F452896
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 484 | 293 | 484 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300005543|Ga0070672_100345177|Ga0070672_1003451771 |
| Length | 246 |
| Sequence | VSASGERPPAPALPRDGDAILITGTSRGIGLHLAQTFVARGWRVFGCARGAAAFQHERYSHDELDVADEDAVAGMFAGVRRSGASLYALINNAGTASMNHVLTTPSKTMSKLWQVNVLGTMLCCREAAKHMVLRRRGRIVNCGSVAVPWGLEGESVYTATKAAVEAYSRVLARDLGTYGVTVNTVSPNPVQTDLIAGVPVEKMDRLVRRQSIPRYGTVEDVLAVVDFFLAPESGFVTGQTVYIGGP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 153 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 168 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 169 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 170 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 171 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 172 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 173 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 175 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 206 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 207 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 208 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 260 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 261 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 268 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 269 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 270 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 272 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 273 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 275 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 277 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 278 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 287 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 288 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 289 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 290 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 291 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 293 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.38 |
| Metatranscriptomes | 0.62 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.21 |
| Nodule | 0 |
| Rhizoplane | 3.1 |
| Rhizosphere | 95.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10042651 | 3300003203 | Unclassified | 1586 |
| 2 | Ga0058863_11279205 | 3300004799 | Bacteria | 1701 |
| 3 | Ga0058862_12139172 | 3300004803 | Bacteria | 1072 |
| 4 | Ga0065712_10068442 | 3300005290 | Bacteria | 10619 |
| 5 | Ga0065715_10107665 | 3300005293 | Bacteria | 2759 |
| 6 | Ga0065715_10144629 | 3300005293 | Bacteria | 1800 |
| 7 | Ga0070676_10018880 | 3300005328 | Bacteria | 3828 |
| 8 | Ga0070676_10146018 | 3300005328 | Bacteria | 1510 |
| 9 | Ga0070676_10305377 | 3300005328 | Bacteria | 1080 |
| 10 | Ga0070676_10321164 | 3300005328 | Bacteria | 1056 |
| 11 | Ga0070690_100045614 | 3300005330 | Bacteria | 2785 |
| 12 | Ga0070690_100089349 | 3300005330 | Bacteria | 2026 |
| 13 | Ga0070690_100122298 | 3300005330 | Bacteria | 1748 |
| 14 | Ga0070690_100165364 | 3300005330 | Bacteria | 1519 |
| 15 | Ga0070677_10012150 | 3300005333 | Bacteria | 2984 |
| 16 | Ga0068869_100112556 | 3300005334 | Bacteria | 2072 |
| 17 | Ga0070666_10008482 | 3300005335 | Bacteria | 6384 |
| 18 | Ga0068868_100687425 | 3300005338 | Bacteria | 914 |
| 19 | Ga0070691_10003816 | 3300005341 | Bacteria | 6802 |
| 20 | Ga0070691_10047985 | 3300005341 | Bacteria | 2031 |
| 21 | Ga0070687_100257873 | 3300005343 | Bacteria | 1087 |
| 22 | Ga0070692_10069126 | 3300005345 | Bacteria | 1878 |
| 23 | Ga0070692_10070186 | 3300005345 | Bacteria | 1865 |
| 24 | Ga0070668_100400223 | 3300005347 | Bacteria | 1172 |
| 25 | Ga0070668_100719737 | 3300005347 | Bacteria | 881 |
| 26 | Ga0070669_100082607 | 3300005353 | Bacteria | 2395 |
| 27 | Ga0070669_100120583 | 3300005353 | Bacteria | 2000 |
| 28 | Ga0070675_100062563 | 3300005354 | Bacteria | 3075 |
| 29 | Ga0070674_100047740 | 3300005356 | Bacteria | 2936 |
| 30 | Ga0070674_100051551 | 3300005356 | Bacteria | 2836 |
| 31 | Ga0070673_100088915 | 3300005364 | Bacteria | 2520 |
| 32 | Ga0070673_100222441 | 3300005364 | Bacteria | 1634 |
| 33 | Ga0070659_100189682 | 3300005366 | Bacteria | 1689 |
| 34 | Ga0070667_100395530 | 3300005367 | Bacteria | 1257 |
| 35 | Ga0070703_10022989 | 3300005406 | Bacteria | 1833 |
| 36 | Ga0070703_10199039 | 3300005406 | Bacteria | 785 |
| 37 | Ga0070701_10015319 | 3300005438 | Bacteria | 3538 |
| 38 | Ga0070701_10065069 | 3300005438 | Bacteria | 1934 |
| 39 | Ga0070701_10093558 | 3300005438 | Bacteria | 1652 |
| 40 | Ga0070705_100014205 | 3300005440 | Bacteria | 4092 |
| 41 | Ga0070705_100023839 | 3300005440 | Bacteria | 3293 |
| 42 | Ga0070700_100003849 | 3300005441 | Bacteria | 7786 |
| 43 | Ga0070700_100010983 | 3300005441 | Bacteria | 5006 |
| 44 | Ga0070700_100380385 | 3300005441 | Bacteria | 1055 |
| 45 | Ga0070700_100385089 | 3300005441 | Bacteria | 1050 |
| 46 | Ga0070694_100012019 | 3300005444 | Bacteria | 5375 |
| 47 | Ga0070694_100019003 | 3300005444 | Bacteria | 4367 |
| 48 | Ga0070694_100288463 | 3300005444 | Bacteria | 1253 |
| 49 | Ga0070694_100456078 | 3300005444 | Bacteria | 1010 |
| 50 | Ga0070694_100471178 | 3300005444 | Unclassified | 995 |
| 51 | Ga0070708_100069835 | 3300005445 | Bacteria | 3159 |
| 52 | Ga0070708_100087132 | 3300005445 | Bacteria | 2837 |
| 53 | Ga0070663_100326003 | 3300005455 | Bacteria | 1236 |
| 54 | Ga0070678_100142431 | 3300005456 | Bacteria | 1920 |
| 55 | Ga0070662_100216097 | 3300005457 | Bacteria | 1528 |
| 56 | Ga0070662_100853376 | 3300005457 | Bacteria | 776 |
| 57 | Ga0068867_100011394 | 3300005459 | Bacteria | 6274 |
| 58 | Ga0068867_100020901 | 3300005459 | Bacteria | 4668 |
| 59 | Ga0068867_100145657 | 3300005459 | Bacteria | 1856 |
| 60 | Ga0070706_100035474 | 3300005467 | Unclassified | 4607 |
| 61 | Ga0070706_100041544 | 3300005467 | Bacteria | 4245 |
| 62 | Ga0070706_100322276 | 3300005467 | Bacteria | 1441 |
| 63 | Ga0070707_100025007 | 3300005468 | Bacteria | 5662 |
| 64 | Ga0070707_100050136 | 3300005468 | Bacteria | 4002 |
| 65 | Ga0070707_100106058 | 3300005468 | Bacteria | 2725 |
| 66 | Ga0070707_100309134 | 3300005468 | Bacteria | 1536 |
| 67 | Ga0070698_100022430 | 3300005471 | Bacteria | 6605 |
| 68 | Ga0070698_100049340 | 3300005471 | Bacteria | 4297 |
| 69 | Ga0070698_100151669 | 3300005471 | Bacteria | 2265 |
| 70 | Ga0070698_100197793 | 3300005471 | Bacteria | 1946 |
| 71 | Ga0070699_100026760 | 3300005518 | Bacteria | 4975 |
| 72 | Ga0070699_100164607 | 3300005518 | Bacteria | 1964 |
| 73 | Ga0070699_100179396 | 3300005518 | Bacteria | 1879 |
| 74 | Ga0070697_100075008 | 3300005536 | Bacteria | 2779 |
| 75 | Ga0070697_100266073 | 3300005536 | Bacteria | 1469 |
| 76 | Ga0068853_100027520 | 3300005539 | Unclassified | 4776 |
| 77 | Ga0068853_100193298 | 3300005539 | Bacteria | 1850 |
| 78 | Ga0070672_100345177 | 3300005543 | Bacteria | 1268 |
| 79 | Ga0070686_100004576 | 3300005544 | Bacteria | 7624 |
| 80 | Ga0070686_100069703 | 3300005544 | Bacteria | 2297 |
| 81 | Ga0070686_100476567 | 3300005544 | Bacteria | 964 |
| 82 | Ga0070695_100005719 | 3300005545 | Bacteria | 7328 |
| 83 | Ga0070695_100080549 | 3300005545 | Bacteria | 2152 |
| 84 | Ga0070695_100091982 | 3300005545 | Bacteria | 2027 |
| 85 | Ga0070695_100124119 | 3300005545 | Bacteria | 1771 |
| 86 | Ga0070696_100022736 | 3300005546 | Bacteria | 4261 |
| 87 | Ga0070665_100000250 | 3300005548 | Bacteria | 88981 |
| 88 | Ga0070665_100243219 | 3300005548 | Bacteria | 1800 |
| 89 | Ga0070704_100001599 | 3300005549 | Bacteria | 12249 |
| 90 | Ga0070704_100010004 | 3300005549 | Bacteria | 5760 |
| 91 | Ga0070704_100038979 | 3300005549 | Bacteria | 3259 |
| 92 | Ga0068855_100482026 | 3300005563 | Bacteria | 1350 |
| 93 | Ga0070664_100211058 | 3300005564 | Bacteria | 1735 |
| 94 | Ga0070664_100358213 | 3300005564 | Bacteria | 1328 |
| 95 | Ga0068857_100053587 | 3300005577 | Bacteria | 3579 |
| 96 | Ga0068854_100014890 | 3300005578 | Bacteria | 5135 |
| 97 | Ga0068854_100027326 | 3300005578 | Bacteria | 3932 |
| 98 | Ga0068854_100063964 | 3300005578 | Bacteria | 2672 |
| 99 | Ga0068854_100152646 | 3300005578 | Bacteria | 1782 |
| 100 | Ga0070702_100023196 | 3300005615 | Bacteria | 3294 |
| 101 | Ga0070702_100073108 | 3300005615 | Bacteria | 2030 |
| 102 | Ga0070702_100102053 | 3300005615 | Bacteria | 1762 |
| 103 | Ga0070702_100468424 | 3300005615 | Unclassified | 918 |
| 104 | Ga0068852_100036042 | 3300005616 | Bacteria | 4135 |
| 105 | Ga0068859_100052030 | 3300005617 | Bacteria | 4118 |
| 106 | Ga0068859_100230342 | 3300005617 | Bacteria | 1941 |
| 107 | Ga0068864_100026949 | 3300005618 | Bacteria | 4848 |
| 108 | Ga0068864_100229748 | 3300005618 | Bacteria | 1715 |
| 109 | Ga0068866_10081930 | 3300005718 | Bacteria | 1734 |
| 110 | Ga0068861_100000681 | 3300005719 | Bacteria | 20273 |
| 111 | Ga0068861_100010825 | 3300005719 | Bacteria | 6339 |
| 112 | Ga0068861_100108813 | 3300005719 | Bacteria | 2218 |
| 113 | Ga0068861_100657859 | 3300005719 | Bacteria | 969 |
| 114 | Ga0068851_10095208 | 3300005834 | Bacteria | 1573 |
| 115 | Ga0068870_10187760 | 3300005840 | Bacteria | 1245 |
| 116 | Ga0068863_100097390 | 3300005841 | Bacteria | 2793 |
| 117 | Ga0068863_100304864 | 3300005841 | Bacteria | 1545 |
| 118 | Ga0068858_100001359 | 3300005842 | Bacteria | 25178 |
| 119 | Ga0068858_100100913 | 3300005842 | Bacteria | 2691 |
| 120 | Ga0068860_100375085 | 3300005843 | Bacteria | 1404 |
| 121 | Ga0068860_100404440 | 3300005843 | Bacteria | 1351 |
| 122 | Ga0068860_100549455 | 3300005843 | Bacteria | 1157 |
| 123 | Ga0068862_100084219 | 3300005844 | Bacteria | 2762 |
| 124 | Ga0068862_100101767 | 3300005844 | Bacteria | 2514 |
| 125 | Ga0068862_100600240 | 3300005844 | Bacteria | 1057 |
| 126 | Ga0081455_10003195 | 3300005937 | Bacteria | 18992 |
| 127 | Ga0070716_100279813 | 3300006173 | Bacteria | 1151 |
| 128 | Ga0097621_100038475 | 3300006237 | Bacteria | 3839 |
| 129 | Ga0097621_100099906 | 3300006237 | Bacteria | 2440 |
| 130 | Ga0068871_100063542 | 3300006358 | Bacteria | 3020 |
| 131 | Ga0075428_100036815 | 3300006844 | Bacteria | 5388 |
| 132 | Ga0075428_100209263 | 3300006844 | Bacteria | 2108 |
| 133 | Ga0075428_100696606 | 3300006844 | Unclassified | 1082 |
| 134 | Ga0075431_100452997 | 3300006847 | Bacteria | 1279 |
| 135 | Ga0075431_100795550 | 3300006847 | Bacteria | 919 |
| 136 | Ga0075433_10050103 | 3300006852 | Bacteria | 3635 |
| 137 | Ga0075433_10077615 | 3300006852 | Unclassified | 2925 |
| 138 | Ga0075434_100005198 | 3300006871 | Bacteria | 11819 |
| 139 | Ga0075434_100057200 | 3300006871 | Bacteria | 3876 |
| 140 | Ga0075434_100164404 | 3300006871 | Bacteria | 2239 |
| 141 | Ga0075434_100233141 | 3300006871 | Bacteria | 1860 |
| 142 | Ga0075429_100296630 | 3300006880 | Unclassified | 1415 |
| 143 | Ga0068865_100044907 | 3300006881 | Bacteria | 3027 |
| 144 | Ga0068865_100168027 | 3300006881 | Bacteria | 1679 |
| 145 | Ga0075436_100041532 | 3300006914 | Bacteria | 3174 |
| 146 | Ga0075436_100094950 | 3300006914 | Bacteria | 2074 |
| 147 | Ga0075436_100171440 | 3300006914 | Bacteria | 1532 |
| 148 | Ga0075436_100279610 | 3300006914 | Bacteria | 1193 |
| 149 | Ga0097620_100052032 | 3300006931 | Bacteria | 4118 |
| 150 | Ga0097620_100230336 | 3300006931 | Bacteria | 1941 |
| 151 | Ga0075435_100000320 | 3300007076 | Bacteria | 29604 |
| 152 | Ga0075435_100001859 | 3300007076 | Bacteria | 13711 |
| 153 | Ga0075435_100022848 | 3300007076 | Bacteria | 4828 |
| 154 | Ga0075435_100475235 | 3300007076 | Bacteria | 1079 |
| 155 | Ga0105240_10217806 | 3300009093 | Bacteria | 2226 |
| 156 | Ga0105240_10231861 | 3300009093 | Bacteria | 2145 |
| 157 | Ga0105240_10319724 | 3300009093 | Bacteria | 1769 |
| 158 | Ga0105240_10435790 | 3300009093 | Bacteria | 1470 |
| 159 | Ga0111539_10006463 | 3300009094 | Bacteria | 15100 |
| 160 | Ga0111539_10118948 | 3300009094 | Bacteria | 3096 |
| 161 | Ga0111539_10434294 | 3300009094 | Bacteria | 1529 |
| 162 | Ga0111539_10801630 | 3300009094 | Bacteria | 1096 |
| 163 | Ga0105245_10069902 | 3300009098 | Bacteria | 3185 |
| 164 | Ga0105247_10002402 | 3300009101 | Bacteria | 12734 |
| 165 | Ga0105247_10082942 | 3300009101 | Bacteria | 2024 |
| 166 | Ga0114129_10003861 | 3300009147 | Bacteria | 21132 |
| 167 | Ga0114129_10049038 | 3300009147 | Bacteria | 5935 |
| 168 | Ga0114129_10105083 | 3300009147 | Bacteria | 3903 |
| 169 | Ga0114129_10353990 | 3300009147 | Bacteria | 1944 |
| 170 | Ga0114129_10764707 | 3300009147 | Bacteria | 1235 |
| 171 | Ga0114129_10948740 | 3300009147 | Bacteria | 1087 |
| 172 | Ga0105243_10023603 | 3300009148 | Bacteria | 4686 |
| 173 | Ga0105243_10023827 | 3300009148 | Bacteria | 4664 |
| 174 | Ga0105243_10321216 | 3300009148 | Bacteria | 1411 |
| 175 | Ga0105241_10040525 | 3300009174 | Bacteria | 3516 |
| 176 | Ga0105241_10152660 | 3300009174 | Bacteria | 1891 |
| 177 | Ga0105241_10368626 | 3300009174 | Bacteria | 1252 |
| 178 | Ga0105242_10408968 | 3300009176 | Bacteria | 1268 |
| 179 | Ga0105248_10003154 | 3300009177 | Bacteria | 18249 |
| 180 | Ga0105248_10079216 | 3300009177 | Bacteria | 3692 |
| 181 | Ga0105237_10015973 | 3300009545 | Bacteria | 7806 |
| 182 | Ga0105238_10112684 | 3300009551 | Bacteria | 2700 |
| 183 | Ga0105249_10057083 | 3300009553 | Bacteria | 3575 |
| 184 | Ga0105249_10230125 | 3300009553 | Bacteria | 1828 |
| 185 | Ga0105239_10431151 | 3300010375 | Bacteria | 1494 |
| 186 | Ga0105246_10021561 | 3300011119 | Bacteria | 4147 |
| 187 | Ga0157378_10176520 | 3300013297 | Unclassified | 2007 |
| 188 | Ga0163162_10200362 | 3300013306 | Bacteria | 2125 |
| 189 | Ga0157375_10550831 | 3300013308 | Bacteria | 1315 |
| 190 | Ga0163163_10040769 | 3300014325 | Bacteria | 4536 |
| 191 | Ga0157380_10063876 | 3300014326 | Bacteria | 2953 |
| 192 | Ga0157380_10112233 | 3300014326 | Bacteria | 2293 |
| 193 | Ga0157380_10627891 | 3300014326 | Bacteria | 1068 |
| 194 | Ga0157379_10041341 | 3300014968 | Bacteria | 4116 |
| 195 | Ga0207697_10027519 | 3300025315 | Bacteria | 2324 |
| 196 | Ga0207682_10009868 | 3300025893 | Bacteria | 3755 |
| 197 | Ga0207682_10032193 | 3300025893 | Bacteria | 2107 |
| 198 | Ga0207710_10015915 | 3300025900 | Bacteria | 3180 |
| 199 | Ga0207688_10326085 | 3300025901 | Bacteria | 943 |
| 200 | Ga0207680_10054781 | 3300025903 | Bacteria | 2401 |
| 201 | Ga0207680_10143416 | 3300025903 | Bacteria | 1585 |
| 202 | Ga0207647_10085921 | 3300025904 | Bacteria | 1881 |
| 203 | Ga0207645_10003035 | 3300025907 | Bacteria | 12919 |
| 204 | Ga0207645_10118929 | 3300025907 | Bacteria | 1714 |
| 205 | Ga0207645_10144669 | 3300025907 | Bacteria | 1550 |
| 206 | Ga0207643_10081967 | 3300025908 | Bacteria | 1870 |
| 207 | Ga0207684_10013056 | 3300025910 | Bacteria | 7191 |
| 208 | Ga0207684_10183716 | 3300025910 | Unclassified | 1803 |
| 209 | Ga0207684_10375846 | 3300025910 | Bacteria | 1222 |
| 210 | Ga0207654_10292281 | 3300025911 | Unclassified | 1105 |
| 211 | Ga0207695_10154997 | 3300025913 | Bacteria | 2226 |
| 212 | Ga0207671_10053594 | 3300025914 | Bacteria | 2989 |
| 213 | Ga0207662_10010880 | 3300025918 | Bacteria | 5030 |
| 214 | Ga0207662_10124213 | 3300025918 | Bacteria | 1621 |
| 215 | Ga0207662_10215433 | 3300025918 | Bacteria | 1248 |
| 216 | Ga0207649_10292229 | 3300025920 | Bacteria | 1189 |
| 217 | Ga0207646_10205723 | 3300025922 | Bacteria | 1778 |
| 218 | Ga0207646_10211684 | 3300025922 | Bacteria | 1751 |
| 219 | Ga0207646_10228735 | 3300025922 | Bacteria | 1680 |
| 220 | Ga0207646_10950870 | 3300025922 | Bacteria | 761 |
| 221 | Ga0207681_10074774 | 3300025923 | Bacteria | 2374 |
| 222 | Ga0207681_10344182 | 3300025923 | Bacteria | 1192 |
| 223 | Ga0207659_10006868 | 3300025926 | Bacteria | 6999 |
| 224 | Ga0207687_10169166 | 3300025927 | Bacteria | 1684 |
| 225 | Ga0207690_10193243 | 3300025932 | Bacteria | 1540 |
| 226 | Ga0207706_10042053 | 3300025933 | Bacteria | 4049 |
| 227 | Ga0207706_10118193 | 3300025933 | Bacteria | 2331 |
| 228 | Ga0207706_10138668 | 3300025933 | Bacteria | 2139 |
| 229 | Ga0207706_10217447 | 3300025933 | Bacteria | 1674 |
| 230 | Ga0207686_10173161 | 3300025934 | Bacteria | 1524 |
| 231 | Ga0207709_10019917 | 3300025935 | Bacteria | 3779 |
| 232 | Ga0207709_10112366 | 3300025935 | Bacteria | 1824 |
| 233 | Ga0207670_10079303 | 3300025936 | Bacteria | 2292 |
| 234 | Ga0207670_10088415 | 3300025936 | Bacteria | 2185 |
| 235 | Ga0207669_10068344 | 3300025937 | Bacteria | 2218 |
| 236 | Ga0207669_10075389 | 3300025937 | Bacteria | 2137 |
| 237 | Ga0207669_10479282 | 3300025937 | Bacteria | 991 |
| 238 | Ga0207669_10798746 | 3300025937 | Bacteria | 782 |
| 239 | Ga0207704_10030957 | 3300025938 | Bacteria | 3007 |
| 240 | Ga0207691_10210088 | 3300025940 | Bacteria | 1691 |
| 241 | Ga0207691_10380118 | 3300025940 | Bacteria | 1206 |
| 242 | Ga0207711_10003572 | 3300025941 | Bacteria | 13450 |
| 243 | Ga0207689_10630726 | 3300025942 | Bacteria | 902 |
| 244 | Ga0207689_10836238 | 3300025942 | Bacteria | 777 |
| 245 | Ga0207651_10112096 | 3300025960 | Bacteria | 2050 |
| 246 | Ga0207651_10164550 | 3300025960 | Bacteria | 1743 |
| 247 | Ga0207668_10169599 | 3300025972 | Bacteria | 1710 |
| 248 | Ga0207668_10653249 | 3300025972 | Bacteria | 921 |
| 249 | Ga0207640_10018564 | 3300025981 | Bacteria | 4089 |
| 250 | Ga0207640_10025023 | 3300025981 | Bacteria | 3609 |
| 251 | Ga0207640_10135590 | 3300025981 | Bacteria | 1786 |
| 252 | Ga0207640_10187137 | 3300025981 | Bacteria | 1558 |
| 253 | Ga0207658_10188646 | 3300025986 | Bacteria | 1712 |
| 254 | Ga0207677_10121809 | 3300026023 | Bacteria | 1964 |
| 255 | Ga0207703_10002847 | 3300026035 | Bacteria | 14755 |
| 256 | Ga0207703_10110089 | 3300026035 | Bacteria | 2349 |
| 257 | Ga0207639_10301597 | 3300026041 | Bacteria | 1416 |
| 258 | Ga0207678_10410402 | 3300026067 | Bacteria | 1173 |
| 259 | Ga0207708_10000915 | 3300026075 | Bacteria | 22111 |
| 260 | Ga0207708_10000925 | 3300026075 | Bacteria | 21982 |
| 261 | Ga0207708_10045803 | 3300026075 | Bacteria | 3333 |
| 262 | Ga0207708_10174139 | 3300026075 | Bacteria | 1706 |
| 263 | Ga0207702_10025963 | 3300026078 | Bacteria | 4863 |
| 264 | Ga0207641_10005516 | 3300026088 | Bacteria | 10792 |
| 265 | Ga0207641_10143756 | 3300026088 | Bacteria | 2155 |
| 266 | Ga0207648_10003983 | 3300026089 | Bacteria | 15334 |
| 267 | Ga0207648_10020081 | 3300026089 | Bacteria | 6025 |
| 268 | Ga0207648_10125947 | 3300026089 | Bacteria | 2254 |
| 269 | Ga0207676_10020656 | 3300026095 | Bacteria | 4821 |
| 270 | Ga0207674_10090403 | 3300026116 | Bacteria | 3053 |
| 271 | Ga0207675_100006469 | 3300026118 | Bacteria | 11089 |
| 272 | Ga0207675_100011693 | 3300026118 | Bacteria | 8207 |
| 273 | Ga0207675_100037437 | 3300026118 | Bacteria | 4525 |
| 274 | Ga0207675_100110865 | 3300026118 | Bacteria | 2589 |
| 275 | Ga0207675_100118884 | 3300026118 | Bacteria | 2499 |
| 276 | Ga0207675_100308927 | 3300026118 | Bacteria | 1542 |
| 277 | Ga0207683_10044372 | 3300026121 | Bacteria | 3887 |
| 278 | Ga0207698_10019429 | 3300026142 | Bacteria | 4652 |
| 279 | Ga0207428_10036196 | 3300027907 | Bacteria | 4028 |
| 280 | Ga0207428_10061853 | 3300027907 | Bacteria | 2962 |
| 281 | Ga0268266_10003397 | 3300028379 | Bacteria | 15941 |
| 282 | Ga0268265_10003890 | 3300028380 | Bacteria | 10537 |
| 283 | Ga0268265_10457860 | 3300028380 | Bacteria | 1193 |
| 284 | Ga0268264_10262110 | 3300028381 | Bacteria | 1610 |
| 285 | Ga0268264_10446524 | 3300028381 | Bacteria | 1252 |
| 286 | Ga0268264_10481941 | 3300028381 | Bacteria | 1207 |
| 287 | Ga0265334_10001712 | 3300028573 | Bacteria | 10479 |
| 288 | Ga0265318_10000013 | 3300028577 | Bacteria | 208938 |
| 289 | Ga0307515_10000901 | 3300028794 | Bacteria | 68376 |
| 290 | Ga0265760_10000006 | 3300031090 | Bacteria | 143747 |
| 291 | Ga0265320_10004353 | 3300031240 | Bacteria | 9290 |
| 292 | Ga0265339_10121648 | 3300031249 | Bacteria | 1341 |
| 293 | Ga0265327_10001826 | 3300031251 | Bacteria | 24880 |
| 294 | Ga0265316_10031550 | 3300031344 | Unclassified | 4331 |
| 295 | Ga0265316_10055400 | 3300031344 | Bacteria | 3101 |
| 296 | Ga0265316_10137944 | 3300031344 | Bacteria | 1834 |
| 297 | Ga0307408_100062348 | 3300031548 | Bacteria | 2724 |
| 298 | Ga0265313_10002743 | 3300031595 | Bacteria | 14867 |
| 299 | Ga0316579_10104864 | 3300031691 | Bacteria | 1355 |
| 300 | Ga0265314_10004422 | 3300031711 | Bacteria | 13044 |
| 301 | Ga0265342_10111365 | 3300031712 | Unclassified | 1549 |
| 302 | Ga0265342_10197274 | 3300031712 | Bacteria | 1095 |
| 303 | Ga0307405_10004968 | 3300031731 | Bacteria | 6354 |
| 304 | Ga0316577_10152535 | 3300031733 | Bacteria | 1302 |
| 305 | Ga0307413_10009254 | 3300031824 | Bacteria | 4706 |
| 306 | Ga0307410_10015111 | 3300031852 | Bacteria | 4569 |
| 307 | Ga0307410_10026045 | 3300031852 | Bacteria | 3676 |
| 308 | Ga0307406_10019799 | 3300031901 | Bacteria | 3954 |
| 309 | Ga0307407_10032923 | 3300031903 | Bacteria | 2823 |
| 310 | Ga0307407_10124601 | 3300031903 | Bacteria | 1639 |
| 311 | Ga0307412_10019030 | 3300031911 | Bacteria | 4147 |
| 312 | Ga0307412_10102081 | 3300031911 | Bacteria | 2030 |
| 313 | Ga0307409_100014010 | 3300031995 | Bacteria | 5193 |
| 314 | Ga0307409_100033537 | 3300031995 | Bacteria | 3737 |
| 315 | Ga0307409_100124525 | 3300031995 | Bacteria | 2190 |
| 316 | Ga0307409_100494407 | 3300031995 | Bacteria | 1190 |
| 317 | Ga0307416_100062393 | 3300032002 | Bacteria | 3047 |
| 318 | Ga0307416_100122819 | 3300032002 | Bacteria | 2319 |
| 319 | Ga0307416_100204339 | 3300032002 | Bacteria | 1877 |
| 320 | Ga0307414_10079234 | 3300032004 | Bacteria | 2397 |
| 321 | Ga0307414_10081858 | 3300032004 | Bacteria | 2365 |
| 322 | Ga0307411_10021273 | 3300032005 | Bacteria | 3791 |
| 323 | Ga0307411_10403854 | 3300032005 | Bacteria | 1130 |
| 324 | Ga0307415_100018371 | 3300032126 | Bacteria | 4221 |
| 325 | Ga0307415_100018681 | 3300032126 | Bacteria | 4193 |
| 326 | Ga0373930_0001136 | 3300034816 | Bacteria | 3875 |
| 327 | Ga0373948_0036438 | 3300034817 | Bacteria | 1013 |
| 328 | Ga0373950_0001406 | 3300034818 | Bacteria | 3134 |
| 329 | Ga0373958_0000185 | 3300034819 | Bacteria | 7200 |
| 330 | Ga0373959_0002658 | 3300034820 | Bacteria | 2838 |
| 331 | Ga0373938_0001008 | 3300034957 | Bacteria | 4534 |
| 332 | Ga0373928_0001001 | 3300035084 | Bacteria | 5542 |
| 333 | Ga0373929_0000170 | 3300035085 | Bacteria | 11480 |
| 334 | Ga0373934_0001376 | 3300035086 | Bacteria | 8858 |
| 335 | Ga0373940_0000517 | 3300035088 | Bacteria | 6065 |
| 336 | Ga0373949_0001179 | 3300035090 | Bacteria | 7764 |
| 337 | Ga0373951_0003979 | 3300035091 | Bacteria | 3550 |
| 338 | Ga0373952_0000225 | 3300035092 | Bacteria | 9048 |
| 339 | Ga0373923_0000016 | 3300035111 | Bacteria | 30741 |
| 340 | Ga0373932_0000146 | 3300035112 | Bacteria | 20150 |
| 341 | Ga0373936_0000377 | 3300035113 | Bacteria | 15111 |
| 342 | Ga0373939_0001515 | 3300035114 | Bacteria | 5636 |
| 343 | Ga0373941_0000792 | 3300035115 | Bacteria | 6489 |
| 344 | Ga0373945_0040833 | 3300035116 | Unclassified | 1676 |
| 345 | Ga0373953_0001601 | 3300035117 | Bacteria | 6617 |
| 346 | Ga0373954_0000184 | 3300035118 | Bacteria | 22503 |
| 347 | Ga0373956_0002244 | 3300035119 | Bacteria | 7961 |
| 348 | Ga0373957_0000158 | 3300035120 | Bacteria | 17204 |
| 349 | Ga0373943_0118548 | 3300035170 | Unclassified | 1404 |
| 350 | Ga0373946_0109560 | 3300035171 | Unclassified | 1248 |
| 351 | Ga0373955_0003648 | 3300035172 | Bacteria | 6775 |
| 352 | Ga0373942_0000554 | 3300035207 | Bacteria | 10517 |
| 353 | Ga0373961_0000365 | 3300035241 | Bacteria | 19442 |
| 354 | Ga0373961_0000629 | 3300035241 | Bacteria | 12728 |
| 355 | Ga0373961_0034800 | 3300035241 | Bacteria | 1426 |
| 356 | Ga0373962_0001599 | 3300035242 | Bacteria | 5377 |
| 357 | Ga0373924_0000159 | 3300035410 | Bacteria | 19830 |
| 358 | Ga0373931_0007878 | 3300035691 | Bacteria | 5037 |
| 359 | Ga0373935_0001428 | 3300035692 | Bacteria | 13234 |
| 360 | Ga0373927_0042224 | 3300035695 | Unclassified | 2955 |
| 361 | Ga0373933_0001817 | 3300035724 | Bacteria | 12370 |
| 362 | Ga0373937_0015544 | 3300036401 | Bacteria | 6734 |
| 363 | Ga0316584_0114127 | 3300036712 | Bacteria | 2021 |
| 364 | Ga0373925_0002411 | 3300037068 | Bacteria | 14992 |
| 365 | Ga0395905_0000396 | 3300037471 | Bacteria | 61743 |
| 366 | Ga0436364_0256781 | 3300037853 | Bacteria | 1638 |
| 367 | Ga0242420_001164 | 3300038996 | Unclassified | 3411 |
| 368 | Ga0400483_021395 | 3300039062 | Bacteria | 114250 |
| 369 | Ga0439446_0126743 | 3300042156 | Bacteria | 825 |
| 370 | Ga0439434_0063441 | 3300042435 | Bacteria | 1158 |
| 371 | Ga0450916_019683 | 3300042530 | Unclassified | 918 |
| 372 | Ga0453683_0088742 | 3300044673 | Bacteria | 1938 |
| 373 | Ga0466966_0000237 | 3300044684 | Bacteria | 36471 |
| 374 | Ga0453684_0098924 | 3300044712 | Unclassified | 3575 |
| 375 | Ga0466957_0113981 | 3300044842 | Bacteria | 1717 |
| 376 | Ga0451576_0010293 | 3300045051 | Bacteria | 10740 |
| 377 | Ga0451576_0332389 | 3300045051 | Bacteria | 1590 |
| 378 | Ga0495592_0002477 | 3300046454 | Bacteria | 13041 |
| 379 | Ga0495592_0011536 | 3300046454 | Bacteria | 6690 |
| 380 | Ga0495641_0017043 | 3300046461 | Unclassified | 3800 |
| 381 | Ga0495651_0001359 | 3300046462 | Bacteria | 18933 |
| 382 | Ga0495653_0006674 | 3300046463 | Bacteria | 9470 |
| 383 | Ga0495582_0199165 | 3300046473 | Unclassified | 1143 |
| 384 | Ga0495639_0002257 | 3300046475 | Bacteria | 8458 |
| 385 | Ga0495662_0087847 | 3300046476 | Unclassified | 1514 |
| 386 | Ga0495664_0070801 | 3300046477 | Unclassified | 2082 |
| 387 | Ga0495585_0099799 | 3300046492 | Unclassified | 1554 |
| 388 | Ga0495594_0085899 | 3300046499 | Unclassified | 1760 |
| 389 | Ga0495608_0000530 | 3300046511 | Bacteria | 26163 |
| 390 | Ga0495628_0014216 | 3300046516 | Bacteria | 6681 |
| 391 | Ga0495628_0024713 | 3300046516 | Unclassified | 4914 |
| 392 | Ga0495630_0000385 | 3300046517 | Bacteria | 34735 |
| 393 | Ga0495666_0016799 | 3300046526 | Unclassified | 3644 |
| 394 | Ga0495652_0095450 | 3300046529 | Unclassified | 2423 |
| 395 | Ga0495665_0002140 | 3300046531 | Bacteria | 10688 |
| 396 | Ga0495640_0001251 | 3300046533 | Bacteria | 19941 |
| 397 | Ga0495587_0002371 | 3300046536 | Bacteria | 12584 |
| 398 | Ga0495667_0020879 | 3300046559 | Unclassified | 4419 |
| 399 | Ga0495634_0005065 | 3300046642 | Bacteria | 10177 |
| 400 | Ga0495635_0113264 | 3300046663 | Unclassified | 1852 |
| 401 | Ga0495659_0167689 | 3300046664 | Bacteria | 889 |
| 402 | Ga0495657_0002255 | 3300046675 | Bacteria | 16310 |
| 403 | Ga0495599_0053864 | 3300046678 | Unclassified | 2520 |
| 404 | Ga0495647_0055862 | 3300046681 | Unclassified | 1546 |
| 405 | Ga0495613_0040306 | 3300046689 | Unclassified | 3461 |
| 406 | Ga0495624_0024901 | 3300046690 | Unclassified | 3937 |
| 407 | Ga0495600_0000751 | 3300046809 | Bacteria | 17074 |
| 408 | Ga0495604_0004826 | 3300047317 | Bacteria | 10691 |
| 409 | Ga0495674_0019477 | 3300047319 | Bacteria | 6298 |
| 410 | Ga0495674_0434879 | 3300047319 | Bacteria | 1056 |
| 411 | Ga0495680_0007644 | 3300047322 | Bacteria | 9869 |
| 412 | Ga0495675_0005422 | 3300047444 | Bacteria | 7776 |
| 413 | Ga0495684_0003397 | 3300047471 | Bacteria | 12489 |
| 414 | Ga0495614_0151565 | 3300048089 | Unclassified | 1034 |
| 415 | Ga0496102_0023033 | 3300048905 | Bacteria | 5527 |
| 416 | Ga0496102_0795233 | 3300048905 | Bacteria | 868 |
| 417 | Ga0496104_0112324 | 3300048907 | Bacteria | 2613 |
| 418 | Ga0496104_0143018 | 3300048907 | Bacteria | 2298 |
| 419 | Ga0496106_0298344 | 3300048909 | Bacteria | 1292 |
| 420 | Ga0496106_0312367 | 3300048909 | Bacteria | 1261 |
| 421 | Ga0496106_0391385 | 3300048909 | Bacteria | 1117 |
| 422 | Ga0496107_0046166 | 3300048910 | Bacteria | 3135 |
| 423 | Ga0496108_0011177 | 3300048911 | Bacteria | 7293 |
| 424 | Ga0496109_0058755 | 3300048912 | Bacteria | 3513 |
| 425 | Ga0496109_0358789 | 3300048912 | Bacteria | 1377 |
| 426 | Ga0496110_0063935 | 3300048913 | Bacteria | 3252 |
| 427 | Ga0496112_0000207 | 3300048915 | Bacteria | 38070 |
| 428 | Ga0496113_0040566 | 3300048916 | Bacteria | 3431 |
| 429 | Ga0496113_0340589 | 3300048916 | Bacteria | 1203 |
| 430 | Ga0496122_0088075 | 3300048925 | Unclassified | 2130 |
| 431 | Ga0501298_003998 | 3300049521 | Unclassified | 2304 |
| 432 | Ga0501299_014573 | 3300049522 | Bacteria | 1370 |
| 433 | Ga0501034_0069072 | 3300049571 | Bacteria | 3544 |
| 434 | Ga0501034_0292045 | 3300049571 | Bacteria | 1568 |
| 435 | Ga0501039_0041414 | 3300049575 | Bacteria | 3558 |
| 436 | Ga0501047_0089087 | 3300049581 | Bacteria | 2963 |
| 437 | Ga0501047_0766174 | 3300049581 | Bacteria | 781 |
| 438 | Ga0501075_0095447 | 3300049591 | Bacteria | 2257 |
| 439 | Ga0501075_0231787 | 3300049591 | Bacteria | 1408 |
| 440 | Ga0501075_0402333 | 3300049591 | Bacteria | 1044 |
| 441 | Ga0501076_0513339 | 3300049592 | Bacteria | 988 |
| 442 | Ga0501202_003653 | 3300049652 | Bacteria | 2651 |
| 443 | Ga0501207_002031 | 3300049654 | Bacteria | 2588 |
| 444 | Ga0501216_001355 | 3300049660 | Unclassified | 3292 |
| 445 | Ga0501223_005511 | 3300049663 | Bacteria | 2657 |
| 446 | Ga0501227_000628 | 3300049665 | Bacteria | 7675 |
| 447 | Ga0501230_000542 | 3300049667 | Unclassified | 3886 |
| 448 | Ga0501235_000760 | 3300049669 | Bacteria | 6555 |
| 449 | Ga0501257_001775 | 3300049686 | Unclassified | 4498 |
| 450 | Ga0501225_0001301 | 3300049705 | Bacteria | 7741 |
| 451 | Ga0501262_023770 | 3300049759 | Unclassified | 854 |
| 452 | Ga0501226_002890 | 3300049853 | Bacteria | 2067 |
| 453 | nmdc:mga05p37_28862_c1 | 3300050507 | Bacteria | 6767 |
| 454 | nmdc:mga05p37_313684_c1 | 3300050507 | Unclassified | 1858 |
| 455 | nmdc:mga05p37_32500_c1 | 3300050507 | Bacteria | 6382 |
| 456 | nmdc:mga08y16_11561_c2 | 3300050511 | Bacteria | 3032 |
| 457 | nmdc:mga08y16_14075_c1 | 3300050511 | Bacteria | 8421 |
| 458 | nmdc:mga08y16_53005_c1 | 3300050511 | Bacteria | 4242 |
| 459 | nmdc:mga0n895_156829_c1 | 3300050512 | Bacteria | 2307 |
| 460 | nmdc:mga0n895_2837_c1 | 3300050512 | Bacteria | 13724 |
| 461 | nmdc:mga0n895_38863_c1 | 3300050512 | Bacteria | 4613 |
| 462 | nmdc:mga0rr50_148385_c1 | 3300050513 | Bacteria | 1893 |
| 463 | nmdc:mga0rr50_458692_c1 | 3300050513 | Bacteria | 1081 |
| 464 | nmdc:mga0rr50_50790_c1 | 3300050513 | Bacteria | 3074 |
| 465 | nmdc:mga0rr50_58238_c1 | 3300050513 | Bacteria | 2895 |
| 466 | nmdc:mga08x19_105669_c1 | 3300050514 | Bacteria | 1873 |
| 467 | nmdc:mga08x19_109744_c1 | 3300050514 | Bacteria | 1839 |
| 468 | nmdc:mga08x19_157068_c1 | 3300050514 | Bacteria | 1543 |
| 469 | nmdc:mga0a205_381498_c1 | 3300050515 | Bacteria | 1275 |
| 470 | Ga0495595_0004770 | 3300053084 | Bacteria | 5459 |
| 471 | Ga0495619_0003179 | 3300053085 | Bacteria | 10641 |
| 472 | Ga0500658_0342699 | 3300053134 | Bacteria | 686 |
| 473 | Ga0590071_000882 | 3300059421 | Bacteria | 8343 |
| 474 | Ga0590074_000689 | 3300059423 | Bacteria | 5143 |
| 475 | Ga0590074_015274 | 3300059423 | Bacteria | 1304 |
| 476 | Ga0590075_000350 | 3300059424 | Bacteria | 12841 |
| 477 | Ga0590075_009952 | 3300059424 | Bacteria | 2284 |
| 478 | Ga0590077_000438 | 3300059426 | Bacteria | 11713 |
| 479 | Ga0590077_008117 | 3300059426 | Bacteria | 2149 |
| 480 | Ga0590077_056303 | 3300059426 | Bacteria | 887 |
| 481 | Ga0501082_0439825 | 3300060353 | Bacteria | 1139 |
| 482 | Ga0466962_0001123 | 3300061719 | Bacteria | 12347 |
| 483 | Ga0530510_0012756 | 3300061734 | Bacteria | 5908 |
| 484 | Ga0530510_0127871 | 3300061734 | Bacteria | 1868 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049652 | Ga0501202_003653 | Ga0501202_003653_304_981 | 202 |
| 2 | 3300049660 | Ga0501216_001355 | Ga0501216_001355_1802_2479 | 202 |
| 3 | 3300049665 | Ga0501227_000628 | Ga0501227_000628_4957_5634 | 202 |
| 4 | 3300049705 | Ga0501225_0001301 | Ga0501225_0001301_552_1229 | 202 |
| 5 | 3300049853 | Ga0501226_002890 | Ga0501226_002890_99_776 | 202 |
| 6 | 3300031548 | Ga0307408_100062348 | Ga0307408_1000623482 | 209 |
| 7 | 3300031911 | Ga0307412_10102081 | Ga0307412_101020812 | 209 |
| 8 | 3300031995 | Ga0307409_100124525 | Ga0307409_1001245252 | 209 |
| 9 | 3300032002 | Ga0307416_100122819 | Ga0307416_1001228193 | 209 |
| 10 | 3300032004 | Ga0307414_10081858 | Ga0307414_100818583 | 209 |
| 11 | 3300049521 | Ga0501298_003998 | Ga0501298_003998_1531_2250 | 209 |
| 12 | 3300049654 | Ga0501207_002031 | Ga0501207_002031_1719_2432 | 209 |
| 13 | 3300049663 | Ga0501223_005511 | Ga0501223_005511_1666_2379 | 209 |
| 14 | 3300049667 | Ga0501230_000542 | Ga0501230_000542_938_1651 | 209 |
| 15 | 3300049669 | Ga0501235_000760 | Ga0501235_000760_244_957 | 209 |
| 16 | 3300049686 | Ga0501257_001775 | Ga0501257_001775_1392_2105 | 209 |
| 17 | 3300049759 | Ga0501262_023770 | Ga0501262_023770_42_761 | 209 |
| 18 | 3300053134 | Ga0500658_0342699 | Ga0500658_0342699_35_667 | 210 |
| 19 | 3300005841 | Ga0068863_100304864 | Ga0068863_1003048642 | 213 |
| 20 | 3300006237 | Ga0097621_100099906 | Ga0097621_1000999063 | 224 |
| 21 | 3300006358 | Ga0068871_100063542 | Ga0068871_1000635424 | 224 |
| 22 | 3300009147 | Ga0114129_10764707 | Ga0114129_107647072 | 225 |
| 23 | 3300009174 | Ga0105241_10368626 | Ga0105241_103686262 | 225 |
| 24 | 3300009545 | Ga0105237_10015973 | Ga0105237_100159736 | 225 |
| 25 | 3300011119 | Ga0105246_10021561 | Ga0105246_100215612 | 225 |
| 26 | 3300025922 | Ga0207646_10211684 | Ga0207646_102116842 | 225 |
| 27 | 3300038996 | Ga0242420_001164 | Ga0242420_001164_465_1142 | 225 |
| 28 | 3300026041 | Ga0207639_10301597 | Ga0207639_103015972 | 226 |
| 29 | 3300044684 | Ga0466966_0000237 | Ga0466966_0000237_8490_9170 | 226 |
| 30 | 3300044842 | Ga0466957_0113981 | Ga0466957_0113981_718_1398 | 226 |
| 31 | 3300009094 | Ga0111539_10801630 | Ga0111539_108016302 | 227 |
| 32 | 3300013297 | Ga0157378_10176520 | Ga0157378_101765202 | 227 |
| 33 | 3300035086 | Ga0373934_0001376 | Ga0373934_0001376_948_1631 | 227 |
| 34 | 3300035111 | Ga0373923_0000016 | Ga0373923_0000016_2933_3616 | 227 |
| 35 | 3300035113 | Ga0373936_0000377 | Ga0373936_0000377_423_1106 | 227 |
| 36 | 3300035116 | Ga0373945_0040833 | Ga0373945_0040833_325_1008 | 227 |
| 37 | 3300035117 | Ga0373953_0001601 | Ga0373953_0001601_2816_3499 | 227 |
| 38 | 3300035118 | Ga0373954_0000184 | Ga0373954_0000184_2921_3604 | 227 |
| 39 | 3300035119 | Ga0373956_0002244 | Ga0373956_0002244_1759_2442 | 227 |
| 40 | 3300035120 | Ga0373957_0000158 | Ga0373957_0000158_13240_13923 | 227 |
| 41 | 3300035170 | Ga0373943_0118548 | Ga0373943_0118548_630_1313 | 227 |
| 42 | 3300035171 | Ga0373946_0109560 | Ga0373946_0109560_324_1007 | 227 |
| 43 | 3300035172 | Ga0373955_0003648 | Ga0373955_0003648_3855_4538 | 227 |
| 44 | 3300035410 | Ga0373924_0000159 | Ga0373924_0000159_11824_12507 | 227 |
| 45 | 3300035692 | Ga0373935_0001428 | Ga0373935_0001428_7468_8151 | 227 |
| 46 | 3300035695 | Ga0373927_0042224 | Ga0373927_0042224_189_872 | 227 |
| 47 | 3300035724 | Ga0373933_0001817 | Ga0373933_0001817_10739_11422 | 227 |
| 48 | 3300036401 | Ga0373937_0015544 | Ga0373937_0015544_856_1539 | 227 |
| 49 | 3300037068 | Ga0373925_0002411 | Ga0373925_0002411_5948_6631 | 227 |
| 50 | 3300039062 | Ga0400483_021395 | Ga0400483_021395_42409_43092 | 227 |
| 51 | 3300046454 | Ga0495592_0002477 | Ga0495592_0002477_1518_2201 | 227 |
| 52 | 3300046454 | Ga0495592_0011536 | Ga0495592_0011536_1349_2032 | 227 |
| 53 | 3300046461 | Ga0495641_0017043 | Ga0495641_0017043_1321_2004 | 227 |
| 54 | 3300046462 | Ga0495651_0001359 | Ga0495651_0001359_3510_4193 | 227 |
| 55 | 3300046463 | Ga0495653_0006674 | Ga0495653_0006674_6848_7531 | 227 |
| 56 | 3300046473 | Ga0495582_0199165 | Ga0495582_0199165_20_703 | 227 |
| 57 | 3300046475 | Ga0495639_0002257 | Ga0495639_0002257_4177_4860 | 227 |
| 58 | 3300046476 | Ga0495662_0087847 | Ga0495662_0087847_666_1349 | 227 |
| 59 | 3300046477 | Ga0495664_0070801 | Ga0495664_0070801_474_1157 | 227 |
| 60 | 3300046499 | Ga0495594_0085899 | Ga0495594_0085899_393_1076 | 227 |
| 61 | 3300046511 | Ga0495608_0000530 | Ga0495608_0000530_10575_11258 | 227 |
| 62 | 3300046516 | Ga0495628_0014216 | Ga0495628_0014216_4310_4993 | 227 |
| 63 | 3300046516 | Ga0495628_0024713 | Ga0495628_0024713_3587_4270 | 227 |
| 64 | 3300046517 | Ga0495630_0000385 | Ga0495630_0000385_3928_4611 | 227 |
| 65 | 3300046526 | Ga0495666_0016799 | Ga0495666_0016799_670_1353 | 227 |
| 66 | 3300046529 | Ga0495652_0095450 | Ga0495652_0095450_1424_2107 | 227 |
| 67 | 3300046531 | Ga0495665_0002140 | Ga0495665_0002140_4767_5450 | 227 |
| 68 | 3300046533 | Ga0495640_0001251 | Ga0495640_0001251_2106_2789 | 227 |
| 69 | 3300046536 | Ga0495587_0002371 | Ga0495587_0002371_949_1632 | 227 |
| 70 | 3300046559 | Ga0495667_0020879 | Ga0495667_0020879_1978_2661 | 227 |
| 71 | 3300046642 | Ga0495634_0005065 | Ga0495634_0005065_1518_2201 | 227 |
| 72 | 3300046663 | Ga0495635_0113264 | Ga0495635_0113264_484_1167 | 227 |
| 73 | 3300046675 | Ga0495657_0002255 | Ga0495657_0002255_9086_9769 | 227 |
| 74 | 3300046678 | Ga0495599_0053864 | Ga0495599_0053864_478_1161 | 227 |
| 75 | 3300046681 | Ga0495647_0055862 | Ga0495647_0055862_267_950 | 227 |
| 76 | 3300046689 | Ga0495613_0040306 | Ga0495613_0040306_949_1632 | 227 |
| 77 | 3300046690 | Ga0495624_0024901 | Ga0495624_0024901_2582_3265 | 227 |
| 78 | 3300046809 | Ga0495600_0000751 | Ga0495600_0000751_5412_6095 | 227 |
| 79 | 3300047317 | Ga0495604_0004826 | Ga0495604_0004826_8383_9066 | 227 |
| 80 | 3300047319 | Ga0495674_0019477 | Ga0495674_0019477_3510_4193 | 227 |
| 81 | 3300047322 | Ga0495680_0007644 | Ga0495680_0007644_6068_6751 | 227 |
| 82 | 3300047444 | Ga0495675_0005422 | Ga0495675_0005422_1848_2531 | 227 |
| 83 | 3300047471 | Ga0495684_0003397 | Ga0495684_0003397_2106_2789 | 227 |
| 84 | 3300048089 | Ga0495614_0151565 | Ga0495614_0151565_290_973 | 227 |
| 85 | 3300049581 | Ga0501047_0089087 | Ga0501047_0089087_715_1398 | 227 |
| 86 | 3300053084 | Ga0495595_0004770 | Ga0495595_0004770_537_1220 | 227 |
| 87 | 3300053085 | Ga0495619_0003179 | Ga0495619_0003179_6043_6726 | 227 |
| 88 | 3300037853 | Ga0436364_0256781 | Ga0436364_0256781_699_1385 | 228 |
| 89 | 3300048911 | Ga0496108_0011177 | Ga0496108_0011177_33_725 | 230 |
| 90 | 3300006237 | Ga0097621_100038475 | Ga0097621_1000384753 | 231 |
| 91 | 3300006844 | Ga0075428_100696606 | Ga0075428_1006966062 | 231 |
| 92 | 3300006847 | Ga0075431_100795550 | Ga0075431_1007955502 | 231 |
| 93 | 3300006880 | Ga0075429_100296630 | Ga0075429_1002966303 | 231 |
| 94 | 3300009093 | Ga0105240_10231861 | Ga0105240_102318613 | 231 |
| 95 | 3300009147 | Ga0114129_10105083 | Ga0114129_101050832 | 231 |
| 96 | 3300009551 | Ga0105238_10112684 | Ga0105238_101126842 | 231 |
| 97 | 3300031251 | Ga0265327_10001826 | Ga0265327_1000182617 | 231 |
| 98 | 3300049581 | Ga0501047_0766174 | Ga0501047_0766174_20_745 | 231 |
| 99 | 3300050507 | nmdc:mga05p37_28862_c1 | nmdc:mga05p37_28862_c1_2387_3082 | 231 |
| 100 | 3300005330 | Ga0070690_100165364 | Ga0070690_1001653642 | 232 |
| 101 | 3300005345 | Ga0070692_10070186 | Ga0070692_100701862 | 232 |
| 102 | 3300005444 | Ga0070694_100288463 | Ga0070694_1002884632 | 232 |
| 103 | 3300005444 | Ga0070694_100471178 | Ga0070694_1004711781 | 232 |
| 104 | 3300005445 | Ga0070708_100069835 | Ga0070708_1000698352 | 232 |
| 105 | 3300005467 | Ga0070706_100035474 | Ga0070706_1000354743 | 232 |
| 106 | 3300005467 | Ga0070706_100041544 | Ga0070706_1000415443 | 232 |
| 107 | 3300005468 | Ga0070707_100025007 | Ga0070707_1000250074 | 232 |
| 108 | 3300005471 | Ga0070698_100022430 | Ga0070698_1000224304 | 232 |
| 109 | 3300005518 | Ga0070699_100026760 | Ga0070699_1000267602 | 232 |
| 110 | 3300005536 | Ga0070697_100075008 | Ga0070697_1000750083 | 232 |
| 111 | 3300005539 | Ga0068853_100027520 | Ga0068853_1000275205 | 232 |
| 112 | 3300005543 | Ga0070672_100345177 | Ga0070672_1003451771 | 232 |
| 113 | 3300005544 | Ga0070686_100476567 | Ga0070686_1004765671 | 232 |
| 114 | 3300005548 | Ga0070665_100000250 | Ga0070665_10000025015 | 232 |
| 115 | 3300005563 | Ga0068855_100482026 | Ga0068855_1004820262 | 232 |
| 116 | 3300005577 | Ga0068857_100053587 | Ga0068857_1000535873 | 232 |
| 117 | 3300005615 | Ga0070702_100102053 | Ga0070702_1001020532 | 232 |
| 118 | 3300005618 | Ga0068864_100229748 | Ga0068864_1002297483 | 232 |
| 119 | 3300005843 | Ga0068860_100375085 | Ga0068860_1003750852 | 232 |
| 120 | 3300005937 | Ga0081455_10003195 | Ga0081455_1000319511 | 232 |
| 121 | 3300006173 | Ga0070716_100279813 | Ga0070716_1002798133 | 232 |
| 122 | 3300006844 | Ga0075428_100209263 | Ga0075428_1002092633 | 232 |
| 123 | 3300006847 | Ga0075431_100452997 | Ga0075431_1004529972 | 232 |
| 124 | 3300006852 | Ga0075433_10077615 | Ga0075433_100776154 | 232 |
| 125 | 3300006914 | Ga0075436_100279610 | Ga0075436_1002796102 | 232 |
| 126 | 3300009093 | Ga0105240_10435790 | Ga0105240_104357902 | 232 |
| 127 | 3300009094 | Ga0111539_10434294 | Ga0111539_104342942 | 232 |
| 128 | 3300009101 | Ga0105247_10082942 | Ga0105247_100829422 | 232 |
| 129 | 3300009147 | Ga0114129_10948740 | Ga0114129_109487402 | 232 |
| 130 | 3300009148 | Ga0105243_10321216 | Ga0105243_103212161 | 232 |
| 131 | 3300013308 | Ga0157375_10550831 | Ga0157375_105508313 | 232 |
| 132 | 3300014326 | Ga0157380_10627891 | Ga0157380_106278912 | 232 |
| 133 | 3300025904 | Ga0207647_10085921 | Ga0207647_100859212 | 232 |
| 134 | 3300025910 | Ga0207684_10013056 | Ga0207684_100130564 | 232 |
| 135 | 3300025910 | Ga0207684_10183716 | Ga0207684_101837162 | 232 |
| 136 | 3300025911 | Ga0207654_10292281 | Ga0207654_102922811 | 232 |
| 137 | 3300025914 | Ga0207671_10053594 | Ga0207671_100535943 | 232 |
| 138 | 3300025920 | Ga0207649_10292229 | Ga0207649_102922291 | 232 |
| 139 | 3300025922 | Ga0207646_10228735 | Ga0207646_102287352 | 232 |
| 140 | 3300025922 | Ga0207646_10950870 | Ga0207646_109508701 | 232 |
| 141 | 3300025923 | Ga0207681_10344182 | Ga0207681_103441822 | 232 |
| 142 | 3300025933 | Ga0207706_10138668 | Ga0207706_101386682 | 232 |
| 143 | 3300025936 | Ga0207670_10079303 | Ga0207670_100793033 | 232 |
| 144 | 3300025942 | Ga0207689_10630726 | Ga0207689_106307262 | 232 |
| 145 | 3300025972 | Ga0207668_10653249 | Ga0207668_106532491 | 232 |
| 146 | 3300026035 | Ga0207703_10110089 | Ga0207703_101100892 | 232 |
| 147 | 3300026078 | Ga0207702_10025963 | Ga0207702_100259634 | 232 |
| 148 | 3300026116 | Ga0207674_10090403 | Ga0207674_100904033 | 232 |
| 149 | 3300026118 | Ga0207675_100308927 | Ga0207675_1003089272 | 232 |
| 150 | 3300028379 | Ga0268266_10003397 | Ga0268266_100033972 | 232 |
| 151 | 3300028381 | Ga0268264_10446524 | Ga0268264_104465242 | 232 |
| 152 | 3300028794 | Ga0307515_10000901 | Ga0307515_1000090134 | 232 |
| 153 | 3300031249 | Ga0265339_10121648 | Ga0265339_101216482 | 232 |
| 154 | 3300031344 | Ga0265316_10031550 | Ga0265316_100315503 | 232 |
| 155 | 3300031344 | Ga0265316_10137944 | Ga0265316_101379442 | 232 |
| 156 | 3300031691 | Ga0316579_10104864 | Ga0316579_101048642 | 232 |
| 157 | 3300031712 | Ga0265342_10111365 | Ga0265342_101113652 | 232 |
| 158 | 3300031712 | Ga0265342_10197274 | Ga0265342_101972742 | 232 |
| 159 | 3300031733 | Ga0316577_10152535 | Ga0316577_101525352 | 232 |
| 160 | 3300035241 | Ga0373961_0000629 | Ga0373961_0000629_10237_10935 | 232 |
| 161 | 3300036712 | Ga0316584_0114127 | Ga0316584_0114127_257_964 | 232 |
| 162 | 3300037471 | Ga0395905_0000396 | Ga0395905_0000396_41510_42208 | 232 |
| 163 | 3300042435 | Ga0439434_0063441 | Ga0439434_0063441_253_966 | 232 |
| 164 | 3300042530 | Ga0450916_019683 | Ga0450916_019683_175_873 | 232 |
| 165 | 3300044673 | Ga0453683_0088742 | Ga0453683_0088742_780_1478 | 232 |
| 166 | 3300046664 | Ga0495659_0167689 | Ga0495659_0167689_80_778 | 232 |
| 167 | 3300048905 | Ga0496102_0023033 | Ga0496102_0023033_2777_3490 | 232 |
| 168 | 3300048907 | Ga0496104_0112324 | Ga0496104_0112324_1326_2039 | 232 |
| 169 | 3300048909 | Ga0496106_0312367 | Ga0496106_0312367_335_1048 | 232 |
| 170 | 3300048912 | Ga0496109_0358789 | Ga0496109_0358789_527_1228 | 232 |
| 171 | 3300048913 | Ga0496110_0063935 | Ga0496110_0063935_325_1038 | 232 |
| 172 | 3300048916 | Ga0496113_0340589 | Ga0496113_0340589_143_862 | 232 |
| 173 | 3300048925 | Ga0496122_0088075 | Ga0496122_0088075_1026_1730 | 232 |
| 174 | 3300049571 | Ga0501034_0069072 | Ga0501034_0069072_1561_2259 | 232 |
| 175 | 3300049571 | Ga0501034_0292045 | Ga0501034_0292045_399_1103 | 232 |
| 176 | 3300049591 | Ga0501075_0095447 | Ga0501075_0095447_834_1532 | 232 |
| 177 | 3300049591 | Ga0501075_0231787 | Ga0501075_0231787_473_1171 | 232 |
| 178 | 3300049591 | Ga0501075_0402333 | Ga0501075_0402333_90_788 | 232 |
| 179 | 3300050511 | nmdc:mga08y16_53005_c1 | nmdc:mga08y16_53005_c1_2179_2880 | 232 |
| 180 | 3300059423 | Ga0590074_015274 | Ga0590074_015274_270_968 | 232 |
| 181 | 3300059424 | Ga0590075_009952 | Ga0590075_009952_1428_2126 | 232 |
| 182 | 3300059426 | Ga0590077_008117 | Ga0590077_008117_228_926 | 232 |
| 183 | 3300059426 | Ga0590077_056303 | Ga0590077_056303_179_877 | 232 |
| 184 | 3300061719 | Ga0466962_0001123 | Ga0466962_0001123_6153_6860 | 232 |
| 185 | 3300061734 | Ga0530510_0012756 | Ga0530510_0012756_675_1373 | 232 |
| 186 | 3300061734 | Ga0530510_0127871 | Ga0530510_0127871_199_906 | 232 |
| 187 | 3300003203 | JGI25406J46586_10042651 | JGI25406J46586_100426512 | 233 |
| 188 | 3300004799 | Ga0058863_11279205 | Ga0058863_112792052 | 233 |
| 189 | 3300004803 | Ga0058862_12139172 | Ga0058862_121391722 | 233 |
| 190 | 3300005290 | Ga0065712_10068442 | Ga0065712_100684428 | 233 |
| 191 | 3300005293 | Ga0065715_10107665 | Ga0065715_101076652 | 233 |
| 192 | 3300005293 | Ga0065715_10144629 | Ga0065715_101446292 | 233 |
| 193 | 3300005328 | Ga0070676_10018880 | Ga0070676_100188804 | 233 |
| 194 | 3300005328 | Ga0070676_10146018 | Ga0070676_101460182 | 233 |
| 195 | 3300005328 | Ga0070676_10305377 | Ga0070676_103053771 | 233 |
| 196 | 3300005328 | Ga0070676_10321164 | Ga0070676_103211641 | 233 |
| 197 | 3300005330 | Ga0070690_100045614 | Ga0070690_1000456142 | 233 |
| 198 | 3300005330 | Ga0070690_100089349 | Ga0070690_1000893492 | 233 |
| 199 | 3300005330 | Ga0070690_100122298 | Ga0070690_1001222982 | 233 |
| 200 | 3300005333 | Ga0070677_10012150 | Ga0070677_100121502 | 233 |
| 201 | 3300005334 | Ga0068869_100112556 | Ga0068869_1001125562 | 233 |
| 202 | 3300005335 | Ga0070666_10008482 | Ga0070666_100084822 | 233 |
| 203 | 3300005338 | Ga0068868_100687425 | Ga0068868_1006874251 | 233 |
| 204 | 3300005341 | Ga0070691_10003816 | Ga0070691_100038165 | 233 |
| 205 | 3300005341 | Ga0070691_10047985 | Ga0070691_100479852 | 233 |
| 206 | 3300005343 | Ga0070687_100257873 | Ga0070687_1002578732 | 233 |
| 207 | 3300005345 | Ga0070692_10069126 | Ga0070692_100691263 | 233 |
| 208 | 3300005347 | Ga0070668_100400223 | Ga0070668_1004002232 | 233 |
| 209 | 3300005347 | Ga0070668_100719737 | Ga0070668_1007197371 | 233 |
| 210 | 3300005353 | Ga0070669_100082607 | Ga0070669_1000826072 | 233 |
| 211 | 3300005353 | Ga0070669_100120583 | Ga0070669_1001205832 | 233 |
| 212 | 3300005354 | Ga0070675_100062563 | Ga0070675_1000625634 | 233 |
| 213 | 3300005356 | Ga0070674_100047740 | Ga0070674_1000477402 | 233 |
| 214 | 3300005356 | Ga0070674_100051551 | Ga0070674_1000515513 | 233 |
| 215 | 3300005364 | Ga0070673_100088915 | Ga0070673_1000889153 | 233 |
| 216 | 3300005364 | Ga0070673_100222441 | Ga0070673_1002224412 | 233 |
| 217 | 3300005366 | Ga0070659_100189682 | Ga0070659_1001896821 | 233 |
| 218 | 3300005367 | Ga0070667_100395530 | Ga0070667_1003955301 | 233 |
| 219 | 3300005406 | Ga0070703_10022989 | Ga0070703_100229892 | 233 |
| 220 | 3300005406 | Ga0070703_10199039 | Ga0070703_101990391 | 233 |
| 221 | 3300005438 | Ga0070701_10015319 | Ga0070701_100153192 | 233 |
| 222 | 3300005438 | Ga0070701_10065069 | Ga0070701_100650693 | 233 |
| 223 | 3300005438 | Ga0070701_10093558 | Ga0070701_100935581 | 233 |
| 224 | 3300005440 | Ga0070705_100014205 | Ga0070705_1000142054 | 233 |
| 225 | 3300005440 | Ga0070705_100023839 | Ga0070705_1000238393 | 233 |
| 226 | 3300005441 | Ga0070700_100003849 | Ga0070700_1000038497 | 233 |
| 227 | 3300005441 | Ga0070700_100010983 | Ga0070700_1000109834 | 233 |
| 228 | 3300005441 | Ga0070700_100380385 | Ga0070700_1003803852 | 233 |
| 229 | 3300005441 | Ga0070700_100385089 | Ga0070700_1003850891 | 233 |
| 230 | 3300005444 | Ga0070694_100012019 | Ga0070694_1000120194 | 233 |
| 231 | 3300005444 | Ga0070694_100019003 | Ga0070694_1000190032 | 233 |
| 232 | 3300005444 | Ga0070694_100456078 | Ga0070694_1004560782 | 233 |
| 233 | 3300005445 | Ga0070708_100087132 | Ga0070708_1000871322 | 233 |
| 234 | 3300005455 | Ga0070663_100326003 | Ga0070663_1003260032 | 233 |
| 235 | 3300005456 | Ga0070678_100142431 | Ga0070678_1001424313 | 233 |
| 236 | 3300005457 | Ga0070662_100216097 | Ga0070662_1002160972 | 233 |
| 237 | 3300005457 | Ga0070662_100853376 | Ga0070662_1008533761 | 233 |
| 238 | 3300005459 | Ga0068867_100011394 | Ga0068867_1000113942 | 233 |
| 239 | 3300005459 | Ga0068867_100020901 | Ga0068867_1000209014 | 233 |
| 240 | 3300005459 | Ga0068867_100145657 | Ga0068867_1001456572 | 233 |
| 241 | 3300005467 | Ga0070706_100322276 | Ga0070706_1003222762 | 233 |
| 242 | 3300005468 | Ga0070707_100050136 | Ga0070707_1000501363 | 233 |
| 243 | 3300005468 | Ga0070707_100106058 | Ga0070707_1001060582 | 233 |
| 244 | 3300005468 | Ga0070707_100309134 | Ga0070707_1003091342 | 233 |
| 245 | 3300005471 | Ga0070698_100049340 | Ga0070698_1000493404 | 233 |
| 246 | 3300005471 | Ga0070698_100151669 | Ga0070698_1001516692 | 233 |
| 247 | 3300005471 | Ga0070698_100197793 | Ga0070698_1001977932 | 233 |
| 248 | 3300005518 | Ga0070699_100164607 | Ga0070699_1001646072 | 233 |
| 249 | 3300005518 | Ga0070699_100179396 | Ga0070699_1001793963 | 233 |
| 250 | 3300005536 | Ga0070697_100266073 | Ga0070697_1002660733 | 233 |
| 251 | 3300005539 | Ga0068853_100193298 | Ga0068853_1001932982 | 233 |
| 252 | 3300005544 | Ga0070686_100004576 | Ga0070686_1000045765 | 233 |
| 253 | 3300005544 | Ga0070686_100069703 | Ga0070686_1000697032 | 233 |
| 254 | 3300005545 | Ga0070695_100005719 | Ga0070695_1000057192 | 233 |
| 255 | 3300005545 | Ga0070695_100080549 | Ga0070695_1000805492 | 233 |
| 256 | 3300005545 | Ga0070695_100091982 | Ga0070695_1000919822 | 233 |
| 257 | 3300005545 | Ga0070695_100124119 | Ga0070695_1001241193 | 233 |
| 258 | 3300005546 | Ga0070696_100022736 | Ga0070696_1000227365 | 233 |
| 259 | 3300005548 | Ga0070665_100243219 | Ga0070665_1002432192 | 233 |
| 260 | 3300005549 | Ga0070704_100001599 | Ga0070704_1000015993 | 233 |
| 261 | 3300005549 | Ga0070704_100010004 | Ga0070704_1000100046 | 233 |
| 262 | 3300005549 | Ga0070704_100038979 | Ga0070704_1000389792 | 233 |
| 263 | 3300005564 | Ga0070664_100211058 | Ga0070664_1002110582 | 233 |
| 264 | 3300005564 | Ga0070664_100358213 | Ga0070664_1003582131 | 233 |
| 265 | 3300005578 | Ga0068854_100014890 | Ga0068854_1000148906 | 233 |
| 266 | 3300005578 | Ga0068854_100027326 | Ga0068854_1000273265 | 233 |
| 267 | 3300005578 | Ga0068854_100063964 | Ga0068854_1000639642 | 233 |
| 268 | 3300005578 | Ga0068854_100152646 | Ga0068854_1001526463 | 233 |
| 269 | 3300005615 | Ga0070702_100023196 | Ga0070702_1000231963 | 233 |
| 270 | 3300005615 | Ga0070702_100073108 | Ga0070702_1000731082 | 233 |
| 271 | 3300005615 | Ga0070702_100468424 | Ga0070702_1004684241 | 233 |
| 272 | 3300005616 | Ga0068852_100036042 | Ga0068852_1000360422 | 233 |
| 273 | 3300005617 | Ga0068859_100052030 | Ga0068859_1000520303 | 233 |
| 274 | 3300005617 | Ga0068859_100230342 | Ga0068859_1002303422 | 233 |
| 275 | 3300005618 | Ga0068864_100026949 | Ga0068864_1000269494 | 233 |
| 276 | 3300005718 | Ga0068866_10081930 | Ga0068866_100819302 | 233 |
| 277 | 3300005719 | Ga0068861_100000681 | Ga0068861_1000006814 | 233 |
| 278 | 3300005719 | Ga0068861_100010825 | Ga0068861_1000108254 | 233 |
| 279 | 3300005719 | Ga0068861_100108813 | Ga0068861_1001088133 | 233 |
| 280 | 3300005719 | Ga0068861_100657859 | Ga0068861_1006578591 | 233 |
| 281 | 3300005834 | Ga0068851_10095208 | Ga0068851_100952082 | 233 |
| 282 | 3300005840 | Ga0068870_10187760 | Ga0068870_101877603 | 233 |
| 283 | 3300005841 | Ga0068863_100097390 | Ga0068863_1000973903 | 233 |
| 284 | 3300005842 | Ga0068858_100001359 | Ga0068858_10000135918 | 233 |
| 285 | 3300005842 | Ga0068858_100100913 | Ga0068858_1001009132 | 233 |
| 286 | 3300005843 | Ga0068860_100404440 | Ga0068860_1004044402 | 233 |
| 287 | 3300005843 | Ga0068860_100549455 | Ga0068860_1005494551 | 233 |
| 288 | 3300005844 | Ga0068862_100084219 | Ga0068862_1000842192 | 233 |
| 289 | 3300005844 | Ga0068862_100101767 | Ga0068862_1001017673 | 233 |
| 290 | 3300005844 | Ga0068862_100600240 | Ga0068862_1006002401 | 233 |
| 291 | 3300006844 | Ga0075428_100036815 | Ga0075428_1000368155 | 233 |
| 292 | 3300006852 | Ga0075433_10050103 | Ga0075433_100501034 | 233 |
| 293 | 3300006871 | Ga0075434_100005198 | Ga0075434_1000051988 | 233 |
| 294 | 3300006871 | Ga0075434_100057200 | Ga0075434_1000572002 | 233 |
| 295 | 3300006871 | Ga0075434_100164404 | Ga0075434_1001644041 | 233 |
| 296 | 3300006871 | Ga0075434_100233141 | Ga0075434_1002331412 | 233 |
| 297 | 3300006881 | Ga0068865_100044907 | Ga0068865_1000449074 | 233 |
| 298 | 3300006881 | Ga0068865_100168027 | Ga0068865_1001680273 | 233 |
| 299 | 3300006914 | Ga0075436_100041532 | Ga0075436_1000415322 | 233 |
| 300 | 3300006914 | Ga0075436_100094950 | Ga0075436_1000949503 | 233 |
| 301 | 3300006914 | Ga0075436_100171440 | Ga0075436_1001714402 | 233 |
| 302 | 3300006931 | Ga0097620_100052032 | Ga0097620_1000520323 | 233 |
| 303 | 3300006931 | Ga0097620_100230336 | Ga0097620_1002303362 | 233 |
| 304 | 3300007076 | Ga0075435_100000320 | Ga0075435_10000032021 | 233 |
| 305 | 3300007076 | Ga0075435_100001859 | Ga0075435_1000018595 | 233 |
| 306 | 3300007076 | Ga0075435_100022848 | Ga0075435_1000228483 | 233 |
| 307 | 3300007076 | Ga0075435_100475235 | Ga0075435_1004752352 | 233 |
| 308 | 3300009093 | Ga0105240_10217806 | Ga0105240_102178063 | 233 |
| 309 | 3300009093 | Ga0105240_10319724 | Ga0105240_103197242 | 233 |
| 310 | 3300009094 | Ga0111539_10006463 | Ga0111539_1000646311 | 233 |
| 311 | 3300009094 | Ga0111539_10118948 | Ga0111539_101189481 | 233 |
| 312 | 3300009098 | Ga0105245_10069902 | Ga0105245_100699024 | 233 |
| 313 | 3300009101 | Ga0105247_10002402 | Ga0105247_100024022 | 233 |
| 314 | 3300009147 | Ga0114129_10003861 | Ga0114129_100038617 | 233 |
| 315 | 3300009147 | Ga0114129_10049038 | Ga0114129_100490382 | 233 |
| 316 | 3300009147 | Ga0114129_10353990 | Ga0114129_103539902 | 233 |
| 317 | 3300009148 | Ga0105243_10023603 | Ga0105243_100236033 | 233 |
| 318 | 3300009148 | Ga0105243_10023827 | Ga0105243_100238276 | 233 |
| 319 | 3300009174 | Ga0105241_10040525 | Ga0105241_100405253 | 233 |
| 320 | 3300009174 | Ga0105241_10152660 | Ga0105241_101526603 | 233 |
| 321 | 3300009176 | Ga0105242_10408968 | Ga0105242_104089682 | 233 |
| 322 | 3300009177 | Ga0105248_10003154 | Ga0105248_100031548 | 233 |
| 323 | 3300009177 | Ga0105248_10079216 | Ga0105248_100792163 | 233 |
| 324 | 3300009553 | Ga0105249_10057083 | Ga0105249_100570833 | 233 |
| 325 | 3300009553 | Ga0105249_10230125 | Ga0105249_102301253 | 233 |
| 326 | 3300010375 | Ga0105239_10431151 | Ga0105239_104311513 | 233 |
| 327 | 3300013306 | Ga0163162_10200362 | Ga0163162_102003623 | 233 |
| 328 | 3300014325 | Ga0163163_10040769 | Ga0163163_100407693 | 233 |
| 329 | 3300014326 | Ga0157380_10063876 | Ga0157380_100638764 | 233 |
| 330 | 3300014326 | Ga0157380_10112233 | Ga0157380_101122332 | 233 |
| 331 | 3300014968 | Ga0157379_10041341 | Ga0157379_100413413 | 233 |
| 332 | 3300025315 | Ga0207697_10027519 | Ga0207697_100275192 | 233 |
| 333 | 3300025893 | Ga0207682_10009868 | Ga0207682_100098682 | 233 |
| 334 | 3300025893 | Ga0207682_10032193 | Ga0207682_100321932 | 233 |
| 335 | 3300025900 | Ga0207710_10015915 | Ga0207710_100159153 | 233 |
| 336 | 3300025901 | Ga0207688_10326085 | Ga0207688_103260852 | 233 |
| 337 | 3300025903 | Ga0207680_10054781 | Ga0207680_100547812 | 233 |
| 338 | 3300025903 | Ga0207680_10143416 | Ga0207680_101434162 | 233 |
| 339 | 3300025907 | Ga0207645_10003035 | Ga0207645_100030354 | 233 |
| 340 | 3300025907 | Ga0207645_10118929 | Ga0207645_101189292 | 233 |
| 341 | 3300025907 | Ga0207645_10144669 | Ga0207645_101446692 | 233 |
| 342 | 3300025908 | Ga0207643_10081967 | Ga0207643_100819672 | 233 |
| 343 | 3300025910 | Ga0207684_10375846 | Ga0207684_103758462 | 233 |
| 344 | 3300025913 | Ga0207695_10154997 | Ga0207695_101549972 | 233 |
| 345 | 3300025918 | Ga0207662_10010880 | Ga0207662_100108806 | 233 |
| 346 | 3300025918 | Ga0207662_10124213 | Ga0207662_101242133 | 233 |
| 347 | 3300025918 | Ga0207662_10215433 | Ga0207662_102154332 | 233 |
| 348 | 3300025922 | Ga0207646_10205723 | Ga0207646_102057232 | 233 |
| 349 | 3300025923 | Ga0207681_10074774 | Ga0207681_100747743 | 233 |
| 350 | 3300025926 | Ga0207659_10006868 | Ga0207659_100068686 | 233 |
| 351 | 3300025927 | Ga0207687_10169166 | Ga0207687_101691663 | 233 |
| 352 | 3300025932 | Ga0207690_10193243 | Ga0207690_101932432 | 233 |
| 353 | 3300025933 | Ga0207706_10042053 | Ga0207706_100420533 | 233 |
| 354 | 3300025933 | Ga0207706_10118193 | Ga0207706_101181932 | 233 |
| 355 | 3300025933 | Ga0207706_10217447 | Ga0207706_102174471 | 233 |
| 356 | 3300025934 | Ga0207686_10173161 | Ga0207686_101731612 | 233 |
| 357 | 3300025935 | Ga0207709_10019917 | Ga0207709_100199172 | 233 |
| 358 | 3300025935 | Ga0207709_10112366 | Ga0207709_101123662 | 233 |
| 359 | 3300025936 | Ga0207670_10088415 | Ga0207670_100884152 | 233 |
| 360 | 3300025937 | Ga0207669_10068344 | Ga0207669_100683443 | 233 |
| 361 | 3300025937 | Ga0207669_10075389 | Ga0207669_100753892 | 233 |
| 362 | 3300025937 | Ga0207669_10479282 | Ga0207669_104792822 | 233 |
| 363 | 3300025937 | Ga0207669_10798746 | Ga0207669_107987461 | 233 |
| 364 | 3300025938 | Ga0207704_10030957 | Ga0207704_100309574 | 233 |
| 365 | 3300025940 | Ga0207691_10210088 | Ga0207691_102100882 | 233 |
| 366 | 3300025940 | Ga0207691_10380118 | Ga0207691_103801182 | 233 |
| 367 | 3300025941 | Ga0207711_10003572 | Ga0207711_100035727 | 233 |
| 368 | 3300025942 | Ga0207689_10836238 | Ga0207689_108362381 | 233 |
| 369 | 3300025960 | Ga0207651_10112096 | Ga0207651_101120962 | 233 |
| 370 | 3300025960 | Ga0207651_10164550 | Ga0207651_101645502 | 233 |
| 371 | 3300025972 | Ga0207668_10169599 | Ga0207668_101695992 | 233 |
| 372 | 3300025981 | Ga0207640_10018564 | Ga0207640_100185644 | 233 |
| 373 | 3300025981 | Ga0207640_10025023 | Ga0207640_100250232 | 233 |
| 374 | 3300025981 | Ga0207640_10135590 | Ga0207640_101355902 | 233 |
| 375 | 3300025981 | Ga0207640_10187137 | Ga0207640_101871372 | 233 |
| 376 | 3300025986 | Ga0207658_10188646 | Ga0207658_101886462 | 233 |
| 377 | 3300026023 | Ga0207677_10121809 | Ga0207677_101218093 | 233 |
| 378 | 3300026035 | Ga0207703_10002847 | Ga0207703_100028473 | 233 |
| 379 | 3300026067 | Ga0207678_10410402 | Ga0207678_104104022 | 233 |
| 380 | 3300026075 | Ga0207708_10000915 | Ga0207708_100009159 | 233 |
| 381 | 3300026075 | Ga0207708_10000925 | Ga0207708_1000092514 | 233 |
| 382 | 3300026075 | Ga0207708_10045803 | Ga0207708_100458032 | 233 |
| 383 | 3300026075 | Ga0207708_10174139 | Ga0207708_101741392 | 233 |
| 384 | 3300026088 | Ga0207641_10005516 | Ga0207641_100055167 | 233 |
| 385 | 3300026088 | Ga0207641_10143756 | Ga0207641_101437563 | 233 |
| 386 | 3300026089 | Ga0207648_10003983 | Ga0207648_100039837 | 233 |
| 387 | 3300026089 | Ga0207648_10020081 | Ga0207648_100200812 | 233 |
| 388 | 3300026089 | Ga0207648_10125947 | Ga0207648_101259472 | 233 |
| 389 | 3300026095 | Ga0207676_10020656 | Ga0207676_100206564 | 233 |
| 390 | 3300026118 | Ga0207675_100006469 | Ga0207675_1000064693 | 233 |
| 391 | 3300026118 | Ga0207675_100011693 | Ga0207675_1000116936 | 233 |
| 392 | 3300026118 | Ga0207675_100037437 | Ga0207675_1000374374 | 233 |
| 393 | 3300026118 | Ga0207675_100110865 | Ga0207675_1001108653 | 233 |
| 394 | 3300026118 | Ga0207675_100118884 | Ga0207675_1001188842 | 233 |
| 395 | 3300026121 | Ga0207683_10044372 | Ga0207683_100443722 | 233 |
| 396 | 3300026142 | Ga0207698_10019429 | Ga0207698_100194294 | 233 |
| 397 | 3300027907 | Ga0207428_10036196 | Ga0207428_100361963 | 233 |
| 398 | 3300027907 | Ga0207428_10061853 | Ga0207428_100618531 | 233 |
| 399 | 3300028380 | Ga0268265_10003890 | Ga0268265_100038905 | 233 |
| 400 | 3300028380 | Ga0268265_10457860 | Ga0268265_104578601 | 233 |
| 401 | 3300028381 | Ga0268264_10262110 | Ga0268264_102621102 | 233 |
| 402 | 3300028381 | Ga0268264_10481941 | Ga0268264_104819412 | 233 |
| 403 | 3300028573 | Ga0265334_10001712 | Ga0265334_100017125 | 233 |
| 404 | 3300028577 | Ga0265318_10000013 | Ga0265318_1000001353 | 233 |
| 405 | 3300031090 | Ga0265760_10000006 | Ga0265760_1000000666 | 233 |
| 406 | 3300031240 | Ga0265320_10004353 | Ga0265320_100043535 | 233 |
| 407 | 3300031344 | Ga0265316_10055400 | Ga0265316_100554001 | 233 |
| 408 | 3300031595 | Ga0265313_10002743 | Ga0265313_1000274310 | 233 |
| 409 | 3300031711 | Ga0265314_10004422 | Ga0265314_100044223 | 233 |
| 410 | 3300031731 | Ga0307405_10004968 | Ga0307405_100049683 | 233 |
| 411 | 3300031824 | Ga0307413_10009254 | Ga0307413_100092542 | 233 |
| 412 | 3300031852 | Ga0307410_10015111 | Ga0307410_100151112 | 233 |
| 413 | 3300031852 | Ga0307410_10026045 | Ga0307410_100260453 | 233 |
| 414 | 3300031901 | Ga0307406_10019799 | Ga0307406_100197993 | 233 |
| 415 | 3300031903 | Ga0307407_10032923 | Ga0307407_100329233 | 233 |
| 416 | 3300031903 | Ga0307407_10124601 | Ga0307407_101246013 | 233 |
| 417 | 3300031911 | Ga0307412_10019030 | Ga0307412_100190305 | 233 |
| 418 | 3300031995 | Ga0307409_100014010 | Ga0307409_1000140104 | 233 |
| 419 | 3300031995 | Ga0307409_100033537 | Ga0307409_1000335373 | 233 |
| 420 | 3300031995 | Ga0307409_100494407 | Ga0307409_1004944071 | 233 |
| 421 | 3300032002 | Ga0307416_100062393 | Ga0307416_1000623933 | 233 |
| 422 | 3300032002 | Ga0307416_100204339 | Ga0307416_1002043392 | 233 |
| 423 | 3300032004 | Ga0307414_10079234 | Ga0307414_100792342 | 233 |
| 424 | 3300032005 | Ga0307411_10021273 | Ga0307411_100212732 | 233 |
| 425 | 3300032005 | Ga0307411_10403854 | Ga0307411_104038542 | 233 |
| 426 | 3300032126 | Ga0307415_100018371 | Ga0307415_1000183714 | 233 |
| 427 | 3300032126 | Ga0307415_100018681 | Ga0307415_1000186812 | 233 |
| 428 | 3300034816 | Ga0373930_0001136 | Ga0373930_0001136_465_1166 | 233 |
| 429 | 3300034817 | Ga0373948_0036438 | Ga0373948_0036438_33_734 | 233 |
| 430 | 3300034818 | Ga0373950_0001406 | Ga0373950_0001406_2046_2747 | 233 |
| 431 | 3300034819 | Ga0373958_0000185 | Ga0373958_0000185_1405_2106 | 233 |
| 432 | 3300034820 | Ga0373959_0002658 | Ga0373959_0002658_166_867 | 233 |
| 433 | 3300034957 | Ga0373938_0001008 | Ga0373938_0001008_336_1037 | 233 |
| 434 | 3300035084 | Ga0373928_0001001 | Ga0373928_0001001_4239_4940 | 233 |
| 435 | 3300035085 | Ga0373929_0000170 | Ga0373929_0000170_6502_7203 | 233 |
| 436 | 3300035088 | Ga0373940_0000517 | Ga0373940_0000517_251_952 | 233 |
| 437 | 3300035090 | Ga0373949_0001179 | Ga0373949_0001179_163_864 | 233 |
| 438 | 3300035091 | Ga0373951_0003979 | Ga0373951_0003979_2437_3138 | 233 |
| 439 | 3300035092 | Ga0373952_0000225 | Ga0373952_0000225_4182_4883 | 233 |
| 440 | 3300035112 | Ga0373932_0000146 | Ga0373932_0000146_15609_16310 | 233 |
| 441 | 3300035114 | Ga0373939_0001515 | Ga0373939_0001515_4504_5205 | 233 |
| 442 | 3300035115 | Ga0373941_0000792 | Ga0373941_0000792_4466_5167 | 233 |
| 443 | 3300035207 | Ga0373942_0000554 | Ga0373942_0000554_9448_10149 | 233 |
| 444 | 3300035241 | Ga0373961_0000365 | Ga0373961_0000365_13635_14336 | 233 |
| 445 | 3300035241 | Ga0373961_0034800 | Ga0373961_0034800_555_1256 | 233 |
| 446 | 3300035242 | Ga0373962_0001599 | Ga0373962_0001599_1323_2024 | 233 |
| 447 | 3300035691 | Ga0373931_0007878 | Ga0373931_0007878_1774_2475 | 233 |
| 448 | 3300042156 | Ga0439446_0126743 | Ga0439446_0126743_68_769 | 233 |
| 449 | 3300044712 | Ga0453684_0098924 | Ga0453684_0098924_2248_2952 | 233 |
| 450 | 3300045051 | Ga0451576_0010293 | Ga0451576_0010293_5133_5834 | 233 |
| 451 | 3300045051 | Ga0451576_0332389 | Ga0451576_0332389_537_1238 | 233 |
| 452 | 3300046492 | Ga0495585_0099799 | Ga0495585_0099799_729_1439 | 233 |
| 453 | 3300047319 | Ga0495674_0434879 | Ga0495674_0434879_295_999 | 233 |
| 454 | 3300048905 | Ga0496102_0795233 | Ga0496102_0795233_151_855 | 233 |
| 455 | 3300048907 | Ga0496104_0143018 | Ga0496104_0143018_978_1682 | 233 |
| 456 | 3300048909 | Ga0496106_0298344 | Ga0496106_0298344_45_746 | 233 |
| 457 | 3300048909 | Ga0496106_0391385 | Ga0496106_0391385_52_753 | 233 |
| 458 | 3300048910 | Ga0496107_0046166 | Ga0496107_0046166_1481_2182 | 233 |
| 459 | 3300048912 | Ga0496109_0058755 | Ga0496109_0058755_21_725 | 233 |
| 460 | 3300048915 | Ga0496112_0000207 | Ga0496112_0000207_28397_29101 | 233 |
| 461 | 3300048916 | Ga0496113_0040566 | Ga0496113_0040566_930_1634 | 233 |
| 462 | 3300049522 | Ga0501299_014573 | Ga0501299_014573_474_1175 | 233 |
| 463 | 3300049575 | Ga0501039_0041414 | Ga0501039_0041414_741_1448 | 233 |
| 464 | 3300049592 | Ga0501076_0513339 | Ga0501076_0513339_196_897 | 233 |
| 465 | 3300050507 | nmdc:mga05p37_313684_c1 | nmdc:mga05p37_313684_c1_901_1602 | 233 |
| 466 | 3300050507 | nmdc:mga05p37_32500_c1 | nmdc:mga05p37_32500_c1_1391_2095 | 233 |
| 467 | 3300050511 | nmdc:mga08y16_11561_c2 | nmdc:mga08y16_11561_c2_116_820 | 233 |
| 468 | 3300050511 | nmdc:mga08y16_14075_c1 | nmdc:mga08y16_14075_c1_1216_1917 | 233 |
| 469 | 3300050512 | nmdc:mga0n895_156829_c1 | nmdc:mga0n895_156829_c1_77_778 | 233 |
| 470 | 3300050512 | nmdc:mga0n895_2837_c1 | nmdc:mga0n895_2837_c1_1683_2384 | 233 |
| 471 | 3300050512 | nmdc:mga0n895_38863_c1 | nmdc:mga0n895_38863_c1_2905_3606 | 233 |
| 472 | 3300050513 | nmdc:mga0rr50_148385_c1 | nmdc:mga0rr50_148385_c1_639_1343 | 233 |
| 473 | 3300050513 | nmdc:mga0rr50_458692_c1 | nmdc:mga0rr50_458692_c1_304_1008 | 233 |
| 474 | 3300050513 | nmdc:mga0rr50_50790_c1 | nmdc:mga0rr50_50790_c1_1817_2518 | 233 |
| 475 | 3300050513 | nmdc:mga0rr50_58238_c1 | nmdc:mga0rr50_58238_c1_1474_2175 | 233 |
| 476 | 3300050514 | nmdc:mga08x19_105669_c1 | nmdc:mga08x19_105669_c1_445_1146 | 233 |
| 477 | 3300050514 | nmdc:mga08x19_109744_c1 | nmdc:mga08x19_109744_c1_600_1301 | 233 |
| 478 | 3300050514 | nmdc:mga08x19_157068_c1 | nmdc:mga08x19_157068_c1_319_1023 | 233 |
| 479 | 3300050515 | nmdc:mga0a205_381498_c1 | nmdc:mga0a205_381498_c1_342_1046 | 233 |
| 480 | 3300059421 | Ga0590071_000882 | Ga0590071_000882_2463_3164 | 233 |
| 481 | 3300059423 | Ga0590074_000689 | Ga0590074_000689_2581_3282 | 233 |
| 482 | 3300059424 | Ga0590075_000350 | Ga0590075_000350_5176_5877 | 233 |
| 483 | 3300059426 | Ga0590077_000438 | Ga0590077_000438_8358_9059 | 233 |
| 484 | 3300060353 | Ga0501082_0439825 | Ga0501082_0439825_274_975 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nbt-assembly1.cif.gz_D | crystal structure of fabg from acholeplasma laidlawii | 0.9534 | 2 | 231 |
| 6xew-assembly1.cif.gz_A | structure of serratia marcescens 2,3-butanediol dehydrogenase | 0.9482 | 1 | 226 |
| 4nbt-assembly1.cif.gz_D | crystal structure of fabg from acholeplasma laidlawii | 0.9455 | 2 | 231 |
| 3op4-assembly1.cif.gz_A | crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. n16961 in complex with nadp+ | 0.9436 | 1 | 229 |
| 4nbu-assembly1.cif.gz_D | crystal structure of fabg from bacillus sp | 0.9434 | 2 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2QLP7_18_222_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9574 | 5 | 177 | 3.40.50.720 |
| 4nbtD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9534 | 2 | 231 | 3.40.50.720 |
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9459 | 1 | 168 | 3.40.50.720 |
| 4nbtD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9455 | 2 | 231 | 3.40.50.720 |
| 3nugC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9341 | 2 | 228 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C6ZQN5-F1-model_v4 | SDR family oxidoreductase | 0.9908 | 1 | 230 |
GO:0016616
GO:0030497 |
| AF-A0A7W1IPF5-F1-model_v4 | SDR family oxidoreductase | 0.9884 | 2 | 231 |
GO:0006633
GO:0016616 GO:0048038 |
| AF-A0A1F2R9D9-F1-model_v4 | Oxidoreductase | 0.9881 | 3 | 230 |
GO:0006633
GO:0016616 GO:0048038 |
| AF-K1T6U1-F1-model_v4 | 3-oxoacyl-(Acyl-carrier-protein) reductase | 0.9865 | 38 | 231 |
GO:0016616
|
| AF-A0A370NAX2-F1-model_v4 | Oxidoreductase | 0.9862 | 1 | 230 |
GO:0016616
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar