100058533 Ga0068853_1000585333 428
181 3300005543 Ga0070672_100087235 Ga0070672_1000872352 428
182 3300005545 Ga0070695_100005494 Ga0070695_1000054945 428
183 3300005546 Ga0070696_100004630 Ga0070696_1000046307 428
184 3300005548 Ga0070665_100141860 Ga0070665_1001418602 428
185 3300005549 Ga0070704_100062326 Ga0070704_1000623261 428
186 3300005563 Ga0068855_100008088 Ga0068855_1000080887 428
187 3300005563 Ga0068855_100013438 Ga0068855_1000134384 428
188 3300005577 Ga0068857_100003412 Ga0068857_1000034122 428
189 3300005614 Ga0068856_100052668 Ga0068856_1000526682 428
190 3300005615 Ga0070702_100009081 Ga0070702_1000090814 428
191 3300005616 Ga0068852_100008649 Ga0068852_1000086495 428
192 3300005617 Ga0068859_100031478 Ga0068859_1000314783 428
193 3300005617 Ga0068859_100031649 Ga0068859_1000316493 428
194 3300005618 Ga0068864_100049926 Ga0068864_1000499262 428
195 3300005718 Ga0068866_10013844 Ga0068866_100138443 428
196 3300005840 Ga0068870_10021984 Ga0068870_100219841 428
197 3300005841 Ga0068863_100021511 Ga0068863_1000215113 428
198 3300005844 Ga0068862_100021766 Ga0068862_1000217662 428
199 3300005844 Ga0068862_100024885 Ga0068862_1000248853 428
200 3300005937 Ga0081455_10015313 Ga0081455_100153133 428
201 3300005937 Ga0081455_10029876 Ga0081455_100298764 428
202 3300005983 Ga0081540_1019281 Ga0081540_10192813 428
203 3300006038 Ga0075365_10061537 Ga0075365_100615371 428
204 3300006163 Ga0070715_10011087 Ga0070715_100110873 428
205 3300006163 Ga0070715_10051940 Ga0070715_100519402 428
206 3300006173 Ga0070716_100008399 Ga0070716_1000083993 428
207 3300006358 Ga0068871_100063366 Ga0068871_1000633662 428
208 3300006844 Ga0075428_100078334 Ga0075428_1000783342 428
209 3300006846 Ga0075430_100015121 Ga0075430_1000151211 428
210 3300006871 Ga0075434_100170356 Ga0075434_1001703562 428
211 3300006931 Ga0097620_100031478 Ga0097620_1000314783 428
212 3300006931 Ga0097620_100031650 Ga0097620_1000316503 428
213 3300009094 Ga0111539_10004506 Ga0111539_100045066 428
214 3300009094 Ga0111539_10149980 Ga0111539_101499803 428
215 3300009101 Ga0105247_10024302 Ga0105247_100243023 428
216 3300009147 Ga0114129_10013551 Ga0114129_100135518 428
217 3300009147 Ga0114129_10045213 Ga0114129_100452133 428
218 3300009148 Ga0105243_10008030 Ga0105243_100080302 428
219 3300009545 Ga0105237_10047966 Ga0105237_100479663 428
220 3300009551 Ga0105238_10332295 Ga0105238_103322952 428
221 3300009553 Ga0105249_10063681 Ga0105249_100636812 428
222 3300009553 Ga0105249_10075583 Ga0105249_100755832 428
223 3300013308 Ga0157375_10046974 Ga0157375_100469742 428
224 3300014325 Ga0163163_10039234 Ga0163163_100392343 428
225 3300014326 Ga0157380_10030383 Ga0157380_100303832 428
226 3300014968 Ga0157379_10038294 Ga0157379_100382942 428
227 3300025885 Ga0207653_10000916 Ga0207653_100009162 428
228 3300025899 Ga0207642_10003570 Ga0207642_100035703 428
229 3300025900 Ga0207710_10009678 Ga0207710_100096782 428
230 3300025901 Ga0207688_10000135 Ga0207688_100001358 428
231 3300025904 Ga0207647_10010263 Ga0207647_100102633 428
232 3300025906 Ga0207699_10079653 Ga0207699_100796532 428
233 3300025907 Ga0207645_10030498 Ga0207645_100304982 428
234 3300025908 Ga0207643_10004358 Ga0207643_100043584 428
235 3300025914 Ga0207671_10146441 Ga0207671_101464412 428
236 3300025916 Ga0207663_10062138 Ga0207663_100621382 428
237 3300025917 Ga0207660_10036111 Ga0207660_100361112 428
238 3300025918 Ga0207662_10118737 Ga0207662_101187372 428
239 3300025919 Ga0207657_10073794 Ga0207657_100737941 428
240 3300025920 Ga0207649_10099177 Ga0207649_100991772 428
241 3300025924 Ga0207694_10032128 Ga0207694_100321282 428
242 3300025925 Ga0207650_10008691 Ga0207650_100086915 428
243 3300025925 Ga0207650_10107676 Ga0207650_101076762 428
244 3300025926 Ga0207659_10026827 Ga0207659_100268273 428
245 3300025928 Ga0207700_10004698 Ga0207700_100046983 428
246 3300025932 Ga0207690_10134090 Ga0207690_101340901 428
247 3300025933 Ga0207706_10044820 Ga0207706_100448203 428
248 3300025935 Ga0207709_10033321 Ga0207709_100333213 428
249 3300025936 Ga0207670_10007206 Ga0207670_100072064 428
250 3300025938 Ga0207704_10009950 Ga0207704_100099502 428
251 3300025939 Ga0207665_10006915 Ga0207665_100069153 428
252 3300025940 Ga0207691_10018822 Ga0207691_100188224 428
253 3300025942 Ga0207689_10011802 Ga0207689_100118023 428
254 3300025944 Ga0207661_10128409 Ga0207661_101284092 428
255 3300025945 Ga0207679_10038841 Ga0207679_100388411 428
256 3300025949 Ga0207667_10058895 Ga0207667_100588952 428
257 3300025961 Ga0207712_10009027 Ga0207712_100090272 428
258 3300026023 Ga0207677_10014112 Ga0207677_100141121 428
259 3300026035 Ga0207703_10017422 Ga0207703_100174223 428
260 3300026067 Ga0207678_10001748 Ga0207678_100017489 428
261 3300026067 Ga0207678_10045581 Ga0207678_100455812 428
262 3300026075 Ga0207708_10000891 Ga0207708_1000089110 428
263 3300026075 Ga0207708_10023443 Ga0207708_100234433 428
264 3300026078 Ga0207702_10085537 Ga0207702_100855373 428
265 3300026088 Ga0207641_10100254 Ga0207641_101002541 428
266 3300026095 Ga0207676_10020054 Ga0207676_100200544 428
267 3300026095 Ga0207676_10059460 Ga0207676_100594602 428
268 3300026116 Ga0207674_10002799 Ga0207674_100027992 428
269 3300026118 Ga0207675_100007361 Ga0207675_1000073612 428
270 3300026121 Ga0207683_10007749 Ga0207683_100077494 428
271 3300026142 Ga0207698_10051289 Ga0207698_100512892 428
272 3300027907 Ga0207428_10008432 Ga0207428_100084324 428
273 3300028379 Ga0268266_10070933 Ga0268266_100709332 428
274 3300028380 Ga0268265_10008198 Ga0268265_100081985 428
275 3300028380 Ga0268265_10039041 Ga0268265_100390412 428
276 3300028381 Ga0268264_10001838 Ga0268264_100018382 428
277 3300028381 Ga0268264_10104167 Ga0268264_101041672 428
278 3300028556 Ga0265337_1000691 Ga0265337_10006913 428
279 3300028573 Ga0265334_10002246 Ga0265334_100022466 428
280 3300028800 Ga0265338_10029750 Ga0265338_100297504 428
281 3300031711 Ga0265314_10001634 Ga0265314_1000163411 428
282 3300031712 Ga0265342_10001205 Ga0265342_100012056 428
283 3300035089 Ga0373944_0003925 Ga0373944_0003925_1004_2377 428
284 3300035111 Ga0373923_0000267 Ga0373923_0000267_7878_9251 428
285 3300035118 Ga0373954_0006992 Ga0373954_0006992_1622_2995 428
286 3300035119 Ga0373956_0023510 Ga0373956_0023510_36_1409 428
287 3300035170 Ga0373943_0005794 Ga0373943_0005794_190_1563 428
288 3300035171 Ga0373946_0047892 Ga0373946_0047892_121_1494 428
289 3300035172 Ga0373955_0000191 Ga0373955_0000191_1544_2917 428
290 3300035410 Ga0373924_0000239 Ga0373924_0000239_88_1461 428
291 3300035692 Ga0373935_0004920 Ga0373935_0004920_4690_6063 428
292 3300035692 Ga0373935_0024476 Ga0373935_0024476_34_1407 428
293 3300035695 Ga0373927_0012591 Ga0373927_0012591_4009_5382 428
294 3300035695 Ga0373927_0013334 Ga0373927_0013334_138_1511 428
295 3300035695 Ga0373927_0030641 Ga0373927_0030641_1568_2941 428
296 3300035695 Ga0373927_0037033 Ga0373927_0037033_491_1864 428
297 3300035695 Ga0373927_0062775 Ga0373927_0062775_366_1739 428
298 3300035724 Ga0373933_0002903 Ga0373933_0002903_7152_8525 428
299 3300035725 Ga0373947_0019274 Ga0373947_0019274_425_1798 428
300 3300035725 Ga0373947_0069935 Ga0373947_0069935_598_1971 428
301 3300035725 Ga0373947_0154873 Ga0373947_0154873_40_1413 428
302 3300036401 Ga0373937_0000030 Ga0373937_0000030_86300_87673 428
303 3300037068 Ga0373925_0000501 Ga0373925_0000501_20062_21435 428
304 3300037068 Ga0373925_0060415 Ga0373925_0060415_460_1833 428
305 3300037068 Ga0373925_0093388 Ga0373925_0093388_907_2280 428
306 3300046454 Ga0495592_0000046 Ga0495592_0000046_14246_15619 428
307 3300046459 Ga0495629_0016126 Ga0495629_0016126_1863_3236 428
308 3300046462 Ga0495651_0029859 Ga0495651_0029859_1970_3343 428
309 3300046463 Ga0495653_0000036 Ga0495653_0000036_108384_109757 428
310 3300046472 Ga0495580_0035408 Ga0495580_0035408_431_1804 428
311 3300046473 Ga0495582_0022666 Ga0495582_0022666_785_2158 428
312 3300046476 Ga0495662_0032042 Ga0495662_0032042_768_2141 428
313 3300046476 Ga0495662_0069301 Ga0495662_0069301_128_1501 428
314 3300046477 Ga0495664_0000002 Ga0495664_0000002_14283_15656 428
315 3300046492 Ga0495585_0013074 Ga0495585_0013074_1687_3060 428
316 3300046499 Ga0495594_0021861 Ga0495594_0021861_1154_2527 428
317 3300046501 Ga0495607_0090464 Ga0495607_0090464_53_1426 428
318 3300046507 Ga0495606_0016858 Ga0495606_0016858_794_2173 428
319 3300046511 Ga0495608_0000006 Ga0495608_0000006_198890_200263 428
320 3300046514 Ga0495618_0000034 Ga0495618_0000034_31462_32835 428
321 3300046516 Ga0495628_0000077 Ga0495628_0000077_55729_57102 428
322 3300046517 Ga0495630_0000516 Ga0495630_0000516_12956_14329 428
323 3300046523 Ga0495644_0026632 Ga0495644_0026632_273_1646 428
324 3300046529 Ga0495652_0000824 Ga0495652_0000824_20102_21475 428
325 3300046531 Ga0495665_0004116 Ga0495665_0004116_2687_4078 428
326 3300046533 Ga0495640_0000007 Ga0495640_0000007_146592_147965 428
327 3300046533 Ga0495640_0036579 Ga0495640_0036579_1906_3279 428
328 3300046536 Ga0495587_0001165 Ga0495587_0001165_1692_3065 428
329 3300046537 Ga0495598_0000802 Ga0495598_0000802_1051_2424 428
330 3300046543 Ga0495645_0000116 Ga0495645_0000116_3097_4470 428
331 3300046559 Ga0495667_0000129 Ga0495667_0000129_20026_21399 428
332 3300046615 Ga0495656_0044183 Ga0495656_0044183_379_1752 428
333 3300046642 Ga0495634_0001134 Ga0495634_0001134_18356_19729 428
334 3300046663 Ga0495635_0000021 Ga0495635_0000021_124092_125465 428
335 3300046664 Ga0495659_0040961 Ga0495659_0040961_147_1520 428
336 3300046675 Ga0495657_0000521 Ga0495657_0000521_14322_15695 428
337 3300046678 Ga0495599_0000001 Ga0495599_0000001_117261_118634 428
338 3300046679 Ga0495623_0000237 Ga0495623_0000237_14237_15610 428
339 3300046680 Ga0495646_0000007 Ga0495646_0000007_118086_119459 428
340 3300046681 Ga0495647_0035555 Ga0495647_0035555_435_1808 428
341 3300046683 Ga0495658_0024071 Ga0495658_0024071_1781_3154 428
342 3300046683 Ga0495658_0033634 Ga0495658_0033634_1037_2410 428
343 3300046689 Ga0495613_0024619 Ga0495613_0024619_1474_2847 428
344 3300046690 Ga0495624_0036758 Ga0495624_0036758_575_1948 428
345 3300046809 Ga0495600_0000190 Ga0495600_0000190_20103_21476 428
346 3300047317 Ga0495604_0000005 Ga0495604_0000005_4312_5685 428
347 3300047319 Ga0495674_0000014 Ga0495674_0000014_20085_21458 428
348 3300047319 Ga0495674_0130098 Ga0495674_0130098_687_2060 428
349 3300047322 Ga0495680_0000580 Ga0495680_0000580_38759_40132 428
350 3300047444 Ga0495675_0000573 Ga0495675_0000573_20443_21816 428
351 3300047471 Ga0495684_0000390 Ga0495684_0000390_14318_15691 428
352 3300047472 Ga0495686_0000594 Ga0495686_0000594_14422_15801 428
353 3300047673 Ga0495593_0011849 Ga0495593_0011849_1870_3243 428
354 3300048088 Ga0495602_0000211 Ga0495602_0000211_14281_15654 428
355 3300048903 Ga0496100_0009346 Ga0496100_0009346_604_1977 428
356 3300048904 Ga0496101_0002598 Ga0496101_0002598_7561_8934 428
357 3300048904 Ga0496101_0122380 Ga0496101_0122380_407_1891 428
358 3300048905 Ga0496102_0005580 Ga0496102_0005580_1174_2658 428
359 3300048905 Ga0496102_0010961 Ga0496102_0010961_671_2044 428
360 3300048905 Ga0496102_0045445 Ga0496102_0045445_1198_2571 428
361 3300048906 Ga0496103_0015561 Ga0496103_0015561_2534_3907 428
362 3300048906 Ga0496103_0032948 Ga0496103_0032948_933_2306 428
363 3300048907 Ga0496104_0000351 Ga0496104_0000351_7905_9278 428
364 3300048907 Ga0496104_0088471 Ga0496104_0088471_757_2130 428
365 3300048908 Ga0496105_0001783 Ga0496105_0001783_12396_13769 428
366 3300048908 Ga0496105_0003346 Ga0496105_0003346_9400_10773 428
367 3300048908 Ga0496105_0006479 Ga0496105_0006479_812_2185 428
368 3300048908 Ga0496105_0130177 Ga0496105_0130177_236_1609 428
369 3300048909 Ga0496106_0021558 Ga0496106_0021558_2123_3496 428
370 3300048909 Ga0496106_0064799 Ga0496106_0064799_485_1858 428
371 3300048909 Ga0496106_0207405 Ga0496106_0207405_44_1528 428
372 3300048910 Ga0496107_0027242 Ga0496107_0027242_1268_2641 428
373 3300048911 Ga0496108_0046305 Ga0496108_0046305_659_2032 428
374 3300048912 Ga0496109_0000340 Ga0496109_0000340_42059_43432 428
375 3300048912 Ga0496109_0011906 Ga0496109_0011906_5287_6660 428
376 3300048912 Ga0496109_0092824 Ga0496109_0092824_774_2147 428
377 3300048913 Ga0496110_0038863 Ga0496110_0038863_1133_2506 428
378 3300048913 Ga0496110_0179030 Ga0496110_0179030_287_1660 428
379 3300048914 Ga0496111_0052113 Ga0496111_0052113_821_2194 428
380 3300048915 Ga0496112_0001843 Ga0496112_0001843_2201_3574 428
381 3300048915 Ga0496112_0011291 Ga0496112_0011291_3532_4905 428
382 3300048916 Ga0496113_0004318 Ga0496113_0004318_2179_3552 428
383 3300048916 Ga0496113_0040569 Ga0496113_0040569_1819_3192 428
384 3300048917 Ga0496114_0016716 Ga0496114_0016716_2147_3520 428
385 3300048918 Ga0496115_0005904 Ga0496115_0005904_2883_4256 428
386 3300048918 Ga0496115_0013526 Ga0496115_0013526_2684_4057 428
387 3300048924 Ga0496121_0006722 Ga0496121_0006722_8726_10105 428
388 3300049569 Ga0501032_0094891 Ga0501032_0094891_339_1712 428
389 3300049578 Ga0501042_0158260 Ga0501042_0158260_160_1536 428
390 3300049581 Ga0501047_0054538 Ga0501047_0054538_2237_3610 428
391 3300050491 nmdc:mga00v17_34852_c1 nmdc:mga00v17_34852_c1_1437_2810 428
392 3300050507 nmdc:mga05p37_234781_c1 nmdc:mga05p37_234781_c1_268_1656 428
393 3300050507 nmdc:mga05p37_45816_c1 nmdc:mga05p37_45816_c1_2310_3683 428
394 3300050508 nmdc:mga09592_79857_c1 nmdc:mga09592_79857_c1_1341_2714 428
395 3300050511 nmdc:mga08y16_120561_c1 nmdc:mga08y16_120561_c1_605_1978 428
396 3300050511 nmdc:mga08y16_49765_c1 nmdc:mga08y16_49765_c1_2343_3716 428
397 3300050511 nmdc:mga08y16_6645_c1 nmdc:mga08y16_6645_c1_679_2052 428
398 3300053077 Ga0495601_0000008 Ga0495601_0000008_342701_344074 428
399 3300053078 Ga0495612_0000026 Ga0495612_0000026_1885_3258 428
400 3300053084 Ga0495595_0000096 Ga0495595_0000096_38171_39544 428
401 3300053085 Ga0495619_0000033 Ga0495619_0000033_117454_118827 428
402 3300053087 Ga0500643_003082 Ga0500643_003082_6310_7686 428
403 3300053088 Ga0500644_0000584 Ga0500644_0000584_6525_7901 428
404 3300053093 Ga0500651_0006148 Ga0500651_0006148_5371_6747 428
405 3300053119 Ga0500595_000010 Ga0500595_000010_34915_36291 428
406 3300053153 Ga0500616_0000001 Ga0500616_0000001_784706_786082 428
407 3300053730 Ga0500645_000015 Ga0500645_000015_86752_88128 428
408 3300003354 JGI25160J50197_1000018 JGI25160J50197_1000018114 429
409 3300003374 JGI25161J50226_1000020 JGI25161J50226_1000020114 429
410 3300004625 Ga0055543_1000004 Ga0055543_1000004115 429
411 3300005262 Ga0065165_1000065 Ga0065165_1000065115 429
412 3300005985 Ga0081539_10000012 Ga0081539_10000012256 429
413 3300025284 Ga0209130_1000035 Ga0209130_1000035111 429
414 3300025302 Ga0207426_1000017 Ga0207426_1000017111 429
415 3300036401 Ga0373937_0015209 Ga0373937_0015209_4917_6317 429
416 3300046460 Ga0495638_0000238 Ga0495638_0000238_63706_65088 429
417 3300046507 Ga0495606_0033428 Ga0495606_0033428_1920_3299 429
418 3300047320 Ga0495672_0021489 Ga0495672_0021489_528_1910 429
419 3300049572 Ga0501036_0080770 Ga0501036_0080770_921_2297 429
420 3300049578 Ga0501042_0004874 Ga0501042_0004874_75_1454 429
421 3300049592 Ga0501076_0018424 Ga0501076_0018424_2713_4089 429
422 3300049593 Ga0501077_0027254 Ga0501077_0027254_947_2323 429
423 3300049741 Ga0501079_0064322 Ga0501079_0064322_1235_2611 429
424 3300049744 Ga0501083_0140730 Ga0501083_0140730_113_1489 429
425 3300050511 nmdc:mga08y16_21013_c1 nmdc:mga08y16_21013_c1_400_1794 429
426 3300053117 Ga0500593_000206 Ga0500593_000206_20822_22201 429
427 3300053139 Ga0500568_0000001 Ga0500568_0000001_769136_770512 429
428 3300053139 Ga0500568_0000295 Ga0500568_0000295_17757_19139 429
429 3300053153 Ga0500616_0001084 Ga0500616_0001084_12142_13524 429
430 3300054114 Ga0501084_0001270 Ga0501084_0001270_15364_16740 429
431 3300060353 Ga0501082_0016557 Ga0501082_0016557_3160_4536 429
432 3300003215 JGI25153J46596_10000010 JGI25153J46596_10000010165 430
433 3300005456 Ga0070678_100045899 Ga0070678_1000458991 430
434 3300025272 Ga0209455_1000494 Ga0209455_10004949 430
435 3300025297 Ga0209758_1000033 Ga0209758_1000033306 430
436 3300026121 Ga0207683_10044319 Ga0207683_100443193 430
437 3300031456 Ga0307513_10182493 Ga0307513_101824932 430
438 3300037312 Ga0395899_0000314 Ga0395899_0000314_34140_35540 430
439 3300037418 Ga0395900_0000408 Ga0395900_0000408_34139_35539 430
440 3300037466 Ga0395898_0000666 Ga0395898_0000666_34139_35539 430
441 3300037471 Ga0395905_0000392 Ga0395905_0000392_34139_35539 430
442 3300038443 Ga0395901_0000292 Ga0395901_0000292_26498_27898 430
443 3300049569 Ga0501032_0002590 Ga0501032_0002590_46_1425 430
444 3300049570 Ga0501033_0002032 Ga0501033_0002032_12852_14231 430
445 3300049571 Ga0501034_0005104 Ga0501034_0005104_3223_4602 430
446 3300049571 Ga0501034_0146901 Ga0501034_0146901_205_1590 430
447 3300049571 Ga0501034_0158621 Ga0501034_0158621_513_1892 430
448 3300049572 Ga0501036_0008366 Ga0501036_0008366_2547_3926 430
449 3300049573 Ga0501037_0008103 Ga0501037_0008103_1903_3282 430
450 3300049574 Ga0501038_0005721 Ga0501038_0005721_435_1814 430
451 3300049574 Ga0501038_0057022 Ga0501038_0057022_555_1934 430
452 3300049575 Ga0501039_0068451 Ga0501039_0068451_588_1967 430
453 3300049579 Ga0501043_0009950 Ga0501043_0009950_3878_5257 430
454 3300049579 Ga0501043_0016232 Ga0501043_0016232_461_1840 430
455 3300049580 Ga0501046_0029943 Ga0501046_0029943_1109_2488 430
456 3300049580 Ga0501046_0040889 Ga0501046_0040889_514_1893 430
457 3300049581 Ga0501047_0012203 Ga0501047_0012203_3580_4959 430
458 3300049581 Ga0501047_0052372 Ga0501047_0052372_2343_3722 430
459 3300049582 Ga0501048_0033466 Ga0501048_0033466_292_1671 430
460 3300049583 Ga0501067_0022532 Ga0501067_0022532_1914_3293 430
461 3300049583 Ga0501067_0056196 Ga0501067_0056196_666_2045 430
462 3300049583 Ga0501067_0103593 Ga0501067_0103593_136_1515 430
463 3300049584 Ga0501068_0003107 Ga0501068_0003107_5020_6399 430
464 3300049584 Ga0501068_0009385 Ga0501068_0009385_3234_4613 430
465 3300049585 Ga0501069_0010067 Ga0501069_0010067_1448_2827 430
466 3300049586 Ga0501070_0035633 Ga0501070_0035633_435_1814 430
467 3300049588 Ga0501072_0041485 Ga0501072_0041485_797_2176 430
468 3300049589 Ga0501073_0022572 Ga0501073_0022572_1373_2752 430
469 3300049589 Ga0501073_0034945 Ga0501073_0034945_261_1640 430
470 3300049590 Ga0501074_0020487 Ga0501074_0020487_1726_3105 430
471 3300049742 Ga0501080_0001953 Ga0501080_0001953_14229_15608 430
472 3300049742 Ga0501080_0054449 Ga0501080_0054449_1757_3136 430
473 3300049742 Ga0501080_0055392 Ga0501080_0055392_2257_3636 430
474 3300049744 Ga0501083_0006236 Ga0501083_0006236_4508_5887 430
475 3300049744 Ga0501083_0012078 Ga0501083_0012078_667_2046 430
476 3300049744 Ga0501083_0013372 Ga0501083_0013372_1277_2656 430
477 3300049822 Ga0501035_0058371 Ga0501035_0058371_436_1815 430
478 3300049823 Ga0501044_0038754 Ga0501044_0038754_2114_3493 430
479 3300049823 Ga0501044_0114871 Ga0501044_0114871_229_1608 430
480 3300049823 Ga0501044_0162280 Ga0501044_0162280_400_1779 430
481 3300054114 Ga0501084_0010604 Ga0501084_0010604_4167_5546 430
482 3300054114 Ga0501084_0041587 Ga0501084_0041587_1933_3312 430
483 3300060353 Ga0501082_0009289 Ga0501082_0009289_3248_4627 430
484 3300060353 Ga0501082_0049899 Ga0501082_0049899_1425_2804 430

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03972

MmgE_PrpD_N

MmgE/PrpD N-terminal domain

59

284

0.94

PF19305

MmgE_PrpD_C

MmgE/PrpD C-terminal domain

304

474

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7br9-assembly1.cif.gz_A crystal structure of mus musculus irg1 0.8739 9 429
2hp0-assembly1.cif.gz_A crystal structure of iminodisuccinate epimerase 0.8713 11 430
6r6t-assembly1.cif.gz_B crystal structure of mouse cis-aconitate decarboxylase 0.8554 9 430
7br9-assembly1.cif.gz_A crystal structure of mus musculus irg1 0.8547 9 429
6r6t-assembly1.cif.gz_A crystal structure of mouse cis-aconitate decarboxylase 0.8525 13 430
ID Description Score Start End Superfamily
af_O06582_313_451_3.30.1330.120 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD 0.8547 249 373 3.30.1330.120
af_O06582_36_312_1.10.4100.10 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.81 2 247 1.10.4100.10
af_A0A2R8RL39_271_404_1.10.4100.10 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.8059 246 377 1.10.4100.10
2hp0B02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD 0.7925 247 377 3.30.1330.120
af_A0A2R8RL39_271_404_1.10.4100.10 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.7892 246 377 1.10.4100.10
ID Description Score Start End GO Terms
AF-A0A524HYU7-F1-model_v4 MmgE/PrpD family protein 0.9851 9 158 GO:0016829
AF-A0A524HYU7-F1-model_v4 MmgE/PrpD family protein 0.9722 9 158 GO:0016829
AF-A0A6N7FD90-F1-model_v4 MmgE/PrpD family protein 0.9616 4 430 GO:0016829
AF-A0A538RBR5-F1-model_v4 MmgE/PrpD family protein 0.9552 5 429 GO:0016829
AF-A0A2E4HLG4-F1-model_v4 2-methylcitrate dehydratase 0.9535 7 430 GO:0016829

Feature Viewer

pLDDT pTM Quality
90.54 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map