F452899

General Info

Members Datasets Scaffolds Average Seq Length
484 241 968 232

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100096651|Ga0068854_1000966512
Length 261
Sequence MGPVGGVDGAACAEATPAIDRRTTRNDLSMNMTKNDEIVIRADKVSKSVDGPDGRLTILDDVGFTLARGDSLAIVGASGSGKTTLLGLLAGLDRPSSGEITLAGERLDVLDEEARARLRRRRVGFVFQNFHLLPALNAEENVMLPLELEGGADARTRAGEALARVGLAGRKHHYPAQLSGGEQQRVALARAFVHAPEILFADEPTGNLDRRTGTAIGDLLFALNREHGTTLVLVTHDTVLAERCARRLALDGGRIVDAAAA

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
132 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
172 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
222 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
223 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
227 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
230 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
231 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
232 2734482264 Dyella sp. AD052 Isolate Unclassified
233 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
234 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
235 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
236 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
237 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
238 2919085039 Luteibacter sp. 1214 Isolate Unclassified
239 2919404418 Luteibacter sp. 3190 Isolate Unclassified
240 2941471342 Luteibacter sp. 621 Isolate Unclassified
241 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0.41
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.75
Nodule 0
Rhizoplane 2.69
Rhizosphere 82.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_100096651 3300005578 Bacteria 2207
2 JGI24736J21556_1000453 3300001904 Bacteria 7688
3 Ga0006562J51391_1029719 3300003578 Bacteria 7370
4 Ga0006562J51391_1029721 3300003578 Bacteria 2440
5 Ga0055543_1011650 3300004625 Bacteria 1792
6 Ga0065165_1000700 3300005262 Bacteria 47662
7 Ga0070658_10000030 3300005327 Bacteria 153608
8 Ga0070658_10016979 3300005327 Bacteria 5825
9 Ga0070658_10017986 3300005327 Bacteria 5653
10 Ga0070690_100040039 3300005330 Bacteria 2963
11 Ga0070690_100068676 3300005330 Bacteria 2299
12 Ga0070670_100016193 3300005331 Bacteria 6400
13 Ga0070670_100268021 3300005331 Bacteria 1489
14 Ga0070670_100554078 3300005331 Bacteria 1026
15 Ga0068869_100004014 3300005334 Bacteria 9101
16 Ga0068869_100147545 3300005334 Bacteria 1822
17 Ga0070666_10000013 3300005335 Bacteria 230442
18 Ga0070666_10000388 3300005335 Bacteria 27657
19 Ga0070666_10029472 3300005335 Bacteria 3608
20 Ga0070666_10143803 3300005335 Bacteria 1662
21 Ga0070666_10158635 3300005335 Bacteria 1581
22 Ga0068868_100006334 3300005338 Bacteria 8366
23 Ga0070668_100159482 3300005347 Bacteria 1830
24 Ga0070668_100448930 3300005347 Bacteria 1108
25 Ga0070669_100018696 3300005353 Bacteria 4953
26 Ga0070675_100028948 3300005354 Bacteria 4463
27 Ga0070673_100052657 3300005364 Bacteria 3194
28 Ga0070673_100059292 3300005364 Bacteria 3029
29 Ga0070667_100000065 3300005367 Bacteria 135172
30 Ga0070667_100024620 3300005367 Bacteria 5000
31 Ga0070667_100046354 3300005367 Bacteria 3657
32 Ga0070667_100120737 3300005367 Bacteria 2279
33 Ga0070711_100398892 3300005439 Bacteria 1116
34 Ga0070663_100000317 3300005455 Bacteria 24999
35 Ga0070663_100129402 3300005455 Bacteria 1915
36 Ga0070663_100170008 3300005455 Bacteria 1684
37 Ga0070663_100293097 3300005455 Bacteria 1300
38 Ga0070678_100662130 3300005456 Bacteria 937
39 Ga0070662_100275150 3300005457 Bacteria 1361
40 Ga0068867_100054593 3300005459 Bacteria 2951
41 Ga0070685_10001421 3300005466 Bacteria 12566
42 Ga0068853_100001386 3300005539 Bacteria 17508
43 Ga0068853_100008885 3300005539 Bacteria 8084
44 Ga0068853_100014323 3300005539 Bacteria 6490
45 Ga0068853_100015974 3300005539 Bacteria 6172
46 Ga0068853_100021188 3300005539 Bacteria 5414
47 Ga0068853_100060062 3300005539 Bacteria 3284
48 Ga0068853_100087598 3300005539 Bacteria 2732
49 Ga0068853_100100308 3300005539 Bacteria 2559
50 Ga0068853_100102310 3300005539 Bacteria 2535
51 Ga0068853_100849248 3300005539 Bacteria 876
52 Ga0070672_100024063 3300005543 Bacteria 4494
53 Ga0070693_100133740 3300005547 Bacteria 1553
54 Ga0070665_100000211 3300005548 Bacteria 100358
55 Ga0070665_100003692 3300005548 Bacteria 16210
56 Ga0070665_100009766 3300005548 Bacteria 9706
57 Ga0070665_100015547 3300005548 Bacteria 7644
58 Ga0070665_100024119 3300005548 Bacteria 6126
59 Ga0070665_100027016 3300005548 Bacteria 5779
60 Ga0070665_100086019 3300005548 Bacteria 3150
61 Ga0070665_100170654 3300005548 Bacteria 2176
62 Ga0068855_100006125 3300005563 Bacteria 14671
63 Ga0068855_100045303 3300005563 Bacteria 5202
64 Ga0068855_100205833 3300005563 Bacteria 2214
65 Ga0068855_100896479 3300005563 Bacteria 937
66 Ga0068857_100062054 3300005577 Bacteria 3322
67 Ga0068857_100085866 3300005577 Bacteria 2813
68 Ga0068854_100079193 3300005578 Bacteria 2422
69 Ga0068856_100017618 3300005614 Bacteria 6922
70 Ga0068852_100037755 3300005616 Bacteria 4053
71 Ga0068859_100095929 3300005617 Bacteria 3018
72 Ga0068859_100373281 3300005617 Bacteria 1522
73 Ga0068861_100018011 3300005719 Bacteria 5023
74 Ga0068861_100521932 3300005719 Bacteria 1077
75 Ga0068870_10003680 3300005840 Bacteria 6514
76 Ga0068863_100124098 3300005841 Bacteria 2463
77 Ga0068858_100008109 3300005842 Bacteria 10106
78 Ga0068858_100102276 3300005842 Bacteria 2673
79 Ga0068858_100806365 3300005842 Bacteria 916
80 Ga0075369_10015312 3300006186 Bacteria 3076
81 Ga0068871_100031951 3300006358 Bacteria 4153
82 Ga0068871_100067585 3300006358 Bacteria 2933
83 Ga0075430_100803708 3300006846 Bacteria 775
84 Ga0075434_100287852 3300006871 Bacteria 1663
85 Ga0075429_100467430 3300006880 Bacteria 1105
86 Ga0068865_100003536 3300006881 Bacteria 9371
87 Ga0068865_100011005 3300006881 Bacteria 5646
88 Ga0068865_100045770 3300006881 Bacteria 3000
89 Ga0097620_100095931 3300006931 Bacteria 3018
90 Ga0097620_100373273 3300006931 Bacteria 1522
91 Ga0105240_10000026 3300009093 Bacteria 355569
92 Ga0105240_10000685 3300009093 Bacteria 62397
93 Ga0105240_10018536 3300009093 Bacteria 9343
94 Ga0105240_10051039 3300009093 Bacteria 5208
95 Ga0105240_10693671 3300009093 Bacteria 1112
96 Ga0111539_10042207 3300009094 Bacteria 5480
97 Ga0105245_10369991 3300009098 Bacteria 1425
98 Ga0105247_10004486 3300009101 Bacteria 8902
99 Ga0114129_10489881 3300009147 Bacteria 1607
100 Ga0105241_10002302 3300009174 Bacteria 14344
101 Ga0105242_10002451 3300009176 Bacteria 14549
102 Ga0105248_10005666 3300009177 Bacteria 13721
103 Ga0105237_10004639 3300009545 Bacteria 15836
104 Ga0105237_10012010 3300009545 Bacteria 9149
105 Ga0105237_10013243 3300009545 Bacteria 8654
106 Ga0105237_10193615 3300009545 Bacteria 2033
107 Ga0105237_10278720 3300009545 Bacteria 1674
108 Ga0105238_10000477 3300009551 Bacteria 42013
109 Ga0105238_10000928 3300009551 Bacteria 30018
110 Ga0105238_10035800 3300009551 Bacteria 5046
111 Ga0105238_10050628 3300009551 Bacteria 4181
112 Ga0105238_10051952 3300009551 Bacteria 4121
113 Ga0105238_10060532 3300009551 Bacteria 3791
114 Ga0105238_10388029 3300009551 Bacteria 1388
115 Ga0105249_10000367 3300009553 Bacteria 44838
116 Ga0105249_10035185 3300009553 Bacteria 4541
117 Ga0105239_10015277 3300010375 Bacteria 8507
118 Ga0105239_10107457 3300010375 Bacteria 3091
119 Ga0105239_10230640 3300010375 Bacteria 2077
120 Ga0105239_10369404 3300010375 Bacteria 1621
121 Ga0105239_10580125 3300010375 Bacteria 1278
122 Ga0105246_10291030 3300011119 Bacteria 1314
123 Ga0157373_10367864 3300013100 Bacteria 1027
124 Ga0157370_10003809 3300013104 Bacteria 17595
125 Ga0157370_10008099 3300013104 Bacteria 11376
126 Ga0157370_10223213 3300013104 Bacteria 1745
127 Ga0157369_10000011 3300013105 Bacteria 271560
128 Ga0157369_10000529 3300013105 Bacteria 50408
129 Ga0157369_10095262 3300013105 Bacteria 3177
130 Ga0157374_10013357 3300013296 Bacteria 7167
131 Ga0157374_10129747 3300013296 Bacteria 2439
132 Ga0157378_10000018 3300013297 Bacteria 134075
133 Ga0163162_10000061 3300013306 Bacteria 106351
134 Ga0163162_10000508 3300013306 Bacteria 36193
135 Ga0163162_10210798 3300013306 Bacteria 2073
136 Ga0163162_10255162 3300013306 Bacteria 1885
137 Ga0163162_10620860 3300013306 Bacteria 1206
138 Ga0163162_10733689 3300013306 Bacteria 1108
139 Ga0157372_10048685 3300013307 Bacteria 4711
140 Ga0157375_10000144 3300013308 Bacteria 70151
141 Ga0157375_10002238 3300013308 Bacteria 16732
142 Ga0182008_10138327 3300014497 Bacteria 1217
143 Ga0157379_10091642 3300014968 Bacteria 2726
144 Ga0157376_10004137 3300014969 Bacteria 10053
145 Ga0157376_10022486 3300014969 Bacteria 4918
146 Ga0157376_10459529 3300014969 Bacteria 1244
147 Ga0182006_1000093 3300015261 Bacteria 106185
148 Ga0182006_1000416 3300015261 Bacteria 34218
149 Ga0182007_10002081 3300015262 Bacteria 10274
150 Ga0182005_1000536 3300015265 Bacteria 19181
151 Ga0182005_1001172 3300015265 Bacteria 10832
152 Ga0182005_1022246 3300015265 Bacteria 1737
153 Ga0163161_10052230 3300017792 Bacteria 2962
154 Ga0213876_10002499 3300021384 Bacteria 10793
155 Ga0209674_100642 3300025226 Bacteria 12654
156 Ga0209437_100605 3300025233 Bacteria 22268
157 Ga0209148_1003616 3300025254 Bacteria 4149
158 Ga0209129_1000439 3300025258 Bacteria 31012
159 Ga0209758_1009460 3300025297 Bacteria 6054
160 Ga0209256_1003092 3300025299 Bacteria 12197
161 Ga0207426_1035747 3300025302 Bacteria 1584
162 Ga0209051_1016130 3300025303 Bacteria 3403
163 Ga0209051_1032712 3300025303 Bacteria 1979
164 Ga0207710_10025248 3300025900 Bacteria 2564
165 Ga0207680_10000001 3300025903 Bacteria 1091453
166 Ga0207680_10000227 3300025903 Bacteria 27167
167 Ga0207680_10020123 3300025903 Bacteria 3584
168 Ga0207680_10099671 3300025903 Bacteria 1864
169 Ga0207680_10250703 3300025903 Bacteria 1223
170 Ga0207680_10305551 3300025903 Bacteria 1109
171 Ga0207680_10318011 3300025903 Bacteria 1088
172 Ga0207647_10000277 3300025904 Bacteria 41661
173 Ga0207647_10001812 3300025904 Bacteria 16389
174 Ga0207645_10014002 3300025907 Bacteria 5380
175 Ga0207645_10063518 3300025907 Bacteria 2359
176 Ga0207705_10001065 3300025909 Bacteria 22324
177 Ga0207705_10013746 3300025909 Bacteria 5839
178 Ga0207705_10035889 3300025909 Bacteria 3548
179 Ga0207705_10048171 3300025909 Bacteria 3065
180 Ga0207654_10003118 3300025911 Bacteria 8397
181 Ga0207654_10169230 3300025911 Bacteria 1418
182 Ga0207695_10000007 3300025913 Bacteria 1092551
183 Ga0207695_10000246 3300025913 Bacteria 140972
184 Ga0207695_10000809 3300025913 Bacteria 58219
185 Ga0207695_10001826 3300025913 Bacteria 33473
186 Ga0207695_10058579 3300025913 Bacteria 3997
187 Ga0207695_10803297 3300025913 Bacteria 821
188 Ga0207671_10001898 3300025914 Bacteria 23242
189 Ga0207671_10004252 3300025914 Bacteria 13784
190 Ga0207671_10008015 3300025914 Bacteria 9040
191 Ga0207671_10162401 3300025914 Bacteria 1731
192 Ga0207663_10307565 3300025916 Bacteria 1187
193 Ga0207663_10423630 3300025916 Bacteria 1022
194 Ga0207649_10036484 3300025920 Bacteria 2961
195 Ga0207649_10069415 3300025920 Bacteria 2244
196 Ga0207649_10083179 3300025920 Bacteria 2077
197 Ga0207649_10096913 3300025920 Bacteria 1944
198 Ga0207681_10021076 3300025923 Bacteria 4138
199 Ga0207694_10000168 3300025924 Bacteria 67647
200 Ga0207694_10004923 3300025924 Bacteria 10361
201 Ga0207694_10013947 3300025924 Bacteria 6059
202 Ga0207694_10085039 3300025924 Bacteria 2489
203 Ga0207694_10184229 3300025924 Bacteria 1694
204 Ga0207650_10005452 3300025925 Bacteria 8685
205 Ga0207650_10129103 3300025925 Bacteria 1976
206 Ga0207650_10306131 3300025925 Bacteria 1299
207 Ga0207650_10533802 3300025925 Bacteria 983
208 Ga0207659_10029802 3300025926 Bacteria 3722
209 Ga0207687_10339801 3300025927 Bacteria 1220
210 Ga0207706_10090769 3300025933 Bacteria 2686
211 Ga0207704_10003301 3300025938 Bacteria 7328
212 Ga0207704_10041613 3300025938 Bacteria 2696
213 Ga0207704_10059539 3300025938 Bacteria 2358
214 Ga0207691_10004583 3300025940 Bacteria 13385
215 Ga0207689_10013703 3300025942 Bacteria 6912
216 Ga0207689_10025606 3300025942 Bacteria 4943
217 Ga0207667_10355794 3300025949 Bacteria 1493
218 Ga0207667_10509101 3300025949 Bacteria 1220
219 Ga0207667_10768453 3300025949 Bacteria 962
220 Ga0207651_10103465 3300025960 Bacteria 2119
221 Ga0207712_10000107 3300025961 Bacteria 94254
222 Ga0207712_10000168 3300025961 Bacteria 67505
223 Ga0207712_10150019 3300025961 Bacteria 1800
224 Ga0207668_10232882 3300025972 Bacteria 1486
225 Ga0207640_10098380 3300025981 Bacteria 2045
226 Ga0207658_10000420 3300025986 Bacteria 40191
227 Ga0207658_10033504 3300025986 Bacteria 3665
228 Ga0207658_10034639 3300025986 Bacteria 3610
229 Ga0207658_10269166 3300025986 Bacteria 1455
230 Ga0207677_10285675 3300026023 Bacteria 1356
231 Ga0207677_10303783 3300026023 Bacteria 1319
232 Ga0207703_10001197 3300026035 Bacteria 24365
233 Ga0207703_10080812 3300026035 Bacteria 2708
234 Ga0207703_10291862 3300026035 Bacteria 1484
235 Ga0207639_10000066 3300026041 Bacteria 98237
236 Ga0207639_10002444 3300026041 Bacteria 12465
237 Ga0207639_10003762 3300026041 Bacteria 10210
238 Ga0207639_10004612 3300026041 Bacteria 9271
239 Ga0207639_10041871 3300026041 Bacteria 3430
240 Ga0207639_10196436 3300026041 Bacteria 1727
241 Ga0207639_10314643 3300026041 Bacteria 1388
242 Ga0207678_10000509 3300026067 Bacteria 35261
243 Ga0207678_10010598 3300026067 Bacteria 8099
244 Ga0207678_10191404 3300026067 Bacteria 1748
245 Ga0207678_10314530 3300026067 Bacteria 1347
246 Ga0207678_10750597 3300026067 Bacteria 860
247 Ga0207702_10103022 3300026078 Bacteria 2524
248 Ga0207641_10031489 3300026088 Bacteria 4399
249 Ga0207641_10053178 3300026088 Bacteria 3432
250 Ga0207641_10150920 3300026088 Bacteria 2104
251 Ga0207641_10339495 3300026088 Bacteria 1429
252 Ga0207648_10009809 3300026089 Bacteria 9146
253 Ga0207674_10016250 3300026116 Bacteria 8152
254 Ga0207674_10232446 3300026116 Bacteria 1791
255 Ga0207675_100026635 3300026118 Bacteria 5382
256 Ga0207683_10007139 3300026121 Bacteria 9575
257 Ga0207683_10234367 3300026121 Bacteria 1674
258 Ga0207698_10008130 3300026142 Bacteria 6612
259 Ga0207698_10080547 3300026142 Bacteria 2624
260 Ga0207698_10158727 3300026142 Bacteria 1975
261 Ga0268266_10000001 3300028379 Bacteria 4040580
262 Ga0268266_10000007 3300028379 Bacteria 1372921
263 Ga0268266_10000059 3300028379 Bacteria 269485
264 Ga0268266_10028032 3300028379 Bacteria 4788
265 Ga0268266_10603823 3300028379 Bacteria 1054
266 Ga0268265_10317407 3300028380 Bacteria 1410
267 Ga0268265_10540315 3300028380 Bacteria 1105
268 Ga0307509_10257733 3300031507 Bacteria 1522
269 Ga0307508_10004577 3300031616 Bacteria 13461
270 Ga0307412_10001041 3300031911 Bacteria 15843
271 Ga0307507_10132756 3300033179 Bacteria 1941
272 Ga0307510_10000112 3300033180 Bacteria 64759
273 Ga0373944_0059092 3300035089 Bacteria 1226
274 Ga0373937_0014408 3300036401 Bacteria 6981
275 Ga0436365_0055304 3300039437 Bacteria 3613
276 Ga0436365_1603528 3300039437 Bacteria 18850
277 Ga0439436_0000016 3300041404 Bacteria 80941
278 Ga0439465_0005618 3300041413 Bacteria 3994
279 Ga0451791_1693520 3300041451 Bacteria 865
280 Ga0451793_1385900 3300041452 Bacteria 752
281 Ga0451793_1427782 3300041452 Bacteria 2196
282 Ga0451807_0786114 3300041486 Bacteria 821
283 Ga0451843_0456557 3300041509 Bacteria 998
284 Ga0450908_000014 3300042184 Bacteria 41620
285 Ga0466972_0000803 3300044658 Bacteria 14935
286 Ga0466982_0000063 3300044672 Bacteria 29669
287 Ga0466970_0001477 3300044765 Bacteria 11357
288 Ga0466959_0100111 3300045049 Bacteria 2075
289 Ga0495617_000750 3300046452 Bacteria 15942
290 Ga0495638_0000078 3300046460 Bacteria 157545
291 Ga0495651_0243943 3300046462 Bacteria 1231
292 Ga0495650_0002172 3300046471 Bacteria 16594
293 Ga0495650_0032317 3300046471 Bacteria 2341
294 Ga0495584_0020240 3300046491 Bacteria 3382
295 Ga0495585_0000366 3300046492 Bacteria 43799
296 Ga0495585_0005846 3300046492 Bacteria 7714
297 Ga0495607_0000040 3300046501 Bacteria 133419
298 Ga0495607_0000140 3300046501 Bacteria 76410
299 Ga0495607_0004707 3300046501 Bacteria 9987
300 Ga0495583_0233076 3300046506 Bacteria 741
301 Ga0495606_0000479 3300046507 Bacteria 65601
302 Ga0495606_0001160 3300046507 Bacteria 37244
303 Ga0495606_0002054 3300046507 Bacteria 24650
304 Ga0495606_0013687 3300046507 Bacteria 6391
305 Ga0495606_0133536 3300046507 Bacteria 1473
306 Ga0495606_0237350 3300046507 Bacteria 1018
307 Ga0495610_0003265 3300046512 Bacteria 12790
308 Ga0495610_0016262 3300046512 Bacteria 4291
309 Ga0495616_0000045 3300046513 Bacteria 113226
310 Ga0495616_0002958 3300046513 Bacteria 11034
311 Ga0495620_0000141 3300046515 Bacteria 58744
312 Ga0495620_0033873 3300046515 Bacteria 2313
313 Ga0495630_0642237 3300046517 Bacteria 813
314 Ga0495631_0000025 3300046518 Bacteria 89262
315 Ga0495631_0000610 3300046518 Bacteria 23558
316 Ga0495632_0000016 3300046519 Bacteria 232022
317 Ga0495632_0020332 3300046519 Bacteria 3595
318 Ga0495632_0048020 3300046519 Bacteria 2115
319 Ga0495637_0007133 3300046520 Bacteria 5563
320 Ga0495648_0000508 3300046524 Bacteria 41940
321 Ga0495648_0010386 3300046524 Bacteria 7094
322 Ga0495665_0086751 3300046531 Bacteria 1645
323 Ga0495609_0038503 3300046538 Bacteria 2155
324 Ga0495668_0001459 3300046616 Bacteria 22747
325 Ga0495611_0000001 3300046648 Bacteria 2628469
326 Ga0495611_0000073 3300046648 Bacteria 70704
327 Ga0495611_0273092 3300046648 Bacteria 781
328 Ga0495625_0000041 3300046660 Bacteria 206598
329 Ga0495625_0044064 3300046660 Bacteria 3232
330 Ga0495625_0053333 3300046660 Bacteria 2892
331 Ga0495661_0003999 3300046665 Bacteria 10750
332 Ga0495661_0070294 3300046665 Bacteria 2049
333 Ga0495657_0096849 3300046675 Bacteria 1885
334 Ga0495623_0291386 3300046679 Bacteria 905
335 Ga0495647_0009554 3300046681 Bacteria 3288
336 Ga0495658_0009835 3300046683 Bacteria 4769
337 Ga0495670_0012908 3300046691 Bacteria 4106
338 Ga0495671_0000182 3300046692 Bacteria 55867
339 Ga0495649_0071236 3300046694 Bacteria 1863
340 Ga0495589_0000008 3300046794 Bacteria 266071
341 Ga0495660_0000149 3300046810 Bacteria 76124
342 Ga0495660_0000169 3300046810 Bacteria 70663
343 Ga0495604_0130984 3300047317 Bacteria 1803
344 Ga0495683_0004682 3300047323 Bacteria 7707
345 Ga0495679_000004 3300047446 Bacteria 748056
346 Ga0495673_0000004 3300047469 Bacteria 1354526
347 Ga0495673_0000278 3300047469 Bacteria 69367
348 Ga0495673_0001102 3300047469 Bacteria 23237
349 Ga0495686_0000017 3300047472 Bacteria 435554
350 Ga0495686_0001145 3300047472 Bacteria 31190
351 Ga0495686_0006922 3300047472 Bacteria 8576
352 Ga0495686_0067779 3300047472 Bacteria 2202
353 Ga0496100_0000429 3300048903 Bacteria 20428
354 Ga0496101_0104797 3300048904 Bacteria 2121
355 Ga0496102_0832589 3300048905 Bacteria 845
356 Ga0496104_0000005 3300048907 Bacteria 620360
357 Ga0496105_0000018 3300048908 Bacteria 197208
358 Ga0496106_0012978 3300048909 Bacteria 6147
359 Ga0496107_0113629 3300048910 Bacteria 1992
360 Ga0496107_0117999 3300048910 Bacteria 1954
361 Ga0496115_0000077 3300048918 Bacteria 89885
362 Ga0496116_0112929 3300048919 Bacteria 1591
363 Ga0496117_0070715 3300048920 Bacteria 2342
364 Ga0496117_0164409 3300048920 Bacteria 1296
365 Ga0496118_0000101 3300048921 Bacteria 159577
366 Ga0496118_0000968 3300048921 Bacteria 44862
367 Ga0496118_0001481 3300048921 Bacteria 35145
368 Ga0496118_0005672 3300048921 Bacteria 14071
369 Ga0496118_0008000 3300048921 Bacteria 11049
370 Ga0496118_0013028 3300048921 Bacteria 7910
371 Ga0496119_0016143 3300048922 Bacteria 5703
372 Ga0496119_0202641 3300048922 Bacteria 1026
373 Ga0496121_0000399 3300048924 Bacteria 86768
374 Ga0496121_0001549 3300048924 Bacteria 38481
375 Ga0496121_0003203 3300048924 Bacteria 23561
376 Ga0496121_0091462 3300048924 Bacteria 2375
377 Ga0496122_0000212 3300048925 Bacteria 129245
378 Ga0496122_0015259 3300048925 Bacteria 7351
379 Ga0496122_0016943 3300048925 Bacteria 6847
380 Ga0496122_0027254 3300048925 Bacteria 4890
381 Ga0496123_0001661 3300048926 Bacteria 29841
382 Ga0496123_0007351 3300048926 Bacteria 10427
383 Ga0496123_0011594 3300048926 Bacteria 7620
384 Ga0496123_0064734 3300048926 Bacteria 2328
385 Ga0496124_0000333 3300048927 Bacteria 87394
386 Ga0496124_0000364 3300048927 Bacteria 82831
387 Ga0496125_0019349 3300048928 Bacteria 6426
388 Ga0496125_0071239 3300048928 Bacteria 2717
389 Ga0496126_0000047 3300048929 Bacteria 322212
390 Ga0496126_0026665 3300048929 Bacteria 5537
391 Ga0495678_000612 3300049459 Bacteria 33460
392 Ga0495682_0002092 3300049460 Bacteria 9734
393 Ga0495682_0010132 3300049460 Bacteria 3659
394 Ga0501031_0005792 3300049568 Bacteria 8053
395 Ga0501032_0001989 3300049569 Bacteria 16094
396 Ga0501032_0002181 3300049569 Bacteria 15414
397 Ga0501032_0031454 3300049569 Bacteria 3639
398 Ga0501033_0000726 3300049570 Bacteria 30269
399 Ga0501033_0076403 3300049570 Bacteria 2458
400 Ga0501033_0368605 3300049570 Bacteria 1004
401 Ga0501034_0002127 3300049571 Bacteria 24610
402 Ga0501034_0005967 3300049571 Bacteria 13182
403 Ga0501034_0011585 3300049571 Bacteria 9131
404 Ga0501034_0153420 3300049571 Bacteria 2278
405 Ga0501034_0309300 3300049571 Bacteria 1515
406 Ga0501036_0001181 3300049572 Bacteria 19879
407 Ga0501036_0044373 3300049572 Bacteria 3765
408 Ga0501036_0081057 3300049572 Bacteria 2743
409 Ga0501037_0002533 3300049573 Bacteria 13200
410 Ga0501037_0004913 3300049573 Bacteria 9730
411 Ga0501037_0016570 3300049573 Bacteria 5423
412 Ga0501037_0201916 3300049573 Bacteria 1404
413 Ga0501038_0000880 3300049574 Bacteria 26600
414 Ga0501038_0003700 3300049574 Bacteria 14249
415 Ga0501038_0666225 3300049574 Bacteria 782
416 Ga0501039_0000356 3300049575 Bacteria 32594
417 Ga0501039_0010888 3300049575 Bacteria 6933
418 Ga0501039_0053413 3300049575 Bacteria 3126
419 Ga0501043_0011840 3300049579 Bacteria 6833
420 Ga0501043_0053042 3300049579 Bacteria 3184
421 Ga0501043_0167664 3300049579 Bacteria 1714
422 Ga0501046_0005829 3300049580 Bacteria 10986
423 Ga0501046_0013949 3300049580 Bacteria 6788
424 Ga0501047_0001556 3300049581 Bacteria 22458
425 Ga0501047_0013608 3300049581 Bacteria 7717
426 Ga0501047_0018052 3300049581 Bacteria 6760
427 Ga0501047_0103721 3300049581 Bacteria 2724
428 Ga0501048_0004330 3300049582 Bacteria 10813
429 Ga0501068_0042566 3300049584 Bacteria 2731
430 Ga0501069_0002373 3300049585 Bacteria 9550
431 Ga0501070_0003423 3300049586 Bacteria 13763
432 Ga0501070_0026241 3300049586 Bacteria 4890
433 Ga0501070_0096158 3300049586 Bacteria 2450
434 Ga0501070_0486284 3300049586 Bacteria 992
435 Ga0501070_0642911 3300049586 Bacteria 843
436 Ga0501071_0009387 3300049587 Bacteria 6514
437 Ga0501071_0017978 3300049587 Bacteria 4889
438 Ga0501073_0010612 3300049589 Bacteria 6740
439 Ga0501073_0197707 3300049589 Bacteria 1390
440 Ga0501074_0008743 3300049590 Bacteria 7341
441 Ga0501074_0066791 3300049590 Bacteria 2586
442 Ga0501079_0027128 3300049741 Bacteria 4390
443 Ga0501080_0003950 3300049742 Bacteria 13129
444 Ga0501080_0005250 3300049742 Bacteria 11540
445 Ga0501080_0046765 3300049742 Bacteria 4028
446 Ga0501083_0006387 3300049744 Bacteria 8355
447 Ga0501035_0000788 3300049822 Bacteria 33923
448 Ga0501035_0005913 3300049822 Bacteria 11519
449 Ga0501035_0008269 3300049822 Bacteria 9695
450 Ga0501035_0009770 3300049822 Bacteria 8914
451 Ga0501044_0001348 3300049823 Bacteria 28861
452 Ga0501044_0002789 3300049823 Bacteria 19900
453 Ga0501044_0004889 3300049823 Bacteria 14973
454 Ga0501044_0017117 3300049823 Bacteria 7779
455 Ga0501044_0018306 3300049823 Bacteria 7506
456 Ga0501044_0052543 3300049823 Bacteria 4198
457 nmdc:mga09592_699002_c1 3300050508 Bacteria 863
458 nmdc:mga0n895_273998_c1 3300050512 Bacteria 1711
459 Ga0500643_000020 3300053087 Bacteria 290328
460 Ga0500643_001707 3300053087 Bacteria 12199
461 Ga0500651_0000367 3300053093 Bacteria 24844
462 Ga0500651_0001150 3300053093 Bacteria 13107
463 Ga0500555_001654 3300053103 Bacteria 6734
464 Ga0500597_000041 3300053120 Bacteria 25106
465 Ga0500628_000128 3300053129 Bacteria 15297
466 Ga0500568_0002290 3300053139 Bacteria 11396
467 Ga0500616_0028816 3300053153 Bacteria 3058
468 Ga0500645_000617 3300053730 Bacteria 22792
469 Ga0500661_002705 3300055283 Bacteria 3351
470 Ga0501082_0001878 3300060353 Bacteria 18489
471 Ga0501082_0188085 3300060353 Bacteria 1796
472 Ga0530510_0343599 3300061734 Bacteria 1120
473 2595446980 2593339238 Bacteria 4182970
474 2595449738 2593339239 Bacteria 4124669
475 2735833670 2734482264 Unclassified 5014763
476 2819564119 2818991440 Bacteria 4774720
477 2842917672 2842914999 Bacteria 4419378
478 2842920046 2842918807 Bacteria 4289178
479 2884341658 2884338543 Bacteria 4610696
480 2904464755 2904463128 Bacteria 4775606
481 2919088157 2919085039 Bacteria 4532964
482 2919406269 2919404418 Bacteria 4232372
483 2941473068 2941471342 Bacteria 5018624
484 2953995335 2953994433 Bacteria 4303959
485 Ga0068854_100096651
486 JGI24736J21556_1000453
487 Ga0006562J51391_1029719
488 Ga0006562J51391_1029721
489 Ga0055543_1011650
490 Ga0065165_1000700
491 Ga0070658_10000030
492 Ga0070658_10016979
493 Ga0070658_10017986
494 Ga0070690_100040039
495 Ga0070690_100068676
496 Ga0070670_100016193
497 Ga0070670_100268021
498 Ga0070670_100554078
499 Ga0068869_100004014
500 Ga0068869_100147545
501 Ga0070666_10000013
502 Ga0070666_10000388
503 Ga0070666_10029472
504 Ga0070666_10143803
505 Ga0070666_10158635
506 Ga0068868_100006334
507 Ga0070668_100159482
508 Ga0070668_100448930
509 Ga0070669_100018696
510 Ga0070675_100028948
511 Ga0070673_100052657
512 Ga0070673_100059292
513 Ga0070667_100000065
514 Ga0070667_100024620
515 Ga0070667_100046354
516 Ga0070667_100120737
517 Ga0070711_100398892
518 Ga0070663_100000317
519 Ga0070663_100129402
520 Ga0070663_100170008
521 Ga0070663_100293097
522 Ga0070678_100662130
523 Ga0070662_100275150
524 Ga0068867_100054593
525 Ga0070685_10001421
526 Ga0068853_100001386
527 Ga0068853_100008885
528 Ga0068853_100014323
529 Ga0068853_100015974
530 Ga0068853_100021188
531 Ga0068853_100060062
532 Ga0068853_100087598
533 Ga0068853_100100308
534 Ga0068853_100102310
535 Ga0068853_100849248
536 Ga0070672_100024063
537 Ga0070693_100133740
538 Ga0070665_100000211
539 Ga0070665_100003692
540 Ga0070665_100009766
541 Ga0070665_100015547
542 Ga0070665_100024119
543 Ga0070665_100027016
544 Ga0070665_100086019
545 Ga0070665_100170654
546 Ga0068855_100006125
547 Ga0068855_100045303
548 Ga0068855_100205833
549 Ga0068855_100896479
550 Ga0068857_100062054
551 Ga0068857_100085866
552 Ga0068854_100079193
553 Ga0068856_100017618
554 Ga0068852_100037755
555 Ga0068859_100095929
556 Ga0068859_100373281
557 Ga0068861_100018011
558 Ga0068861_100521932
559 Ga0068870_10003680
560 Ga0068863_100124098
561 Ga0068858_100008109
562 Ga0068858_100102276
563 Ga0068858_100806365
564 Ga0075369_10015312
565 Ga0068871_100031951
566 Ga0068871_100067585
567 Ga0075430_100803708
568 Ga0075434_100287852
569 Ga0075429_100467430
570 Ga0068865_100003536
571 Ga0068865_100011005
572 Ga0068865_100045770
573 Ga0097620_100095931
574 Ga0097620_100373273
575 Ga0105240_10000026
576 Ga0105240_10000685
577 Ga0105240_10018536
578 Ga0105240_10051039
579 Ga0105240_10693671
580 Ga0111539_10042207
581 Ga0105245_10369991
582 Ga0105247_10004486
583 Ga0114129_10489881
584 Ga0105241_10002302
585 Ga0105242_10002451
586 Ga0105248_10005666
587 Ga0105237_10004639
588 Ga0105237_10012010
589 Ga0105237_10013243
590 Ga0105237_10193615
591 Ga0105237_10278720
592 Ga0105238_10000477
593 Ga0105238_10000928
594 Ga0105238_10035800
595 Ga0105238_10050628
596 Ga0105238_10051952
597 Ga0105238_10060532
598 Ga0105238_10388029
599 Ga0105249_10000367
600 Ga0105249_10035185
601 Ga0105239_10015277
602 Ga0105239_10107457
603 Ga0105239_10230640
604 Ga0105239_10369404
605 Ga0105239_10580125
606 Ga0105246_10291030
607 Ga0157373_10367864
608 Ga0157370_10003809
609 Ga0157370_10008099
610 Ga0157370_10223213
611 Ga0157369_10000011
612 Ga0157369_10000529
613 Ga0157369_10095262
614 Ga0157374_10013357
615 Ga0157374_10129747
616 Ga0157378_10000018
617 Ga0163162_10000061
618 Ga0163162_10000508
619 Ga0163162_10210798
620 Ga0163162_10255162
621 Ga0163162_10620860
622 Ga0163162_10733689
623 Ga0157372_10048685
624 Ga0157375_10000144
625 Ga0157375_10002238
626 Ga0182008_10138327
627 Ga0157379_10091642
628 Ga0157376_10004137
629 Ga0157376_10022486
630 Ga0157376_10459529
631 Ga0182006_1000093
632 Ga0182006_1000416
633 Ga0182007_10002081
634 Ga0182005_1000536
635 Ga0182005_1001172
636 Ga0182005_1022246
637 Ga0163161_10052230
638 Ga0213876_10002499
639 Ga0209674_100642
640 Ga0209437_100605
641 Ga0209148_1003616
642 Ga0209129_1000439
643 Ga0209758_1009460
644 Ga0209256_1003092
645 Ga0207426_1035747
646 Ga0209051_1016130
647 Ga0209051_1032712
648 Ga0207710_10025248
649 Ga0207680_10000001
650 Ga0207680_10000227
651 Ga0207680_10020123
652 Ga0207680_10099671
653 Ga0207680_10250703
654 Ga0207680_10305551
655 Ga0207680_10318011
656 Ga0207647_10000277
657 Ga0207647_10001812
658 Ga0207645_10014002
659 Ga0207645_10063518
660 Ga0207705_10001065
661 Ga0207705_10013746
662 Ga0207705_10035889
663 Ga0207705_10048171
664 Ga0207654_10003118
665 Ga0207654_10169230
666 Ga0207695_10000007
667 Ga0207695_10000246
668 Ga0207695_10000809
669 Ga0207695_10001826
670 Ga0207695_10058579
671 Ga0207695_10803297
672 Ga0207671_10001898
673 Ga0207671_10004252
674 Ga0207671_10008015
675 Ga0207671_10162401
676 Ga0207663_10307565
677 Ga0207663_10423630
678 Ga0207649_10036484
679 Ga0207649_10069415
680 Ga0207649_10083179
681 Ga0207649_10096913
682 Ga0207681_10021076
683 Ga0207694_10000168
684 Ga0207694_10004923
685 Ga0207694_10013947
686 Ga0207694_10085039
687 Ga0207694_10184229
688 Ga0207650_10005452
689 Ga0207650_10129103
690 Ga0207650_10306131
691 Ga0207650_10533802
692 Ga0207659_10029802
693 Ga0207687_10339801
694 Ga0207706_10090769
695 Ga0207704_10003301
696 Ga0207704_10041613
697 Ga0207704_10059539
698 Ga0207691_10004583
699 Ga0207689_10013703
700 Ga0207689_10025606
701 Ga0207667_10355794
702 Ga0207667_10509101
703 Ga0207667_10768453
704 Ga0207651_10103465
705 Ga0207712_10000107
706 Ga0207712_10000168
707 Ga0207712_10150019
708 Ga0207668_10232882
709 Ga0207640_10098380
710 Ga0207658_10000420
711 Ga0207658_10033504
712 Ga0207658_10034639
713 Ga0207658_10269166
714 Ga0207677_10285675
715 Ga0207677_10303783
716 Ga0207703_10001197
717 Ga0207703_10080812
718 Ga0207703_10291862
719 Ga0207639_10000066
720 Ga0207639_10002444
721 Ga0207639_10003762
722 Ga0207639_10004612
723 Ga0207639_10041871
724 Ga0207639_10196436
725 Ga0207639_10314643
726 Ga0207678_10000509
727 Ga0207678_10010598
728 Ga0207678_10191404
729 Ga0207678_10314530
730 Ga0207678_10750597
731 Ga0207702_10103022
732 Ga0207641_10031489
733 Ga0207641_10053178
734 Ga0207641_10150920
735 Ga0207641_10339495
736 Ga0207648_10009809
737 Ga0207674_10016250
738 Ga0207674_10232446
739 Ga0207675_100026635
740 Ga0207683_10007139
741 Ga0207683_10234367
742 Ga0207698_10008130
743 Ga0207698_10080547
744 Ga0207698_10158727
745 Ga0268266_10000001
746 Ga0268266_10000007
747 Ga0268266_10000059
748 Ga0268266_10028032
749 Ga0268266_10603823
750 Ga0268265_10317407
751 Ga0268265_10540315
752 Ga0307509_10257733
753 Ga0307508_10004577
754 Ga0307412_10001041
755 Ga0307507_10132756
756 Ga0307510_10000112
757 Ga0373944_0059092
758 Ga0373937_0014408
759 Ga0436365_0055304
760 Ga0436365_1603528
761 Ga0439436_0000016
762 Ga0439465_0005618
763 Ga0451791_1693520
764 Ga0451793_1385900
765 Ga0451793_1427782
766 Ga0451807_0786114
767 Ga0451843_0456557
768 Ga0450908_000014
769 Ga0466972_0000803
770 Ga0466982_0000063
771 Ga0466970_0001477
772 Ga0466959_0100111
773 Ga0495617_000750
774 Ga0495638_0000078
775 Ga0495651_0243943
776 Ga0495650_0002172
777 Ga0495650_0032317
778 Ga0495584_0020240
779 Ga0495585_0000366
780 Ga0495585_0005846
781 Ga0495607_0000040
782 Ga0495607_0000140
783 Ga0495607_0004707
784 Ga0495583_0233076
785 Ga0495606_0000479
786 Ga0495606_0001160
787 Ga0495606_0002054
788 Ga0495606_0013687
789 Ga0495606_0133536
790 Ga0495606_0237350
791 Ga0495610_0003265
792 Ga0495610_0016262
793 Ga0495616_0000045
794 Ga0495616_0002958
795 Ga0495620_0000141
796 Ga0495620_0033873
797 Ga0495630_0642237
798 Ga0495631_0000025
799 Ga0495631_0000610
800 Ga0495632_0000016
801 Ga0495632_0020332
802 Ga0495632_0048020
803 Ga0495637_0007133
804 Ga0495648_0000508
805 Ga0495648_0010386
806 Ga0495665_0086751
807 Ga0495609_0038503
808 Ga0495668_0001459
809 Ga0495611_0000001
810 Ga0495611_0000073
811 Ga0495611_0273092
812 Ga0495625_0000041
813 Ga0495625_0044064
814 Ga0495625_0053333
815 Ga0495661_0003999
816 Ga0495661_0070294
817 Ga0495657_0096849
818 Ga0495623_0291386
819 Ga0495647_0009554
820 Ga0495658_0009835
821 Ga0495670_0012908
822 Ga0495671_0000182
823 Ga0495649_0071236
824 Ga0495589_0000008
825 Ga0495660_0000149
826 Ga0495660_0000169
827 Ga0495604_0130984
828 Ga0495683_0004682
829 Ga0495679_000004
830 Ga0495673_0000004
831 Ga0495673_0000278
832 Ga0495673_0001102
833 Ga0495686_0000017
834 Ga0495686_0001145
835 Ga0495686_0006922
836 Ga0495686_0067779
837 Ga0496100_0000429
838 Ga0496101_0104797
839 Ga0496102_0832589
840 Ga0496104_0000005
841 Ga0496105_0000018
842 Ga0496106_0012978
843 Ga0496107_0113629
844 Ga0496107_0117999
845 Ga0496115_0000077
846 Ga0496116_0112929
847 Ga0496117_0070715
848 Ga0496117_0164409
849 Ga0496118_0000101
850 Ga0496118_0000968
851 Ga0496118_0001481
852 Ga0496118_0005672
853 Ga0496118_0008000
854 Ga0496118_0013028
855 Ga0496119_0016143
856 Ga0496119_0202641
857 Ga0496121_0000399
858 Ga0496121_0001549
859 Ga0496121_0003203
860 Ga0496121_0091462
861 Ga0496122_0000212
862 Ga0496122_0015259
863 Ga0496122_0016943
864 Ga0496122_0027254
865 Ga0496123_0001661
866 Ga0496123_0007351
867 Ga0496123_0011594
868 Ga0496123_0064734
869 Ga0496124_0000333
870 Ga0496124_0000364
871 Ga0496125_0019349
872 Ga0496125_0071239
873 Ga0496126_0000047
874 Ga0496126_0026665
875 Ga0495678_000612
876 Ga0495682_0002092
877 Ga0495682_0010132
878 Ga0501031_0005792
879 Ga0501032_0001989
880 Ga0501032_0002181
881 Ga0501032_0031454
882 Ga0501033_0000726
883 Ga0501033_0076403
884 Ga0501033_0368605
885 Ga0501034_0002127
886 Ga0501034_0005967
887 Ga0501034_0011585
888 Ga0501034_0153420
889 Ga0501034_0309300
890 Ga0501036_0001181
891 Ga0501036_0044373
892 Ga0501036_0081057
893 Ga0501037_0002533
894 Ga0501037_0004913
895 Ga0501037_0016570
896 Ga0501037_0201916
897 Ga0501038_0000880
898 Ga0501038_0003700
899 Ga0501038_0666225
900 Ga0501039_0000356
901 Ga0501039_0010888
902 Ga0501039_0053413
903 Ga0501043_0011840
904 Ga0501043_0053042
905 Ga0501043_0167664
906 Ga0501046_0005829
907 Ga0501046_0013949
908 Ga0501047_0001556
909 Ga0501047_0013608
910 Ga0501047_0018052
911 Ga0501047_0103721
912 Ga0501048_0004330
913 Ga0501068_0042566
914 Ga0501069_0002373
915 Ga0501070_0003423
916 Ga0501070_0026241
917 Ga0501070_0096158
918 Ga0501070_0486284
919 Ga0501070_0642911
920 Ga0501071_0009387
921 Ga0501071_0017978
922 Ga0501073_0010612
923 Ga0501073_0197707
924 Ga0501074_0008743
925 Ga0501074_0066791
926 Ga0501079_0027128
927 Ga0501080_0003950
928 Ga0501080_0005250
929 Ga0501080_0046765
930 Ga0501083_0006387
931 Ga0501035_0000788
932 Ga0501035_0005913
933 Ga0501035_0008269
934 Ga0501035_0009770
935 Ga0501044_0001348
936 Ga0501044_0002789
937 Ga0501044_0004889
938 Ga0501044_0017117
939 Ga0501044_0018306
940 Ga0501044_0052543
941 nmdc:mga09592_699002_c1
942 nmdc:mga0n895_273998_c1
943 Ga0500643_000020
944 Ga0500643_001707
945 Ga0500651_0000367
946 Ga0500651_0001150
947 Ga0500555_001654
948 Ga0500597_000041
949 Ga0500628_000128
950 Ga0500568_0002290
951 Ga0500616_0028816
952 Ga0500645_000617
953 Ga0500661_002705
954 Ga0501082_0001878
955 Ga0501082_0188085
956 Ga0530510_0343599
957 2595446980
958 2595449738
959 2735833670
960 2819564119
961 2842917672
962 2842920046
963 2884341658
964 2904464755
965 2919088157
966 2919406269
967 2941473068
968 2953995335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

59

206

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.962 9 224
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9609 7 225
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9593 7 225
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9567 8 225
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9521 8 223
ID Description Score Start End Superfamily
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9806 7 228 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9762 35 225 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9746 7 224 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9688 7 225 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.962 7 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A316F6D1-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9941 9 225 GO:0005524
GO:0016887
AF-A0A2D5TSH3-F1-model_v4 ABC transporter 0.9895 7 224 GO:0005524
GO:0016887
AF-R6CP31-F1-model_v4 deleted 0.9836 7 225
AF-A9KJN2-F1-model_v4 ABC transporter related 0.9818 2 224 GO:0005524
GO:0016887
AF-A0A351NPA2-F1-model_v4 deleted 0.9808 7 228

Map