F452896

General Info

Members Datasets Scaffolds Average Seq Length
484 293 484 232

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100345177|Ga0070672_1003451771
Length 246
Sequence VSASGERPPAPALPRDGDAILITGTSRGIGLHLAQTFVARGWRVFGCARGAAAFQHERYSHDELDVADEDAVAGMFAGVRRSGASLYALINNAGTASMNHVLTTPSKTMSKLWQVNVLGTMLCCREAAKHMVLRRRGRIVNCGSVAVPWGLEGESVYTATKAAVEAYSRVLARDLGTYGVTVNTVSPNPVQTDLIAGVPVEKMDRLVRRQSIPRYGTVEDVLAVVDFFLAPESGFVTGQTVYIGGP

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
174 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
207 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
208 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
261 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
268 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
269 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
270 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
271 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
272 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
273 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
274 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
275 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
276 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
277 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
287 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 3.1
Rhizosphere 95.87
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10042651 3300003203 Unclassified 1586
2 Ga0058863_11279205 3300004799 Bacteria 1701
3 Ga0058862_12139172 3300004803 Bacteria 1072
4 Ga0065712_10068442 3300005290 Bacteria 10619
5 Ga0065715_10107665 3300005293 Bacteria 2759
6 Ga0065715_10144629 3300005293 Bacteria 1800
7 Ga0070676_10018880 3300005328 Bacteria 3828
8 Ga0070676_10146018 3300005328 Bacteria 1510
9 Ga0070676_10305377 3300005328 Bacteria 1080
10 Ga0070676_10321164 3300005328 Bacteria 1056
11 Ga0070690_100045614 3300005330 Bacteria 2785
12 Ga0070690_100089349 3300005330 Bacteria 2026
13 Ga0070690_100122298 3300005330 Bacteria 1748
14 Ga0070690_100165364 3300005330 Bacteria 1519
15 Ga0070677_10012150 3300005333 Bacteria 2984
16 Ga0068869_100112556 3300005334 Bacteria 2072
17 Ga0070666_10008482 3300005335 Bacteria 6384
18 Ga0068868_100687425 3300005338 Bacteria 914
19 Ga0070691_10003816 3300005341 Bacteria 6802
20 Ga0070691_10047985 3300005341 Bacteria 2031
21 Ga0070687_100257873 3300005343 Bacteria 1087
22 Ga0070692_10069126 3300005345 Bacteria 1878
23 Ga0070692_10070186 3300005345 Bacteria 1865
24 Ga0070668_100400223 3300005347 Bacteria 1172
25 Ga0070668_100719737 3300005347 Bacteria 881
26 Ga0070669_100082607 3300005353 Bacteria 2395
27 Ga0070669_100120583 3300005353 Bacteria 2000
28 Ga0070675_100062563 3300005354 Bacteria 3075
29 Ga0070674_100047740 3300005356 Bacteria 2936
30 Ga0070674_100051551 3300005356 Bacteria 2836
31 Ga0070673_100088915 3300005364 Bacteria 2520
32 Ga0070673_100222441 3300005364 Bacteria 1634
33 Ga0070659_100189682 3300005366 Bacteria 1689
34 Ga0070667_100395530 3300005367 Bacteria 1257
35 Ga0070703_10022989 3300005406 Bacteria 1833
36 Ga0070703_10199039 3300005406 Bacteria 785
37 Ga0070701_10015319 3300005438 Bacteria 3538
38 Ga0070701_10065069 3300005438 Bacteria 1934
39 Ga0070701_10093558 3300005438 Bacteria 1652
40 Ga0070705_100014205 3300005440 Bacteria 4092
41 Ga0070705_100023839 3300005440 Bacteria 3293
42 Ga0070700_100003849 3300005441 Bacteria 7786
43 Ga0070700_100010983 3300005441 Bacteria 5006
44 Ga0070700_100380385 3300005441 Bacteria 1055
45 Ga0070700_100385089 3300005441 Bacteria 1050
46 Ga0070694_100012019 3300005444 Bacteria 5375
47 Ga0070694_100019003 3300005444 Bacteria 4367
48 Ga0070694_100288463 3300005444 Bacteria 1253
49 Ga0070694_100456078 3300005444 Bacteria 1010
50 Ga0070694_100471178 3300005444 Unclassified 995
51 Ga0070708_100069835 3300005445 Bacteria 3159
52 Ga0070708_100087132 3300005445 Bacteria 2837
53 Ga0070663_100326003 3300005455 Bacteria 1236
54 Ga0070678_100142431 3300005456 Bacteria 1920
55 Ga0070662_100216097 3300005457 Bacteria 1528
56 Ga0070662_100853376 3300005457 Bacteria 776
57 Ga0068867_100011394 3300005459 Bacteria 6274
58 Ga0068867_100020901 3300005459 Bacteria 4668
59 Ga0068867_100145657 3300005459 Bacteria 1856
60 Ga0070706_100035474 3300005467 Unclassified 4607
61 Ga0070706_100041544 3300005467 Bacteria 4245
62 Ga0070706_100322276 3300005467 Bacteria 1441
63 Ga0070707_100025007 3300005468 Bacteria 5662
64 Ga0070707_100050136 3300005468 Bacteria 4002
65 Ga0070707_100106058 3300005468 Bacteria 2725
66 Ga0070707_100309134 3300005468 Bacteria 1536
67 Ga0070698_100022430 3300005471 Bacteria 6605
68 Ga0070698_100049340 3300005471 Bacteria 4297
69 Ga0070698_100151669 3300005471 Bacteria 2265
70 Ga0070698_100197793 3300005471 Bacteria 1946
71 Ga0070699_100026760 3300005518 Bacteria 4975
72 Ga0070699_100164607 3300005518 Bacteria 1964
73 Ga0070699_100179396 3300005518 Bacteria 1879
74 Ga0070697_100075008 3300005536 Bacteria 2779
75 Ga0070697_100266073 3300005536 Bacteria 1469
76 Ga0068853_100027520 3300005539 Unclassified 4776
77 Ga0068853_100193298 3300005539 Bacteria 1850
78 Ga0070672_100345177 3300005543 Bacteria 1268
79 Ga0070686_100004576 3300005544 Bacteria 7624
80 Ga0070686_100069703 3300005544 Bacteria 2297
81 Ga0070686_100476567 3300005544 Bacteria 964
82 Ga0070695_100005719 3300005545 Bacteria 7328
83 Ga0070695_100080549 3300005545 Bacteria 2152
84 Ga0070695_100091982 3300005545 Bacteria 2027
85 Ga0070695_100124119 3300005545 Bacteria 1771
86 Ga0070696_100022736 3300005546 Bacteria 4261
87 Ga0070665_100000250 3300005548 Bacteria 88981
88 Ga0070665_100243219 3300005548 Bacteria 1800
89 Ga0070704_100001599 3300005549 Bacteria 12249
90 Ga0070704_100010004 3300005549 Bacteria 5760
91 Ga0070704_100038979 3300005549 Bacteria 3259
92 Ga0068855_100482026 3300005563 Bacteria 1350
93 Ga0070664_100211058 3300005564 Bacteria 1735
94 Ga0070664_100358213 3300005564 Bacteria 1328
95 Ga0068857_100053587 3300005577 Bacteria 3579
96 Ga0068854_100014890 3300005578 Bacteria 5135
97 Ga0068854_100027326 3300005578 Bacteria 3932
98 Ga0068854_100063964 3300005578 Bacteria 2672
99 Ga0068854_100152646 3300005578 Bacteria 1782
100 Ga0070702_100023196 3300005615 Bacteria 3294
101 Ga0070702_100073108 3300005615 Bacteria 2030
102 Ga0070702_100102053 3300005615 Bacteria 1762
103 Ga0070702_100468424 3300005615 Unclassified 918
104 Ga0068852_100036042 3300005616 Bacteria 4135
105 Ga0068859_100052030 3300005617 Bacteria 4118
106 Ga0068859_100230342 3300005617 Bacteria 1941
107 Ga0068864_100026949 3300005618 Bacteria 4848
108 Ga0068864_100229748 3300005618 Bacteria 1715
109 Ga0068866_10081930 3300005718 Bacteria 1734
110 Ga0068861_100000681 3300005719 Bacteria 20273
111 Ga0068861_100010825 3300005719 Bacteria 6339
112 Ga0068861_100108813 3300005719 Bacteria 2218
113 Ga0068861_100657859 3300005719 Bacteria 969
114 Ga0068851_10095208 3300005834 Bacteria 1573
115 Ga0068870_10187760 3300005840 Bacteria 1245
116 Ga0068863_100097390 3300005841 Bacteria 2793
117 Ga0068863_100304864 3300005841 Bacteria 1545
118 Ga0068858_100001359 3300005842 Bacteria 25178
119 Ga0068858_100100913 3300005842 Bacteria 2691
120 Ga0068860_100375085 3300005843 Bacteria 1404
121 Ga0068860_100404440 3300005843 Bacteria 1351
122 Ga0068860_100549455 3300005843 Bacteria 1157
123 Ga0068862_100084219 3300005844 Bacteria 2762
124 Ga0068862_100101767 3300005844 Bacteria 2514
125 Ga0068862_100600240 3300005844 Bacteria 1057
126 Ga0081455_10003195 3300005937 Bacteria 18992
127 Ga0070716_100279813 3300006173 Bacteria 1151
128 Ga0097621_100038475 3300006237 Bacteria 3839
129 Ga0097621_100099906 3300006237 Bacteria 2440
130 Ga0068871_100063542 3300006358 Bacteria 3020
131 Ga0075428_100036815 3300006844 Bacteria 5388
132 Ga0075428_100209263 3300006844 Bacteria 2108
133 Ga0075428_100696606 3300006844 Unclassified 1082
134 Ga0075431_100452997 3300006847 Bacteria 1279
135 Ga0075431_100795550 3300006847 Bacteria 919
136 Ga0075433_10050103 3300006852 Bacteria 3635
137 Ga0075433_10077615 3300006852 Unclassified 2925
138 Ga0075434_100005198 3300006871 Bacteria 11819
139 Ga0075434_100057200 3300006871 Bacteria 3876
140 Ga0075434_100164404 3300006871 Bacteria 2239
141 Ga0075434_100233141 3300006871 Bacteria 1860
142 Ga0075429_100296630 3300006880 Unclassified 1415
143 Ga0068865_100044907 3300006881 Bacteria 3027
144 Ga0068865_100168027 3300006881 Bacteria 1679
145 Ga0075436_100041532 3300006914 Bacteria 3174
146 Ga0075436_100094950 3300006914 Bacteria 2074
147 Ga0075436_100171440 3300006914 Bacteria 1532
148 Ga0075436_100279610 3300006914 Bacteria 1193
149 Ga0097620_100052032 3300006931 Bacteria 4118
150 Ga0097620_100230336 3300006931 Bacteria 1941
151 Ga0075435_100000320 3300007076 Bacteria 29604
152 Ga0075435_100001859 3300007076 Bacteria 13711
153 Ga0075435_100022848 3300007076 Bacteria 4828
154 Ga0075435_100475235 3300007076 Bacteria 1079
155 Ga0105240_10217806 3300009093 Bacteria 2226
156 Ga0105240_10231861 3300009093 Bacteria 2145
157 Ga0105240_10319724 3300009093 Bacteria 1769
158 Ga0105240_10435790 3300009093 Bacteria 1470
159 Ga0111539_10006463 3300009094 Bacteria 15100
160 Ga0111539_10118948 3300009094 Bacteria 3096
161 Ga0111539_10434294 3300009094 Bacteria 1529
162 Ga0111539_10801630 3300009094 Bacteria 1096
163 Ga0105245_10069902 3300009098 Bacteria 3185
164 Ga0105247_10002402 3300009101 Bacteria 12734
165 Ga0105247_10082942 3300009101 Bacteria 2024
166 Ga0114129_10003861 3300009147 Bacteria 21132
167 Ga0114129_10049038 3300009147 Bacteria 5935
168 Ga0114129_10105083 3300009147 Bacteria 3903
169 Ga0114129_10353990 3300009147 Bacteria 1944
170 Ga0114129_10764707 3300009147 Bacteria 1235
171 Ga0114129_10948740 3300009147 Bacteria 1087
172 Ga0105243_10023603 3300009148 Bacteria 4686
173 Ga0105243_10023827 3300009148 Bacteria 4664
174 Ga0105243_10321216 3300009148 Bacteria 1411
175 Ga0105241_10040525 3300009174 Bacteria 3516
176 Ga0105241_10152660 3300009174 Bacteria 1891
177 Ga0105241_10368626 3300009174 Bacteria 1252
178 Ga0105242_10408968 3300009176 Bacteria 1268
179 Ga0105248_10003154 3300009177 Bacteria 18249
180 Ga0105248_10079216 3300009177 Bacteria 3692
181 Ga0105237_10015973 3300009545 Bacteria 7806
182 Ga0105238_10112684 3300009551 Bacteria 2700
183 Ga0105249_10057083 3300009553 Bacteria 3575
184 Ga0105249_10230125 3300009553 Bacteria 1828
185 Ga0105239_10431151 3300010375 Bacteria 1494
186 Ga0105246_10021561 3300011119 Bacteria 4147
187 Ga0157378_10176520 3300013297 Unclassified 2007
188 Ga0163162_10200362 3300013306 Bacteria 2125
189 Ga0157375_10550831 3300013308 Bacteria 1315
190 Ga0163163_10040769 3300014325 Bacteria 4536
191 Ga0157380_10063876 3300014326 Bacteria 2953
192 Ga0157380_10112233 3300014326 Bacteria 2293
193 Ga0157380_10627891 3300014326 Bacteria 1068
194 Ga0157379_10041341 3300014968 Bacteria 4116
195 Ga0207697_10027519 3300025315 Bacteria 2324
196 Ga0207682_10009868 3300025893 Bacteria 3755
197 Ga0207682_10032193 3300025893 Bacteria 2107
198 Ga0207710_10015915 3300025900 Bacteria 3180
199 Ga0207688_10326085 3300025901 Bacteria 943
200 Ga0207680_10054781 3300025903 Bacteria 2401
201 Ga0207680_10143416 3300025903 Bacteria 1585
202 Ga0207647_10085921 3300025904 Bacteria 1881
203 Ga0207645_10003035 3300025907 Bacteria 12919
204 Ga0207645_10118929 3300025907 Bacteria 1714
205 Ga0207645_10144669 3300025907 Bacteria 1550
206 Ga0207643_10081967 3300025908 Bacteria 1870
207 Ga0207684_10013056 3300025910 Bacteria 7191
208 Ga0207684_10183716 3300025910 Unclassified 1803
209 Ga0207684_10375846 3300025910 Bacteria 1222
210 Ga0207654_10292281 3300025911 Unclassified 1105
211 Ga0207695_10154997 3300025913 Bacteria 2226
212 Ga0207671_10053594 3300025914 Bacteria 2989
213 Ga0207662_10010880 3300025918 Bacteria 5030
214 Ga0207662_10124213 3300025918 Bacteria 1621
215 Ga0207662_10215433 3300025918 Bacteria 1248
216 Ga0207649_10292229 3300025920 Bacteria 1189
217 Ga0207646_10205723 3300025922 Bacteria 1778
218 Ga0207646_10211684 3300025922 Bacteria 1751
219 Ga0207646_10228735 3300025922 Bacteria 1680
220 Ga0207646_10950870 3300025922 Bacteria 761
221 Ga0207681_10074774 3300025923 Bacteria 2374
222 Ga0207681_10344182 3300025923 Bacteria 1192
223 Ga0207659_10006868 3300025926 Bacteria 6999
224 Ga0207687_10169166 3300025927 Bacteria 1684
225 Ga0207690_10193243 3300025932 Bacteria 1540
226 Ga0207706_10042053 3300025933 Bacteria 4049
227 Ga0207706_10118193 3300025933 Bacteria 2331
228 Ga0207706_10138668 3300025933 Bacteria 2139
229 Ga0207706_10217447 3300025933 Bacteria 1674
230 Ga0207686_10173161 3300025934 Bacteria 1524
231 Ga0207709_10019917 3300025935 Bacteria 3779
232 Ga0207709_10112366 3300025935 Bacteria 1824
233 Ga0207670_10079303 3300025936 Bacteria 2292
234 Ga0207670_10088415 3300025936 Bacteria 2185
235 Ga0207669_10068344 3300025937 Bacteria 2218
236 Ga0207669_10075389 3300025937 Bacteria 2137
237 Ga0207669_10479282 3300025937 Bacteria 991
238 Ga0207669_10798746 3300025937 Bacteria 782
239 Ga0207704_10030957 3300025938 Bacteria 3007
240 Ga0207691_10210088 3300025940 Bacteria 1691
241 Ga0207691_10380118 3300025940 Bacteria 1206
242 Ga0207711_10003572 3300025941 Bacteria 13450
243 Ga0207689_10630726 3300025942 Bacteria 902
244 Ga0207689_10836238 3300025942 Bacteria 777
245 Ga0207651_10112096 3300025960 Bacteria 2050
246 Ga0207651_10164550 3300025960 Bacteria 1743
247 Ga0207668_10169599 3300025972 Bacteria 1710
248 Ga0207668_10653249 3300025972 Bacteria 921
249 Ga0207640_10018564 3300025981 Bacteria 4089
250 Ga0207640_10025023 3300025981 Bacteria 3609
251 Ga0207640_10135590 3300025981 Bacteria 1786
252 Ga0207640_10187137 3300025981 Bacteria 1558
253 Ga0207658_10188646 3300025986 Bacteria 1712
254 Ga0207677_10121809 3300026023 Bacteria 1964
255 Ga0207703_10002847 3300026035 Bacteria 14755
256 Ga0207703_10110089 3300026035 Bacteria 2349
257 Ga0207639_10301597 3300026041 Bacteria 1416
258 Ga0207678_10410402 3300026067 Bacteria 1173
259 Ga0207708_10000915 3300026075 Bacteria 22111
260 Ga0207708_10000925 3300026075 Bacteria 21982
261 Ga0207708_10045803 3300026075 Bacteria 3333
262 Ga0207708_10174139 3300026075 Bacteria 1706
263 Ga0207702_10025963 3300026078 Bacteria 4863
264 Ga0207641_10005516 3300026088 Bacteria 10792
265 Ga0207641_10143756 3300026088 Bacteria 2155
266 Ga0207648_10003983 3300026089 Bacteria 15334
267 Ga0207648_10020081 3300026089 Bacteria 6025
268 Ga0207648_10125947 3300026089 Bacteria 2254
269 Ga0207676_10020656 3300026095 Bacteria 4821
270 Ga0207674_10090403 3300026116 Bacteria 3053
271 Ga0207675_100006469 3300026118 Bacteria 11089
272 Ga0207675_100011693 3300026118 Bacteria 8207
273 Ga0207675_100037437 3300026118 Bacteria 4525
274 Ga0207675_100110865 3300026118 Bacteria 2589
275 Ga0207675_100118884 3300026118 Bacteria 2499
276 Ga0207675_100308927 3300026118 Bacteria 1542
277 Ga0207683_10044372 3300026121 Bacteria 3887
278 Ga0207698_10019429 3300026142 Bacteria 4652
279 Ga0207428_10036196 3300027907 Bacteria 4028
280 Ga0207428_10061853 3300027907 Bacteria 2962
281 Ga0268266_10003397 3300028379 Bacteria 15941
282 Ga0268265_10003890 3300028380 Bacteria 10537
283 Ga0268265_10457860 3300028380 Bacteria 1193
284 Ga0268264_10262110 3300028381 Bacteria 1610
285 Ga0268264_10446524 3300028381 Bacteria 1252
286 Ga0268264_10481941 3300028381 Bacteria 1207
287 Ga0265334_10001712 3300028573 Bacteria 10479
288 Ga0265318_10000013 3300028577 Bacteria 208938
289 Ga0307515_10000901 3300028794 Bacteria 68376
290 Ga0265760_10000006 3300031090 Bacteria 143747
291 Ga0265320_10004353 3300031240 Bacteria 9290
292 Ga0265339_10121648 3300031249 Bacteria 1341
293 Ga0265327_10001826 3300031251 Bacteria 24880
294 Ga0265316_10031550 3300031344 Unclassified 4331
295 Ga0265316_10055400 3300031344 Bacteria 3101
296 Ga0265316_10137944 3300031344 Bacteria 1834
297 Ga0307408_100062348 3300031548 Bacteria 2724
298 Ga0265313_10002743 3300031595 Bacteria 14867
299 Ga0316579_10104864 3300031691 Bacteria 1355
300 Ga0265314_10004422 3300031711 Bacteria 13044
301 Ga0265342_10111365 3300031712 Unclassified 1549
302 Ga0265342_10197274 3300031712 Bacteria 1095
303 Ga0307405_10004968 3300031731 Bacteria 6354
304 Ga0316577_10152535 3300031733 Bacteria 1302
305 Ga0307413_10009254 3300031824 Bacteria 4706
306 Ga0307410_10015111 3300031852 Bacteria 4569
307 Ga0307410_10026045 3300031852 Bacteria 3676
308 Ga0307406_10019799 3300031901 Bacteria 3954
309 Ga0307407_10032923 3300031903 Bacteria 2823
310 Ga0307407_10124601 3300031903 Bacteria 1639
311 Ga0307412_10019030 3300031911 Bacteria 4147
312 Ga0307412_10102081 3300031911 Bacteria 2030
313 Ga0307409_100014010 3300031995 Bacteria 5193
314 Ga0307409_100033537 3300031995 Bacteria 3737
315 Ga0307409_100124525 3300031995 Bacteria 2190
316 Ga0307409_100494407 3300031995 Bacteria 1190
317 Ga0307416_100062393 3300032002 Bacteria 3047
318 Ga0307416_100122819 3300032002 Bacteria 2319
319 Ga0307416_100204339 3300032002 Bacteria 1877
320 Ga0307414_10079234 3300032004 Bacteria 2397
321 Ga0307414_10081858 3300032004 Bacteria 2365
322 Ga0307411_10021273 3300032005 Bacteria 3791
323 Ga0307411_10403854 3300032005 Bacteria 1130
324 Ga0307415_100018371 3300032126 Bacteria 4221
325 Ga0307415_100018681 3300032126 Bacteria 4193
326 Ga0373930_0001136 3300034816 Bacteria 3875
327 Ga0373948_0036438 3300034817 Bacteria 1013
328 Ga0373950_0001406 3300034818 Bacteria 3134
329 Ga0373958_0000185 3300034819 Bacteria 7200
330 Ga0373959_0002658 3300034820 Bacteria 2838
331 Ga0373938_0001008 3300034957 Bacteria 4534
332 Ga0373928_0001001 3300035084 Bacteria 5542
333 Ga0373929_0000170 3300035085 Bacteria 11480
334 Ga0373934_0001376 3300035086 Bacteria 8858
335 Ga0373940_0000517 3300035088 Bacteria 6065
336 Ga0373949_0001179 3300035090 Bacteria 7764
337 Ga0373951_0003979 3300035091 Bacteria 3550
338 Ga0373952_0000225 3300035092 Bacteria 9048
339 Ga0373923_0000016 3300035111 Bacteria 30741
340 Ga0373932_0000146 3300035112 Bacteria 20150
341 Ga0373936_0000377 3300035113 Bacteria 15111
342 Ga0373939_0001515 3300035114 Bacteria 5636
343 Ga0373941_0000792 3300035115 Bacteria 6489
344 Ga0373945_0040833 3300035116 Unclassified 1676
345 Ga0373953_0001601 3300035117 Bacteria 6617
346 Ga0373954_0000184 3300035118 Bacteria 22503
347 Ga0373956_0002244 3300035119 Bacteria 7961
348 Ga0373957_0000158 3300035120 Bacteria 17204
349 Ga0373943_0118548 3300035170 Unclassified 1404
350 Ga0373946_0109560 3300035171 Unclassified 1248
351 Ga0373955_0003648 3300035172 Bacteria 6775
352 Ga0373942_0000554 3300035207 Bacteria 10517
353 Ga0373961_0000365 3300035241 Bacteria 19442
354 Ga0373961_0000629 3300035241 Bacteria 12728
355 Ga0373961_0034800 3300035241 Bacteria 1426
356 Ga0373962_0001599 3300035242 Bacteria 5377
357 Ga0373924_0000159 3300035410 Bacteria 19830
358 Ga0373931_0007878 3300035691 Bacteria 5037
359 Ga0373935_0001428 3300035692 Bacteria 13234
360 Ga0373927_0042224 3300035695 Unclassified 2955
361 Ga0373933_0001817 3300035724 Bacteria 12370
362 Ga0373937_0015544 3300036401 Bacteria 6734
363 Ga0316584_0114127 3300036712 Bacteria 2021
364 Ga0373925_0002411 3300037068 Bacteria 14992
365 Ga0395905_0000396 3300037471 Bacteria 61743
366 Ga0436364_0256781 3300037853 Bacteria 1638
367 Ga0242420_001164 3300038996 Unclassified 3411
368 Ga0400483_021395 3300039062 Bacteria 114250
369 Ga0439446_0126743 3300042156 Bacteria 825
370 Ga0439434_0063441 3300042435 Bacteria 1158
371 Ga0450916_019683 3300042530 Unclassified 918
372 Ga0453683_0088742 3300044673 Bacteria 1938
373 Ga0466966_0000237 3300044684 Bacteria 36471
374 Ga0453684_0098924 3300044712 Unclassified 3575
375 Ga0466957_0113981 3300044842 Bacteria 1717
376 Ga0451576_0010293 3300045051 Bacteria 10740
377 Ga0451576_0332389 3300045051 Bacteria 1590
378 Ga0495592_0002477 3300046454 Bacteria 13041
379 Ga0495592_0011536 3300046454 Bacteria 6690
380 Ga0495641_0017043 3300046461 Unclassified 3800
381 Ga0495651_0001359 3300046462 Bacteria 18933
382 Ga0495653_0006674 3300046463 Bacteria 9470
383 Ga0495582_0199165 3300046473 Unclassified 1143
384 Ga0495639_0002257 3300046475 Bacteria 8458
385 Ga0495662_0087847 3300046476 Unclassified 1514
386 Ga0495664_0070801 3300046477 Unclassified 2082
387 Ga0495585_0099799 3300046492 Unclassified 1554
388 Ga0495594_0085899 3300046499 Unclassified 1760
389 Ga0495608_0000530 3300046511 Bacteria 26163
390 Ga0495628_0014216 3300046516 Bacteria 6681
391 Ga0495628_0024713 3300046516 Unclassified 4914
392 Ga0495630_0000385 3300046517 Bacteria 34735
393 Ga0495666_0016799 3300046526 Unclassified 3644
394 Ga0495652_0095450 3300046529 Unclassified 2423
395 Ga0495665_0002140 3300046531 Bacteria 10688
396 Ga0495640_0001251 3300046533 Bacteria 19941
397 Ga0495587_0002371 3300046536 Bacteria 12584
398 Ga0495667_0020879 3300046559 Unclassified 4419
399 Ga0495634_0005065 3300046642 Bacteria 10177
400 Ga0495635_0113264 3300046663 Unclassified 1852
401 Ga0495659_0167689 3300046664 Bacteria 889
402 Ga0495657_0002255 3300046675 Bacteria 16310
403 Ga0495599_0053864 3300046678 Unclassified 2520
404 Ga0495647_0055862 3300046681 Unclassified 1546
405 Ga0495613_0040306 3300046689 Unclassified 3461
406 Ga0495624_0024901 3300046690 Unclassified 3937
407 Ga0495600_0000751 3300046809 Bacteria 17074
408 Ga0495604_0004826 3300047317 Bacteria 10691
409 Ga0495674_0019477 3300047319 Bacteria 6298
410 Ga0495674_0434879 3300047319 Bacteria 1056
411 Ga0495680_0007644 3300047322 Bacteria 9869
412 Ga0495675_0005422 3300047444 Bacteria 7776
413 Ga0495684_0003397 3300047471 Bacteria 12489
414 Ga0495614_0151565 3300048089 Unclassified 1034
415 Ga0496102_0023033 3300048905 Bacteria 5527
416 Ga0496102_0795233 3300048905 Bacteria 868
417 Ga0496104_0112324 3300048907 Bacteria 2613
418 Ga0496104_0143018 3300048907 Bacteria 2298
419 Ga0496106_0298344 3300048909 Bacteria 1292
420 Ga0496106_0312367 3300048909 Bacteria 1261
421 Ga0496106_0391385 3300048909 Bacteria 1117
422 Ga0496107_0046166 3300048910 Bacteria 3135
423 Ga0496108_0011177 3300048911 Bacteria 7293
424 Ga0496109_0058755 3300048912 Bacteria 3513
425 Ga0496109_0358789 3300048912 Bacteria 1377
426 Ga0496110_0063935 3300048913 Bacteria 3252
427 Ga0496112_0000207 3300048915 Bacteria 38070
428 Ga0496113_0040566 3300048916 Bacteria 3431
429 Ga0496113_0340589 3300048916 Bacteria 1203
430 Ga0496122_0088075 3300048925 Unclassified 2130
431 Ga0501298_003998 3300049521 Unclassified 2304
432 Ga0501299_014573 3300049522 Bacteria 1370
433 Ga0501034_0069072 3300049571 Bacteria 3544
434 Ga0501034_0292045 3300049571 Bacteria 1568
435 Ga0501039_0041414 3300049575 Bacteria 3558
436 Ga0501047_0089087 3300049581 Bacteria 2963
437 Ga0501047_0766174 3300049581 Bacteria 781
438 Ga0501075_0095447 3300049591 Bacteria 2257
439 Ga0501075_0231787 3300049591 Bacteria 1408
440 Ga0501075_0402333 3300049591 Bacteria 1044
441 Ga0501076_0513339 3300049592 Bacteria 988
442 Ga0501202_003653 3300049652 Bacteria 2651
443 Ga0501207_002031 3300049654 Bacteria 2588
444 Ga0501216_001355 3300049660 Unclassified 3292
445 Ga0501223_005511 3300049663 Bacteria 2657
446 Ga0501227_000628 3300049665 Bacteria 7675
447 Ga0501230_000542 3300049667 Unclassified 3886
448 Ga0501235_000760 3300049669 Bacteria 6555
449 Ga0501257_001775 3300049686 Unclassified 4498
450 Ga0501225_0001301 3300049705 Bacteria 7741
451 Ga0501262_023770 3300049759 Unclassified 854
452 Ga0501226_002890 3300049853 Bacteria 2067
453 nmdc:mga05p37_28862_c1 3300050507 Bacteria 6767
454 nmdc:mga05p37_313684_c1 3300050507 Unclassified 1858
455 nmdc:mga05p37_32500_c1 3300050507 Bacteria 6382
456 nmdc:mga08y16_11561_c2 3300050511 Bacteria 3032
457 nmdc:mga08y16_14075_c1 3300050511 Bacteria 8421
458 nmdc:mga08y16_53005_c1 3300050511 Bacteria 4242
459 nmdc:mga0n895_156829_c1 3300050512 Bacteria 2307
460 nmdc:mga0n895_2837_c1 3300050512 Bacteria 13724
461 nmdc:mga0n895_38863_c1 3300050512 Bacteria 4613
462 nmdc:mga0rr50_148385_c1 3300050513 Bacteria 1893
463 nmdc:mga0rr50_458692_c1 3300050513 Bacteria 1081
464 nmdc:mga0rr50_50790_c1 3300050513 Bacteria 3074
465 nmdc:mga0rr50_58238_c1 3300050513 Bacteria 2895
466 nmdc:mga08x19_105669_c1 3300050514 Bacteria 1873
467 nmdc:mga08x19_109744_c1 3300050514 Bacteria 1839
468 nmdc:mga08x19_157068_c1 3300050514 Bacteria 1543
469 nmdc:mga0a205_381498_c1 3300050515 Bacteria 1275
470 Ga0495595_0004770 3300053084 Bacteria 5459
471 Ga0495619_0003179 3300053085 Bacteria 10641
472 Ga0500658_0342699 3300053134 Bacteria 686
473 Ga0590071_000882 3300059421 Bacteria 8343
474 Ga0590074_000689 3300059423 Bacteria 5143
475 Ga0590074_015274 3300059423 Bacteria 1304
476 Ga0590075_000350 3300059424 Bacteria 12841
477 Ga0590075_009952 3300059424 Bacteria 2284
478 Ga0590077_000438 3300059426 Bacteria 11713
479 Ga0590077_008117 3300059426 Bacteria 2149
480 Ga0590077_056303 3300059426 Bacteria 887
481 Ga0501082_0439825 3300060353 Bacteria 1139
482 Ga0466962_0001123 3300061719 Bacteria 12347
483 Ga0530510_0012756 3300061734 Bacteria 5908
484 Ga0530510_0127871 3300061734 Bacteria 1868

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049652 Ga0501202_003653 Ga0501202_003653_304_981 202
2 3300049660 Ga0501216_001355 Ga0501216_001355_1802_2479 202
3 3300049665 Ga0501227_000628 Ga0501227_000628_4957_5634 202
4 3300049705 Ga0501225_0001301 Ga0501225_0001301_552_1229 202
5 3300049853 Ga0501226_002890 Ga0501226_002890_99_776 202
6 3300031548 Ga0307408_100062348 Ga0307408_1000623482 209
7 3300031911 Ga0307412_10102081 Ga0307412_101020812 209
8 3300031995 Ga0307409_100124525 Ga0307409_1001245252 209
9 3300032002 Ga0307416_100122819 Ga0307416_1001228193 209
10 3300032004 Ga0307414_10081858 Ga0307414_100818583 209
11 3300049521 Ga0501298_003998 Ga0501298_003998_1531_2250 209
12 3300049654 Ga0501207_002031 Ga0501207_002031_1719_2432 209
13 3300049663 Ga0501223_005511 Ga0501223_005511_1666_2379 209
14 3300049667 Ga0501230_000542 Ga0501230_000542_938_1651 209
15 3300049669 Ga0501235_000760 Ga0501235_000760_244_957 209
16 3300049686 Ga0501257_001775 Ga0501257_001775_1392_2105 209
17 3300049759 Ga0501262_023770 Ga0501262_023770_42_761 209
18 3300053134 Ga0500658_0342699 Ga0500658_0342699_35_667 210
19 3300005841 Ga0068863_100304864 Ga0068863_1003048642 213
20 3300006237 Ga0097621_100099906 Ga0097621_1000999063 224
21 3300006358 Ga0068871_100063542 Ga0068871_1000635424 224
22 3300009147 Ga0114129_10764707 Ga0114129_107647072 225
23 3300009174 Ga0105241_10368626 Ga0105241_103686262 225
24 3300009545 Ga0105237_10015973 Ga0105237_100159736 225
25 3300011119 Ga0105246_10021561 Ga0105246_100215612 225
26 3300025922 Ga0207646_10211684 Ga0207646_102116842 225
27 3300038996 Ga0242420_001164 Ga0242420_001164_465_1142 225
28 3300026041 Ga0207639_10301597 Ga0207639_103015972 226
29 3300044684 Ga0466966_0000237 Ga0466966_0000237_8490_9170 226
30 3300044842 Ga0466957_0113981 Ga0466957_0113981_718_1398 226
31 3300009094 Ga0111539_10801630 Ga0111539_108016302 227
32 3300013297 Ga0157378_10176520 Ga0157378_101765202 227
33 3300035086 Ga0373934_0001376 Ga0373934_0001376_948_1631 227
34 3300035111 Ga0373923_0000016 Ga0373923_0000016_2933_3616 227
35 3300035113 Ga0373936_0000377 Ga0373936_0000377_423_1106 227
36 3300035116 Ga0373945_0040833 Ga0373945_0040833_325_1008 227
37 3300035117 Ga0373953_0001601 Ga0373953_0001601_2816_3499 227
38 3300035118 Ga0373954_0000184 Ga0373954_0000184_2921_3604 227
39 3300035119 Ga0373956_0002244 Ga0373956_0002244_1759_2442 227
40 3300035120 Ga0373957_0000158 Ga0373957_0000158_13240_13923 227
41 3300035170 Ga0373943_0118548 Ga0373943_0118548_630_1313 227
42 3300035171 Ga0373946_0109560 Ga0373946_0109560_324_1007 227
43 3300035172 Ga0373955_0003648 Ga0373955_0003648_3855_4538 227
44 3300035410 Ga0373924_0000159 Ga0373924_0000159_11824_12507 227
45 3300035692 Ga0373935_0001428 Ga0373935_0001428_7468_8151 227
46 3300035695 Ga0373927_0042224 Ga0373927_0042224_189_872 227
47 3300035724 Ga0373933_0001817 Ga0373933_0001817_10739_11422 227
48 3300036401 Ga0373937_0015544 Ga0373937_0015544_856_1539 227
49 3300037068 Ga0373925_0002411 Ga0373925_0002411_5948_6631 227
50 3300039062 Ga0400483_021395 Ga0400483_021395_42409_43092 227
51 3300046454 Ga0495592_0002477 Ga0495592_0002477_1518_2201 227
52 3300046454 Ga0495592_0011536 Ga0495592_0011536_1349_2032 227
53 3300046461 Ga0495641_0017043 Ga0495641_0017043_1321_2004 227
54 3300046462 Ga0495651_0001359 Ga0495651_0001359_3510_4193 227
55 3300046463 Ga0495653_0006674 Ga0495653_0006674_6848_7531 227
56 3300046473 Ga0495582_0199165 Ga0495582_0199165_20_703 227
57 3300046475 Ga0495639_0002257 Ga0495639_0002257_4177_4860 227
58 3300046476 Ga0495662_0087847 Ga0495662_0087847_666_1349 227
59 3300046477 Ga0495664_0070801 Ga0495664_0070801_474_1157 227
60 3300046499 Ga0495594_0085899 Ga0495594_0085899_393_1076 227
61 3300046511 Ga0495608_0000530 Ga0495608_0000530_10575_11258 227
62 3300046516 Ga0495628_0014216 Ga0495628_0014216_4310_4993 227
63 3300046516 Ga0495628_0024713 Ga0495628_0024713_3587_4270 227
64 3300046517 Ga0495630_0000385 Ga0495630_0000385_3928_4611 227
65 3300046526 Ga0495666_0016799 Ga0495666_0016799_670_1353 227
66 3300046529 Ga0495652_0095450 Ga0495652_0095450_1424_2107 227
67 3300046531 Ga0495665_0002140 Ga0495665_0002140_4767_5450 227
68 3300046533 Ga0495640_0001251 Ga0495640_0001251_2106_2789 227
69 3300046536 Ga0495587_0002371 Ga0495587_0002371_949_1632 227
70 3300046559 Ga0495667_0020879 Ga0495667_0020879_1978_2661 227
71 3300046642 Ga0495634_0005065 Ga0495634_0005065_1518_2201 227
72 3300046663 Ga0495635_0113264 Ga0495635_0113264_484_1167 227
73 3300046675 Ga0495657_0002255 Ga0495657_0002255_9086_9769 227
74 3300046678 Ga0495599_0053864 Ga0495599_0053864_478_1161 227
75 3300046681 Ga0495647_0055862 Ga0495647_0055862_267_950 227
76 3300046689 Ga0495613_0040306 Ga0495613_0040306_949_1632 227
77 3300046690 Ga0495624_0024901 Ga0495624_0024901_2582_3265 227
78 3300046809 Ga0495600_0000751 Ga0495600_0000751_5412_6095 227
79 3300047317 Ga0495604_0004826 Ga0495604_0004826_8383_9066 227
80 3300047319 Ga0495674_0019477 Ga0495674_0019477_3510_4193 227
81 3300047322 Ga0495680_0007644 Ga0495680_0007644_6068_6751 227
82 3300047444 Ga0495675_0005422 Ga0495675_0005422_1848_2531 227
83 3300047471 Ga0495684_0003397 Ga0495684_0003397_2106_2789 227
84 3300048089 Ga0495614_0151565 Ga0495614_0151565_290_973 227
85 3300049581 Ga0501047_0089087 Ga0501047_0089087_715_1398 227
86 3300053084 Ga0495595_0004770 Ga0495595_0004770_537_1220 227
87 3300053085 Ga0495619_0003179 Ga0495619_0003179_6043_6726 227
88 3300037853 Ga0436364_0256781 Ga0436364_0256781_699_1385 228
89 3300048911 Ga0496108_0011177 Ga0496108_0011177_33_725 230
90 3300006237 Ga0097621_100038475 Ga0097621_1000384753 231
91 3300006844 Ga0075428_100696606 Ga0075428_1006966062 231
92 3300006847 Ga0075431_100795550 Ga0075431_1007955502 231
93 3300006880 Ga0075429_100296630 Ga0075429_1002966303 231
94 3300009093 Ga0105240_10231861 Ga0105240_102318613 231
95 3300009147 Ga0114129_10105083 Ga0114129_101050832 231
96 3300009551 Ga0105238_10112684 Ga0105238_101126842 231
97 3300031251 Ga0265327_10001826 Ga0265327_1000182617 231
98 3300049581 Ga0501047_0766174 Ga0501047_0766174_20_745 231
99 3300050507 nmdc:mga05p37_28862_c1 nmdc:mga05p37_28862_c1_2387_3082 231
100 3300005330 Ga0070690_100165364 Ga0070690_1001653642 232
101 3300005345 Ga0070692_10070186 Ga0070692_100701862 232
102 3300005444 Ga0070694_100288463 Ga0070694_1002884632 232
103 3300005444 Ga0070694_100471178 Ga0070694_1004711781 232
104 3300005445 Ga0070708_100069835 Ga0070708_1000698352 232
105 3300005467 Ga0070706_100035474 Ga0070706_1000354743 232
106 3300005467 Ga0070706_100041544 Ga0070706_1000415443 232
107 3300005468 Ga0070707_100025007 Ga0070707_1000250074 232
108 3300005471 Ga0070698_100022430 Ga0070698_1000224304 232
109 3300005518 Ga0070699_100026760 Ga0070699_1000267602 232
110 3300005536 Ga0070697_100075008 Ga0070697_1000750083 232
111 3300005539 Ga0068853_100027520 Ga0068853_1000275205 232
112 3300005543 Ga0070672_100345177 Ga0070672_1003451771 232
113 3300005544 Ga0070686_100476567 Ga0070686_1004765671 232
114 3300005548 Ga0070665_100000250 Ga0070665_10000025015 232
115 3300005563 Ga0068855_100482026 Ga0068855_1004820262 232
116 3300005577 Ga0068857_100053587 Ga0068857_1000535873 232
117 3300005615 Ga0070702_100102053 Ga0070702_1001020532 232
118 3300005618 Ga0068864_100229748 Ga0068864_1002297483 232
119 3300005843 Ga0068860_100375085 Ga0068860_1003750852 232
120 3300005937 Ga0081455_10003195 Ga0081455_1000319511 232
121 3300006173 Ga0070716_100279813 Ga0070716_1002798133 232
122 3300006844 Ga0075428_100209263 Ga0075428_1002092633 232
123 3300006847 Ga0075431_100452997 Ga0075431_1004529972 232
124 3300006852 Ga0075433_10077615 Ga0075433_100776154 232
125 3300006914 Ga0075436_100279610 Ga0075436_1002796102 232
126 3300009093 Ga0105240_10435790 Ga0105240_104357902 232
127 3300009094 Ga0111539_10434294 Ga0111539_104342942 232
128 3300009101 Ga0105247_10082942 Ga0105247_100829422 232
129 3300009147 Ga0114129_10948740 Ga0114129_109487402 232
130 3300009148 Ga0105243_10321216 Ga0105243_103212161 232
131 3300013308 Ga0157375_10550831 Ga0157375_105508313 232
132 3300014326 Ga0157380_10627891 Ga0157380_106278912 232
133 3300025904 Ga0207647_10085921 Ga0207647_100859212 232
134 3300025910 Ga0207684_10013056 Ga0207684_100130564 232
135 3300025910 Ga0207684_10183716 Ga0207684_101837162 232
136 3300025911 Ga0207654_10292281 Ga0207654_102922811 232
137 3300025914 Ga0207671_10053594 Ga0207671_100535943 232
138 3300025920 Ga0207649_10292229 Ga0207649_102922291 232
139 3300025922 Ga0207646_10228735 Ga0207646_102287352 232
140 3300025922 Ga0207646_10950870 Ga0207646_109508701 232
141 3300025923 Ga0207681_10344182 Ga0207681_103441822 232
142 3300025933 Ga0207706_10138668 Ga0207706_101386682 232
143 3300025936 Ga0207670_10079303 Ga0207670_100793033 232
144 3300025942 Ga0207689_10630726 Ga0207689_106307262 232
145 3300025972 Ga0207668_10653249 Ga0207668_106532491 232
146 3300026035 Ga0207703_10110089 Ga0207703_101100892 232
147 3300026078 Ga0207702_10025963 Ga0207702_100259634 232
148 3300026116 Ga0207674_10090403 Ga0207674_100904033 232
149 3300026118 Ga0207675_100308927 Ga0207675_1003089272 232
150 3300028379 Ga0268266_10003397 Ga0268266_100033972 232
151 3300028381 Ga0268264_10446524 Ga0268264_104465242 232
152 3300028794 Ga0307515_10000901 Ga0307515_1000090134 232
153 3300031249 Ga0265339_10121648 Ga0265339_101216482 232
154 3300031344 Ga0265316_10031550 Ga0265316_100315503 232
155 3300031344 Ga0265316_10137944 Ga0265316_101379442 232
156 3300031691 Ga0316579_10104864 Ga0316579_101048642 232
157 3300031712 Ga0265342_10111365 Ga0265342_101113652 232
158 3300031712 Ga0265342_10197274 Ga0265342_101972742 232
159 3300031733 Ga0316577_10152535 Ga0316577_101525352 232
160 3300035241 Ga0373961_0000629 Ga0373961_0000629_10237_10935 232
161 3300036712 Ga0316584_0114127 Ga0316584_0114127_257_964 232
162 3300037471 Ga0395905_0000396 Ga0395905_0000396_41510_42208 232
163 3300042435 Ga0439434_0063441 Ga0439434_0063441_253_966 232
164 3300042530 Ga0450916_019683 Ga0450916_019683_175_873 232
165 3300044673 Ga0453683_0088742 Ga0453683_0088742_780_1478 232
166 3300046664 Ga0495659_0167689 Ga0495659_0167689_80_778 232
167 3300048905 Ga0496102_0023033 Ga0496102_0023033_2777_3490 232
168 3300048907 Ga0496104_0112324 Ga0496104_0112324_1326_2039 232
169 3300048909 Ga0496106_0312367 Ga0496106_0312367_335_1048 232
170 3300048912 Ga0496109_0358789 Ga0496109_0358789_527_1228 232
171 3300048913 Ga0496110_0063935 Ga0496110_0063935_325_1038 232
172 3300048916 Ga0496113_0340589 Ga0496113_0340589_143_862 232
173 3300048925 Ga0496122_0088075 Ga0496122_0088075_1026_1730 232
174 3300049571 Ga0501034_0069072 Ga0501034_0069072_1561_2259 232
175 3300049571 Ga0501034_0292045 Ga0501034_0292045_399_1103 232
176 3300049591 Ga0501075_0095447 Ga0501075_0095447_834_1532 232
177 3300049591 Ga0501075_0231787 Ga0501075_0231787_473_1171 232
178 3300049591 Ga0501075_0402333 Ga0501075_0402333_90_788 232
179 3300050511 nmdc:mga08y16_53005_c1 nmdc:mga08y16_53005_c1_2179_2880 232
180 3300059423 Ga0590074_015274 Ga0590074_015274_270_968 232
181 3300059424 Ga0590075_009952 Ga0590075_009952_1428_2126 232
182 3300059426 Ga0590077_008117 Ga0590077_008117_228_926 232
183 3300059426 Ga0590077_056303 Ga0590077_056303_179_877 232
184 3300061719 Ga0466962_0001123 Ga0466962_0001123_6153_6860 232
185 3300061734 Ga0530510_0012756 Ga0530510_0012756_675_1373 232
186 3300061734 Ga0530510_0127871 Ga0530510_0127871_199_906 232
187 3300003203 JGI25406J46586_10042651 JGI25406J46586_100426512 233
188 3300004799 Ga0058863_11279205 Ga0058863_112792052 233
189 3300004803 Ga0058862_12139172 Ga0058862_121391722 233
190 3300005290 Ga0065712_10068442 Ga0065712_100684428 233
191 3300005293 Ga0065715_10107665 Ga0065715_101076652 233
192 3300005293 Ga0065715_10144629 Ga0065715_101446292 233
193 3300005328 Ga0070676_10018880 Ga0070676_100188804 233
194 3300005328 Ga0070676_10146018 Ga0070676_101460182 233
195 3300005328 Ga0070676_10305377 Ga0070676_103053771 233
196 3300005328 Ga0070676_10321164 Ga0070676_103211641 233
197 3300005330 Ga0070690_100045614 Ga0070690_1000456142 233
198 3300005330 Ga0070690_100089349 Ga0070690_1000893492 233
199 3300005330 Ga0070690_100122298 Ga0070690_1001222982 233
200 3300005333 Ga0070677_10012150 Ga0070677_100121502 233
201 3300005334 Ga0068869_100112556 Ga0068869_1001125562 233
202 3300005335 Ga0070666_10008482 Ga0070666_100084822 233
203 3300005338 Ga0068868_100687425 Ga0068868_1006874251 233
204 3300005341 Ga0070691_10003816 Ga0070691_100038165 233
205 3300005341 Ga0070691_10047985 Ga0070691_100479852 233
206 3300005343 Ga0070687_100257873 Ga0070687_1002578732 233
207 3300005345 Ga0070692_10069126 Ga0070692_100691263 233
208 3300005347 Ga0070668_100400223 Ga0070668_1004002232 233
209 3300005347 Ga0070668_100719737 Ga0070668_1007197371 233
210 3300005353 Ga0070669_100082607 Ga0070669_1000826072 233
211 3300005353 Ga0070669_100120583 Ga0070669_1001205832 233
212 3300005354 Ga0070675_100062563 Ga0070675_1000625634 233
213 3300005356 Ga0070674_100047740 Ga0070674_1000477402 233
214 3300005356 Ga0070674_100051551 Ga0070674_1000515513 233
215 3300005364 Ga0070673_100088915 Ga0070673_1000889153 233
216 3300005364 Ga0070673_100222441 Ga0070673_1002224412 233
217 3300005366 Ga0070659_100189682 Ga0070659_1001896821 233
218 3300005367 Ga0070667_100395530 Ga0070667_1003955301 233
219 3300005406 Ga0070703_10022989 Ga0070703_100229892 233
220 3300005406 Ga0070703_10199039 Ga0070703_101990391 233
221 3300005438 Ga0070701_10015319 Ga0070701_100153192 233
222 3300005438 Ga0070701_10065069 Ga0070701_100650693 233
223 3300005438 Ga0070701_10093558 Ga0070701_100935581 233
224 3300005440 Ga0070705_100014205 Ga0070705_1000142054 233
225 3300005440 Ga0070705_100023839 Ga0070705_1000238393 233
226 3300005441 Ga0070700_100003849 Ga0070700_1000038497 233
227 3300005441 Ga0070700_100010983 Ga0070700_1000109834 233
228 3300005441 Ga0070700_100380385 Ga0070700_1003803852 233
229 3300005441 Ga0070700_100385089 Ga0070700_1003850891 233
230 3300005444 Ga0070694_100012019 Ga0070694_1000120194 233
231 3300005444 Ga0070694_100019003 Ga0070694_1000190032 233
232 3300005444 Ga0070694_100456078 Ga0070694_1004560782 233
233 3300005445 Ga0070708_100087132 Ga0070708_1000871322 233
234 3300005455 Ga0070663_100326003 Ga0070663_1003260032 233
235 3300005456 Ga0070678_100142431 Ga0070678_1001424313 233
236 3300005457 Ga0070662_100216097 Ga0070662_1002160972 233
237 3300005457 Ga0070662_100853376 Ga0070662_1008533761 233
238 3300005459 Ga0068867_100011394 Ga0068867_1000113942 233
239 3300005459 Ga0068867_100020901 Ga0068867_1000209014 233
240 3300005459 Ga0068867_100145657 Ga0068867_1001456572 233
241 3300005467 Ga0070706_100322276 Ga0070706_1003222762 233
242 3300005468 Ga0070707_100050136 Ga0070707_1000501363 233
243 3300005468 Ga0070707_100106058 Ga0070707_1001060582 233
244 3300005468 Ga0070707_100309134 Ga0070707_1003091342 233
245 3300005471 Ga0070698_100049340 Ga0070698_1000493404 233
246 3300005471 Ga0070698_100151669 Ga0070698_1001516692 233
247 3300005471 Ga0070698_100197793 Ga0070698_1001977932 233
248 3300005518 Ga0070699_100164607 Ga0070699_1001646072 233
249 3300005518 Ga0070699_100179396 Ga0070699_1001793963 233
250 3300005536 Ga0070697_100266073 Ga0070697_1002660733 233
251 3300005539 Ga0068853_100193298 Ga0068853_1001932982 233
252 3300005544 Ga0070686_100004576 Ga0070686_1000045765 233
253 3300005544 Ga0070686_100069703 Ga0070686_1000697032 233
254 3300005545 Ga0070695_100005719 Ga0070695_1000057192 233
255 3300005545 Ga0070695_100080549 Ga0070695_1000805492 233
256 3300005545 Ga0070695_100091982 Ga0070695_1000919822 233
257 3300005545 Ga0070695_100124119 Ga0070695_1001241193 233
258 3300005546 Ga0070696_100022736 Ga0070696_1000227365 233
259 3300005548 Ga0070665_100243219 Ga0070665_1002432192 233
260 3300005549 Ga0070704_100001599 Ga0070704_1000015993 233
261 3300005549 Ga0070704_100010004 Ga0070704_1000100046 233
262 3300005549 Ga0070704_100038979 Ga0070704_1000389792 233
263 3300005564 Ga0070664_100211058 Ga0070664_1002110582 233
264 3300005564 Ga0070664_100358213 Ga0070664_1003582131 233
265 3300005578 Ga0068854_100014890 Ga0068854_1000148906 233
266 3300005578 Ga0068854_100027326 Ga0068854_1000273265 233
267 3300005578 Ga0068854_100063964 Ga0068854_1000639642 233
268 3300005578 Ga0068854_100152646 Ga0068854_1001526463 233
269 3300005615 Ga0070702_100023196 Ga0070702_1000231963 233
270 3300005615 Ga0070702_100073108 Ga0070702_1000731082 233
271 3300005615 Ga0070702_100468424 Ga0070702_1004684241 233
272 3300005616 Ga0068852_100036042 Ga0068852_1000360422 233
273 3300005617 Ga0068859_100052030 Ga0068859_1000520303 233
274 3300005617 Ga0068859_100230342 Ga0068859_1002303422 233
275 3300005618 Ga0068864_100026949 Ga0068864_1000269494 233
276 3300005718 Ga0068866_10081930 Ga0068866_100819302 233
277 3300005719 Ga0068861_100000681 Ga0068861_1000006814 233
278 3300005719 Ga0068861_100010825 Ga0068861_1000108254 233
279 3300005719 Ga0068861_100108813 Ga0068861_1001088133 233
280 3300005719 Ga0068861_100657859 Ga0068861_1006578591 233
281 3300005834 Ga0068851_10095208 Ga0068851_100952082 233
282 3300005840 Ga0068870_10187760 Ga0068870_101877603 233
283 3300005841 Ga0068863_100097390 Ga0068863_1000973903 233
284 3300005842 Ga0068858_100001359 Ga0068858_10000135918 233
285 3300005842 Ga0068858_100100913 Ga0068858_1001009132 233
286 3300005843 Ga0068860_100404440 Ga0068860_1004044402 233
287 3300005843 Ga0068860_100549455 Ga0068860_1005494551 233
288 3300005844 Ga0068862_100084219 Ga0068862_1000842192 233
289 3300005844 Ga0068862_100101767 Ga0068862_1001017673 233
290 3300005844 Ga0068862_100600240 Ga0068862_1006002401 233
291 3300006844 Ga0075428_100036815 Ga0075428_1000368155 233
292 3300006852 Ga0075433_10050103 Ga0075433_100501034 233
293 3300006871 Ga0075434_100005198 Ga0075434_1000051988 233
294 3300006871 Ga0075434_100057200 Ga0075434_1000572002 233
295 3300006871 Ga0075434_100164404 Ga0075434_1001644041 233
296 3300006871 Ga0075434_100233141 Ga0075434_1002331412 233
297 3300006881 Ga0068865_100044907 Ga0068865_1000449074 233
298 3300006881 Ga0068865_100168027 Ga0068865_1001680273 233
299 3300006914 Ga0075436_100041532 Ga0075436_1000415322 233
300 3300006914 Ga0075436_100094950 Ga0075436_1000949503 233
301 3300006914 Ga0075436_100171440 Ga0075436_1001714402 233
302 3300006931 Ga0097620_100052032 Ga0097620_1000520323 233
303 3300006931 Ga0097620_100230336 Ga0097620_1002303362 233
304 3300007076 Ga0075435_100000320 Ga0075435_10000032021 233
305 3300007076 Ga0075435_100001859 Ga0075435_1000018595 233
306 3300007076 Ga0075435_100022848 Ga0075435_1000228483 233
307 3300007076 Ga0075435_100475235 Ga0075435_1004752352 233
308 3300009093 Ga0105240_10217806 Ga0105240_102178063 233
309 3300009093 Ga0105240_10319724 Ga0105240_103197242 233
310 3300009094 Ga0111539_10006463 Ga0111539_1000646311 233
311 3300009094 Ga0111539_10118948 Ga0111539_101189481 233
312 3300009098 Ga0105245_10069902 Ga0105245_100699024 233
313 3300009101 Ga0105247_10002402 Ga0105247_100024022 233
314 3300009147 Ga0114129_10003861 Ga0114129_100038617 233
315 3300009147 Ga0114129_10049038 Ga0114129_100490382 233
316 3300009147 Ga0114129_10353990 Ga0114129_103539902 233
317 3300009148 Ga0105243_10023603 Ga0105243_100236033 233
318 3300009148 Ga0105243_10023827 Ga0105243_100238276 233
319 3300009174 Ga0105241_10040525 Ga0105241_100405253 233
320 3300009174 Ga0105241_10152660 Ga0105241_101526603 233
321 3300009176 Ga0105242_10408968 Ga0105242_104089682 233
322 3300009177 Ga0105248_10003154 Ga0105248_100031548 233
323 3300009177 Ga0105248_10079216 Ga0105248_100792163 233
324 3300009553 Ga0105249_10057083 Ga0105249_100570833 233
325 3300009553 Ga0105249_10230125 Ga0105249_102301253 233
326 3300010375 Ga0105239_10431151 Ga0105239_104311513 233
327 3300013306 Ga0163162_10200362 Ga0163162_102003623 233
328 3300014325 Ga0163163_10040769 Ga0163163_100407693 233
329 3300014326 Ga0157380_10063876 Ga0157380_100638764 233
330 3300014326 Ga0157380_10112233 Ga0157380_101122332 233
331 3300014968 Ga0157379_10041341 Ga0157379_100413413 233
332 3300025315 Ga0207697_10027519 Ga0207697_100275192 233
333 3300025893 Ga0207682_10009868 Ga0207682_100098682 233
334 3300025893 Ga0207682_10032193 Ga0207682_100321932 233
335 3300025900 Ga0207710_10015915 Ga0207710_100159153 233
336 3300025901 Ga0207688_10326085 Ga0207688_103260852 233
337 3300025903 Ga0207680_10054781 Ga0207680_100547812 233
338 3300025903 Ga0207680_10143416 Ga0207680_101434162 233
339 3300025907 Ga0207645_10003035 Ga0207645_100030354 233
340 3300025907 Ga0207645_10118929 Ga0207645_101189292 233
341 3300025907 Ga0207645_10144669 Ga0207645_101446692 233
342 3300025908 Ga0207643_10081967 Ga0207643_100819672 233
343 3300025910 Ga0207684_10375846 Ga0207684_103758462 233
344 3300025913 Ga0207695_10154997 Ga0207695_101549972 233
345 3300025918 Ga0207662_10010880 Ga0207662_100108806 233
346 3300025918 Ga0207662_10124213 Ga0207662_101242133 233
347 3300025918 Ga0207662_10215433 Ga0207662_102154332 233
348 3300025922 Ga0207646_10205723 Ga0207646_102057232 233
349 3300025923 Ga0207681_10074774 Ga0207681_100747743 233
350 3300025926 Ga0207659_10006868 Ga0207659_100068686 233
351 3300025927 Ga0207687_10169166 Ga0207687_101691663 233
352 3300025932 Ga0207690_10193243 Ga0207690_101932432 233
353 3300025933 Ga0207706_10042053 Ga0207706_100420533 233
354 3300025933 Ga0207706_10118193 Ga0207706_101181932 233
355 3300025933 Ga0207706_10217447 Ga0207706_102174471 233
356 3300025934 Ga0207686_10173161 Ga0207686_101731612 233
357 3300025935 Ga0207709_10019917 Ga0207709_100199172 233
358 3300025935 Ga0207709_10112366 Ga0207709_101123662 233
359 3300025936 Ga0207670_10088415 Ga0207670_100884152 233
360 3300025937 Ga0207669_10068344 Ga0207669_100683443 233
361 3300025937 Ga0207669_10075389 Ga0207669_100753892 233
362 3300025937 Ga0207669_10479282 Ga0207669_104792822 233
363 3300025937 Ga0207669_10798746 Ga0207669_107987461 233
364 3300025938 Ga0207704_10030957 Ga0207704_100309574 233
365 3300025940 Ga0207691_10210088 Ga0207691_102100882 233
366 3300025940 Ga0207691_10380118 Ga0207691_103801182 233
367 3300025941 Ga0207711_10003572 Ga0207711_100035727 233
368 3300025942 Ga0207689_10836238 Ga0207689_108362381 233
369 3300025960 Ga0207651_10112096 Ga0207651_101120962 233
370 3300025960 Ga0207651_10164550 Ga0207651_101645502 233
371 3300025972 Ga0207668_10169599 Ga0207668_101695992 233
372 3300025981 Ga0207640_10018564 Ga0207640_100185644 233
373 3300025981 Ga0207640_10025023 Ga0207640_100250232 233
374 3300025981 Ga0207640_10135590 Ga0207640_101355902 233
375 3300025981 Ga0207640_10187137 Ga0207640_101871372 233
376 3300025986 Ga0207658_10188646 Ga0207658_101886462 233
377 3300026023 Ga0207677_10121809 Ga0207677_101218093 233
378 3300026035 Ga0207703_10002847 Ga0207703_100028473 233
379 3300026067 Ga0207678_10410402 Ga0207678_104104022 233
380 3300026075 Ga0207708_10000915 Ga0207708_100009159 233
381 3300026075 Ga0207708_10000925 Ga0207708_1000092514 233
382 3300026075 Ga0207708_10045803 Ga0207708_100458032 233
383 3300026075 Ga0207708_10174139 Ga0207708_101741392 233
384 3300026088 Ga0207641_10005516 Ga0207641_100055167 233
385 3300026088 Ga0207641_10143756 Ga0207641_101437563 233
386 3300026089 Ga0207648_10003983 Ga0207648_100039837 233
387 3300026089 Ga0207648_10020081 Ga0207648_100200812 233
388 3300026089 Ga0207648_10125947 Ga0207648_101259472 233
389 3300026095 Ga0207676_10020656 Ga0207676_100206564 233
390 3300026118 Ga0207675_100006469 Ga0207675_1000064693 233
391 3300026118 Ga0207675_100011693 Ga0207675_1000116936 233
392 3300026118 Ga0207675_100037437 Ga0207675_1000374374 233
393 3300026118 Ga0207675_100110865 Ga0207675_1001108653 233
394 3300026118 Ga0207675_100118884 Ga0207675_1001188842 233
395 3300026121 Ga0207683_10044372 Ga0207683_100443722 233
396 3300026142 Ga0207698_10019429 Ga0207698_100194294 233
397 3300027907 Ga0207428_10036196 Ga0207428_100361963 233
398 3300027907 Ga0207428_10061853 Ga0207428_100618531 233
399 3300028380 Ga0268265_10003890 Ga0268265_100038905 233
400 3300028380 Ga0268265_10457860 Ga0268265_104578601 233
401 3300028381 Ga0268264_10262110 Ga0268264_102621102 233
402 3300028381 Ga0268264_10481941 Ga0268264_104819412 233
403 3300028573 Ga0265334_10001712 Ga0265334_100017125 233
404 3300028577 Ga0265318_10000013 Ga0265318_1000001353 233
405 3300031090 Ga0265760_10000006 Ga0265760_1000000666 233
406 3300031240 Ga0265320_10004353 Ga0265320_100043535 233
407 3300031344 Ga0265316_10055400 Ga0265316_100554001 233
408 3300031595 Ga0265313_10002743 Ga0265313_1000274310 233
409 3300031711 Ga0265314_10004422 Ga0265314_100044223 233
410 3300031731 Ga0307405_10004968 Ga0307405_100049683 233
411 3300031824 Ga0307413_10009254 Ga0307413_100092542 233
412 3300031852 Ga0307410_10015111 Ga0307410_100151112 233
413 3300031852 Ga0307410_10026045 Ga0307410_100260453 233
414 3300031901 Ga0307406_10019799 Ga0307406_100197993 233
415 3300031903 Ga0307407_10032923 Ga0307407_100329233 233
416 3300031903 Ga0307407_10124601 Ga0307407_101246013 233
417 3300031911 Ga0307412_10019030 Ga0307412_100190305 233
418 3300031995 Ga0307409_100014010 Ga0307409_1000140104 233
419 3300031995 Ga0307409_100033537 Ga0307409_1000335373 233
420 3300031995 Ga0307409_100494407 Ga0307409_1004944071 233
421 3300032002 Ga0307416_100062393 Ga0307416_1000623933 233
422 3300032002 Ga0307416_100204339 Ga0307416_1002043392 233
423 3300032004 Ga0307414_10079234 Ga0307414_100792342 233
424 3300032005 Ga0307411_10021273 Ga0307411_100212732 233
425 3300032005 Ga0307411_10403854 Ga0307411_104038542 233
426 3300032126 Ga0307415_100018371 Ga0307415_1000183714 233
427 3300032126 Ga0307415_100018681 Ga0307415_1000186812 233
428 3300034816 Ga0373930_0001136 Ga0373930_0001136_465_1166 233
429 3300034817 Ga0373948_0036438 Ga0373948_0036438_33_734 233
430 3300034818 Ga0373950_0001406 Ga0373950_0001406_2046_2747 233
431 3300034819 Ga0373958_0000185 Ga0373958_0000185_1405_2106 233
432 3300034820 Ga0373959_0002658 Ga0373959_0002658_166_867 233
433 3300034957 Ga0373938_0001008 Ga0373938_0001008_336_1037 233
434 3300035084 Ga0373928_0001001 Ga0373928_0001001_4239_4940 233
435 3300035085 Ga0373929_0000170 Ga0373929_0000170_6502_7203 233
436 3300035088 Ga0373940_0000517 Ga0373940_0000517_251_952 233
437 3300035090 Ga0373949_0001179 Ga0373949_0001179_163_864 233
438 3300035091 Ga0373951_0003979 Ga0373951_0003979_2437_3138 233
439 3300035092 Ga0373952_0000225 Ga0373952_0000225_4182_4883 233
440 3300035112 Ga0373932_0000146 Ga0373932_0000146_15609_16310 233
441 3300035114 Ga0373939_0001515 Ga0373939_0001515_4504_5205 233
442 3300035115 Ga0373941_0000792 Ga0373941_0000792_4466_5167 233
443 3300035207 Ga0373942_0000554 Ga0373942_0000554_9448_10149 233
444 3300035241 Ga0373961_0000365 Ga0373961_0000365_13635_14336 233
445 3300035241 Ga0373961_0034800 Ga0373961_0034800_555_1256 233
446 3300035242 Ga0373962_0001599 Ga0373962_0001599_1323_2024 233
447 3300035691 Ga0373931_0007878 Ga0373931_0007878_1774_2475 233
448 3300042156 Ga0439446_0126743 Ga0439446_0126743_68_769 233
449 3300044712 Ga0453684_0098924 Ga0453684_0098924_2248_2952 233
450 3300045051 Ga0451576_0010293 Ga0451576_0010293_5133_5834 233
451 3300045051 Ga0451576_0332389 Ga0451576_0332389_537_1238 233
452 3300046492 Ga0495585_0099799 Ga0495585_0099799_729_1439 233
453 3300047319 Ga0495674_0434879 Ga0495674_0434879_295_999 233
454 3300048905 Ga0496102_0795233 Ga0496102_0795233_151_855 233
455 3300048907 Ga0496104_0143018 Ga0496104_0143018_978_1682 233
456 3300048909 Ga0496106_0298344 Ga0496106_0298344_45_746 233
457 3300048909 Ga0496106_0391385 Ga0496106_0391385_52_753 233
458 3300048910 Ga0496107_0046166 Ga0496107_0046166_1481_2182 233
459 3300048912 Ga0496109_0058755 Ga0496109_0058755_21_725 233
460 3300048915 Ga0496112_0000207 Ga0496112_0000207_28397_29101 233
461 3300048916 Ga0496113_0040566 Ga0496113_0040566_930_1634 233
462 3300049522 Ga0501299_014573 Ga0501299_014573_474_1175 233
463 3300049575 Ga0501039_0041414 Ga0501039_0041414_741_1448 233
464 3300049592 Ga0501076_0513339 Ga0501076_0513339_196_897 233
465 3300050507 nmdc:mga05p37_313684_c1 nmdc:mga05p37_313684_c1_901_1602 233
466 3300050507 nmdc:mga05p37_32500_c1 nmdc:mga05p37_32500_c1_1391_2095 233
467 3300050511 nmdc:mga08y16_11561_c2 nmdc:mga08y16_11561_c2_116_820 233
468 3300050511 nmdc:mga08y16_14075_c1 nmdc:mga08y16_14075_c1_1216_1917 233
469 3300050512 nmdc:mga0n895_156829_c1 nmdc:mga0n895_156829_c1_77_778 233
470 3300050512 nmdc:mga0n895_2837_c1 nmdc:mga0n895_2837_c1_1683_2384 233
471 3300050512 nmdc:mga0n895_38863_c1 nmdc:mga0n895_38863_c1_2905_3606 233
472 3300050513 nmdc:mga0rr50_148385_c1 nmdc:mga0rr50_148385_c1_639_1343 233
473 3300050513 nmdc:mga0rr50_458692_c1 nmdc:mga0rr50_458692_c1_304_1008 233
474 3300050513 nmdc:mga0rr50_50790_c1 nmdc:mga0rr50_50790_c1_1817_2518 233
475 3300050513 nmdc:mga0rr50_58238_c1 nmdc:mga0rr50_58238_c1_1474_2175 233
476 3300050514 nmdc:mga08x19_105669_c1 nmdc:mga08x19_105669_c1_445_1146 233
477 3300050514 nmdc:mga08x19_109744_c1 nmdc:mga08x19_109744_c1_600_1301 233
478 3300050514 nmdc:mga08x19_157068_c1 nmdc:mga08x19_157068_c1_319_1023 233
479 3300050515 nmdc:mga0a205_381498_c1 nmdc:mga0a205_381498_c1_342_1046 233
480 3300059421 Ga0590071_000882 Ga0590071_000882_2463_3164 233
481 3300059423 Ga0590074_000689 Ga0590074_000689_2581_3282 233
482 3300059424 Ga0590075_000350 Ga0590075_000350_5176_5877 233
483 3300059426 Ga0590077_000438 Ga0590077_000438_8358_9059 233
484 3300060353 Ga0501082_0439825 Ga0501082_0439825_274_975 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

18

202

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

24

245

0.93

PF08659

KR

KR domain

19

186

0.79

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

20

231

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbt-assembly1.cif.gz_D crystal structure of fabg from acholeplasma laidlawii 0.9534 2 231
6xew-assembly1.cif.gz_A structure of serratia marcescens 2,3-butanediol dehydrogenase 0.9482 1 226
4nbt-assembly1.cif.gz_D crystal structure of fabg from acholeplasma laidlawii 0.9455 2 231
3op4-assembly1.cif.gz_A crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. n16961 in complex with nadp+ 0.9436 1 229
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9434 2 231
ID Description Score Start End Superfamily
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9574 5 177 3.40.50.720
4nbtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9534 2 231 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9459 1 168 3.40.50.720
4nbtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9455 2 231 3.40.50.720
3nugC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9341 2 228 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C6ZQN5-F1-model_v4 SDR family oxidoreductase 0.9908 1 230 GO:0016616
GO:0030497
AF-A0A7W1IPF5-F1-model_v4 SDR family oxidoreductase 0.9884 2 231 GO:0006633
GO:0016616
GO:0048038
AF-A0A1F2R9D9-F1-model_v4 Oxidoreductase 0.9881 3 230 GO:0006633
GO:0016616
GO:0048038
AF-K1T6U1-F1-model_v4 3-oxoacyl-(Acyl-carrier-protein) reductase 0.9865 38 231 GO:0016616
AF-A0A370NAX2-F1-model_v4 Oxidoreductase 0.9862 1 230 GO:0016616

Feature Viewer

pLDDT pTM Quality
94.07 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map