F452905

General Info

Members Datasets Scaffolds Average Seq Length
484 281 477 148

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10478500|Ga0075362_104785002
Length 164
Sequence MPIPPMRACSARLMNEEKALKKVEIFTDGACKGNPGPGGWGAILRMGPHEKEMSGSEAQTTNNRMEMTAAIKGLRALIEPCDVTLYTDSKYVIEGITKWVHGWKRNGWINASKQPVRNADLWHELIDAAQQHQVTWQWVRGHDGHVENERADKLASDAALSVGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
5 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
6 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
7 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
170 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
196 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
238 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
239 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
240 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
255 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
256 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
259 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
262 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
263 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
264 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
265 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
266 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
267 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
268 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
269 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
272 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
278 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
279 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0.21
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.88
Nodule 0.21
Rhizoplane 6.2
Rhizosphere 71.07
Stem 0
Stem Tuber 0
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3108969 2162886007 Bacteria 24240
2 JGI24740J21852_10008630 3300001979 Bacteria 4049
3 JGI24739J22299_10001175 3300001989 Bacteria 9803
4 JGI24737J22298_10001420 3300001990 Bacteria 8522
5 JGI24737J22298_10013441 3300001990 Bacteria 2664
6 JGI24735J21928_10003072 3300002067 Bacteria 5722
7 JGI24735J21928_10013286 3300002067 Bacteria 2590
8 JGI24735J21928_10019507 3300002067 Bacteria 2083
9 JGI24738J21930_10000047 3300002075 Bacteria 24272
10 JGI24751J29686_10000052 3300002459 Bacteria 65492
11 JGI25165J46597_1000021 3300003214 Bacteria 359288
12 JGI25165J46597_1000050 3300003214 Bacteria 242776
13 rootH1_10036854 3300003316 Bacteria 1234
14 Ga0055525_1000070 3300003759 Bacteria 183047
15 Ga0055542_1009933 3300003762 Bacteria 1770
16 Ga0065165_1001234 3300005262 Bacteria 29249
17 Ga0065704_10021604 3300005289 Bacteria 1791
18 Ga0065704_10070270 3300005289 Bacteria 42849
19 Ga0065707_10093884 3300005295 Bacteria 3567
20 Ga0070658_10000735 3300005327 Bacteria 28153
21 Ga0070658_10000736 3300005327 Bacteria 28080
22 Ga0070658_10005617 3300005327 Bacteria 10172
23 Ga0070658_10096950 3300005327 Bacteria 2435
24 Ga0070658_11405066 3300005327 Bacteria 606
25 Ga0070676_10009733 3300005328 Bacteria 5199
26 Ga0070670_100000024 3300005331 Bacteria 189811
27 Ga0070670_100063821 3300005331 Bacteria 3160
28 Ga0070670_100203340 3300005331 Bacteria 1721
29 Ga0068869_100000680 3300005334 Bacteria 19228
30 Ga0070666_10098989 3300005335 Bacteria 2008
31 Ga0070666_10152379 3300005335 Bacteria 1613
32 Ga0070666_10206544 3300005335 Bacteria 1382
33 Ga0070682_100834325 3300005337 Bacteria 752
34 Ga0068868_100000198 3300005338 Bacteria 40253
35 Ga0070660_100000950 3300005339 Bacteria 19357
36 Ga0070660_100001991 3300005339 Bacteria 14096
37 Ga0070668_100214219 3300005347 Bacteria 1586
38 Ga0070669_100000047 3300005353 Bacteria 118892
39 Ga0070669_100001347 3300005353 Bacteria 17705
40 Ga0070669_100003039 3300005353 Bacteria 12071
41 Ga0070669_100612967 3300005353 Bacteria 913
42 Ga0070671_100000040 3300005355 Bacteria 92357
43 Ga0070671_100000565 3300005355 Bacteria 26245
44 Ga0070671_100030283 3300005355 Bacteria 4466
45 Ga0070673_100000002 3300005364 Bacteria 225084
46 Ga0070659_100606316 3300005366 Bacteria 941
47 Ga0070659_101588680 3300005366 Bacteria 584
48 Ga0070667_100004441 3300005367 Bacteria 11825
49 Ga0070667_100248802 3300005367 Bacteria 1589
50 Ga0070708_100540877 3300005445 Bacteria 1099
51 Ga0070663_100022186 3300005455 Bacteria 4239
52 Ga0070663_101290050 3300005455 Bacteria 644
53 Ga0070678_100765810 3300005456 Bacteria 874
54 Ga0070662_100000531 3300005457 Bacteria 23047
55 Ga0070662_100030913 3300005457 Bacteria 3752
56 Ga0068867_100000017 3300005459 Bacteria 106324
57 Ga0070706_101849799 3300005467 Bacteria 548
58 Ga0070679_100009522 3300005530 Bacteria 9188
59 Ga0068853_100041760 3300005539 Bacteria 3920
60 Ga0068853_100070986 3300005539 Bacteria 3032
61 Ga0070672_100205029 3300005543 Bacteria 1650
62 Ga0070686_100050761 3300005544 Bacteria 2638
63 Ga0070665_100000631 3300005548 Bacteria 47914
64 Ga0070665_100477132 3300005548 Bacteria 1258
65 Ga0068855_100019025 3300005563 Bacteria 8255
66 Ga0068855_100102842 3300005563 Bacteria 3288
67 Ga0068855_100545239 3300005563 Bacteria 1256
68 Ga0068855_101111057 3300005563 Bacteria 826
69 Ga0068857_100023682 3300005577 Bacteria 5405
70 Ga0068857_100023867 3300005577 Bacteria 5383
71 Ga0068854_100000235 3300005578 Bacteria 37775
72 Ga0068854_100008636 3300005578 Bacteria 6557
73 Ga0068854_100055482 3300005578 Bacteria 2853
74 Ga0068856_100055594 3300005614 Bacteria 3906
75 Ga0068856_100067337 3300005614 Bacteria 3538
76 Ga0068856_100475302 3300005614 Bacteria 1271
77 Ga0068856_101703606 3300005614 Bacteria 643
78 Ga0068852_100000575 3300005616 Bacteria 24133
79 Ga0068852_100000727 3300005616 Bacteria 21589
80 Ga0068852_100526408 3300005616 Bacteria 1180
81 Ga0068859_100002222 3300005617 Bacteria 19675
82 Ga0068859_100095833 3300005617 Bacteria 3020
83 Ga0068859_100156696 3300005617 Bacteria 2355
84 Ga0068864_100000036 3300005618 Bacteria 189811
85 Ga0068864_101173416 3300005618 Bacteria 766
86 Ga0068861_100432942 3300005719 Bacteria 1174
87 Ga0068863_100005364 3300005841 Bacteria 12643
88 Ga0068863_100007039 3300005841 Bacteria 11021
89 Ga0068863_100427434 3300005841 Bacteria 1298
90 Ga0068858_100013531 3300005842 Bacteria 7699
91 Ga0068858_100075261 3300005842 Bacteria 3136
92 Ga0068858_100519401 3300005842 Bacteria 1151
93 Ga0068860_100017336 3300005843 Bacteria 7017
94 Ga0068860_100030224 3300005843 Bacteria 5210
95 Ga0068862_100078605 3300005844 Bacteria 2858
96 Ga0068862_100417128 3300005844 Bacteria 1259
97 Ga0075365_10373821 3300006038 Bacteria 1005
98 Ga0075368_10001362 3300006042 Bacteria 7777
99 Ga0075363_100041275 3300006048 Bacteria 2433
100 Ga0075364_10065428 3300006051 Bacteria 2386
101 Ga0075364_10161617 3300006051 Bacteria 1512
102 Ga0075432_10000042 3300006058 Bacteria 24212
103 Ga0075362_10016520 3300006177 Bacteria 3024
104 Ga0075362_10478500 3300006177 Bacteria 635
105 Ga0075367_10018015 3300006178 Bacteria 3889
106 Ga0075369_10001547 3300006186 Bacteria 7883
107 Ga0075366_10023881 3300006195 Bacteria 3563
108 Ga0075366_10222032 3300006195 Bacteria 1151
109 Ga0097621_100025316 3300006237 Bacteria 4641
110 Ga0075370_10030311 3300006353 Bacteria 3017
111 Ga0075370_10046112 3300006353 Bacteria 2466
112 Ga0075370_10118632 3300006353 Bacteria 1539
113 Ga0068871_100016308 3300006358 Bacteria 5591
114 Ga0068865_100000004 3300006881 Bacteria 226236
115 Ga0097620_100002222 3300006931 Bacteria 19675
116 Ga0097620_100095827 3300006931 Bacteria 3020
117 Ga0097620_100156697 3300006931 Bacteria 2355
118 Ga0079104_1045864 3300006946 Bacteria 996
119 Ga0105251_10004754 3300009011 Bacteria 9096
120 Ga0105240_10001621 3300009093 Bacteria 38180
121 Ga0105240_10047394 3300009093 Bacteria 5438
122 Ga0105240_10413090 3300009093 Bacteria 1518
123 Ga0105240_10548014 3300009093 Bacteria 1280
124 Ga0105245_10001130 3300009098 Bacteria 24140
125 Ga0105247_10324319 3300009101 Bacteria 1075
126 Ga0105247_10470571 3300009101 Bacteria 910
127 Ga0105243_10000097 3300009148 Bacteria 100151
128 Ga0105243_10685260 3300009148 Bacteria 997
129 Ga0105241_10113754 3300009174 Bacteria 2170
130 Ga0105242_10000108 3300009176 Bacteria 59471
131 Ga0105248_10007718 3300009177 Bacteria 11817
132 Ga0105248_10011556 3300009177 Bacteria 9727
133 Ga0105248_10106722 3300009177 Bacteria 3157
134 Ga0105248_10215111 3300009177 Bacteria 2165
135 Ga0105248_10479228 3300009177 Bacteria 1402
136 Ga0105248_11313742 3300009177 Bacteria 818
137 Ga0105237_10381120 3300009545 Bacteria 1415
138 Ga0105237_10700733 3300009545 Bacteria 1019
139 Ga0105238_10024172 3300009551 Bacteria 6195
140 Ga0105238_10061153 3300009551 Bacteria 3770
141 Ga0105238_10068892 3300009551 Bacteria 3539
142 Ga0105238_10211899 3300009551 Bacteria 1913
143 Ga0105238_11223018 3300009551 Bacteria 776
144 Ga0105249_10282351 3300009553 Bacteria 1659
145 Ga0105239_10000060 3300010375 Bacteria 155195
146 Ga0105239_10017536 3300010375 Bacteria 7919
147 Ga0105239_10158154 3300010375 Bacteria 2531
148 Ga0105239_10458772 3300010375 Bacteria 1446
149 Ga0105246_11257184 3300011119 Bacteria 684
150 Ga0157326_1004264 3300012513 Bacteria 1501
151 Ga0157373_10029044 3300013100 Bacteria 3987
152 Ga0157373_10033813 3300013100 Bacteria 3674
153 Ga0157369_10073294 3300013105 Bacteria 3674
154 Ga0157374_10001088 3300013296 Bacteria 23401
155 Ga0157374_10009193 3300013296 Bacteria 8473
156 Ga0157378_10000727 3300013297 Bacteria 30734
157 Ga0157378_10006170 3300013297 Bacteria 10492
158 Ga0157378_10895595 3300013297 Bacteria 918
159 Ga0163162_10256389 3300013306 Bacteria 1881
160 Ga0163162_10645642 3300013306 Bacteria 1182
161 Ga0163162_11549194 3300013306 Bacteria 755
162 Ga0157372_10007288 3300013307 Bacteria 11776
163 Ga0157372_10079719 3300013307 Bacteria 3704
164 Ga0157372_10148211 3300013307 Bacteria 2707
165 Ga0157372_10418619 3300013307 Bacteria 1561
166 Ga0157372_12613415 3300013307 Bacteria 579
167 Ga0157375_10000959 3300013308 Bacteria 24954
168 Ga0157380_10001527 3300014326 Bacteria 15210
169 Ga0157380_10262887 3300014326 Bacteria 1568
170 Ga0157377_10055620 3300014745 Bacteria 2244
171 Ga0157376_10001012 3300014969 Bacteria 18333
172 Ga0163161_10005639 3300017792 Bacteria 8681
173 Ga0213873_10103152 3300021358 Bacteria 822
174 Ga0209563_100053 3300025230 Bacteria 332370
175 Ga0207427_100896 3300025231 Bacteria 12923
176 Ga0209026_1006145 3300025250 Bacteria 3027
177 Ga0209148_1000116 3300025254 Bacteria 190078
178 Ga0209233_1000041 3300025261 Bacteria 515463
179 Ga0209233_1000065 3300025261 Bacteria 387195
180 Ga0207697_10059757 3300025315 Bacteria 1584
181 Ga0207697_10186974 3300025315 Bacteria 909
182 Ga0207697_10377449 3300025315 Bacteria 630
183 Ga0207713_1025302 3300025735 Bacteria 2745
184 Ga0207680_10049710 3300025903 Bacteria 2497
185 Ga0207680_10057406 3300025903 Bacteria 2355
186 Ga0207680_10154267 3300025903 Bacteria 1534
187 Ga0207647_10001365 3300025904 Bacteria 18758
188 Ga0207647_10022297 3300025904 Bacteria 4209
189 Ga0207647_10050806 3300025904 Bacteria 2565
190 Ga0207645_10001036 3300025907 Bacteria 22967
191 Ga0207705_10000009 3300025909 Bacteria 576128
192 Ga0207705_10000022 3300025909 Bacteria 302232
193 Ga0207705_10000281 3300025909 Bacteria 48548
194 Ga0207705_10117333 3300025909 Bacteria 1971
195 Ga0207705_10187979 3300025909 Bacteria 1561
196 Ga0207705_10535012 3300025909 Bacteria 911
197 Ga0207705_10674732 3300025909 Bacteria 804
198 Ga0207705_10940440 3300025909 Bacteria 669
199 Ga0207654_10064142 3300025911 Bacteria 2158
200 Ga0207654_10129507 3300025911 Bacteria 1595
201 Ga0207695_10001572 3300025913 Bacteria 37183
202 Ga0207695_10318467 3300025913 Bacteria 1445
203 Ga0207671_10714899 3300025914 Bacteria 796
204 Ga0207657_10001837 3300025919 Bacteria 22930
205 Ga0207657_10003867 3300025919 Bacteria 15895
206 Ga0207652_10017725 3300025921 Bacteria 5832
207 Ga0207681_10000014 3300025923 Bacteria 353422
208 Ga0207681_10000396 3300025923 Bacteria 30438
209 Ga0207681_10003928 3300025923 Bacteria 9217
210 Ga0207694_10024090 3300025924 Bacteria 4621
211 Ga0207694_10026191 3300025924 Bacteria 4434
212 Ga0207694_10059209 3300025924 Bacteria 2979
213 Ga0207650_10000015 3300025925 Bacteria 369173
214 Ga0207650_11084539 3300025925 Bacteria 681
215 Ga0207659_10310445 3300025926 Bacteria 1298
216 Ga0207687_10000846 3300025927 Bacteria 20681
217 Ga0207644_10000005 3300025931 Bacteria 441948
218 Ga0207644_10010199 3300025931 Bacteria 6190
219 Ga0207644_10116397 3300025931 Bacteria 2028
220 Ga0207690_11581096 3300025932 Bacteria 548
221 Ga0207706_10002418 3300025933 Bacteria 18218
222 Ga0207706_10078716 3300025933 Bacteria 2899
223 Ga0207706_10105296 3300025933 Bacteria 2482
224 Ga0207686_10001049 3300025934 Bacteria 16360
225 Ga0207709_10000443 3300025935 Bacteria 38905
226 Ga0207704_10000005 3300025938 Bacteria 225353
227 Ga0207691_10240609 3300025940 Bacteria 1565
228 Ga0207711_10000252 3300025941 Bacteria 57840
229 Ga0207711_10003787 3300025941 Bacteria 13014
230 Ga0207711_10414428 3300025941 Bacteria 1252
231 Ga0207711_10607664 3300025941 Bacteria 1020
232 Ga0207711_11000925 3300025941 Bacteria 775
233 Ga0207689_10000285 3300025942 Bacteria 46061
234 Ga0207667_10001997 3300025949 Bacteria 25597
235 Ga0207667_10024529 3300025949 Bacteria 6620
236 Ga0207667_10080397 3300025949 Bacteria 3377
237 Ga0207667_10287995 3300025949 Bacteria 1678
238 Ga0207667_10714339 3300025949 Bacteria 1004
239 Ga0207651_10000007 3300025960 Bacteria 225286
240 Ga0207712_10175125 3300025961 Bacteria 1680
241 Ga0207668_10012797 3300025972 Bacteria 5146
242 Ga0207668_10544542 3300025972 Bacteria 1004
243 Ga0207640_10003333 3300025981 Bacteria 8655
244 Ga0207640_10007181 3300025981 Bacteria 6139
245 Ga0207640_10007576 3300025981 Bacteria 5995
246 Ga0207658_10035761 3300025986 Bacteria 3558
247 Ga0207677_10000467 3300026023 Bacteria 26774
248 Ga0207703_10006273 3300026035 Bacteria 9507
249 Ga0207703_10087722 3300026035 Bacteria 2609
250 Ga0207639_10125656 3300026041 Bacteria 2115
251 Ga0207639_10169855 3300026041 Bacteria 1846
252 Ga0207639_11909778 3300026041 Bacteria 555
253 Ga0207678_10000482 3300026067 Bacteria 36190
254 Ga0207702_10014954 3300026078 Bacteria 6438
255 Ga0207702_10017286 3300026078 Bacteria 5967
256 Ga0207702_10064783 3300026078 Bacteria 3128
257 Ga0207702_10121993 3300026078 Bacteria 2334
258 Ga0207702_11150899 3300026078 Bacteria 770
259 Ga0207641_10021696 3300026088 Bacteria 5277
260 Ga0207641_11448559 3300026088 Bacteria 688
261 Ga0207641_11838925 3300026088 Bacteria 607
262 Ga0207648_10000005 3300026089 Bacteria 225083
263 Ga0207676_10000021 3300026095 Bacteria 296572
264 Ga0207676_10060239 3300026095 Bacteria 3002
265 Ga0207676_10990427 3300026095 Bacteria 828
266 Ga0207674_10016269 3300026116 Bacteria 8147
267 Ga0207674_10120198 3300026116 Bacteria 2595
268 Ga0207675_100075195 3300026118 Bacteria 3162
269 Ga0207683_10014261 3300026121 Bacteria 6771
270 Ga0207698_10000084 3300026142 Bacteria 62453
271 Ga0207698_10000355 3300026142 Bacteria 26972
272 Ga0207698_10495587 3300026142 Bacteria 1188
273 Ga0207698_11138855 3300026142 Bacteria 793
274 Ga0209813_10000044 3300027866 Bacteria 50649
275 Ga0207428_10009543 3300027907 Bacteria 8694
276 Ga0268266_10000198 3300028379 Bacteria 104891
277 Ga0268266_10251743 3300028379 Bacteria 1634
278 Ga0268265_10059643 3300028380 Bacteria 2920
279 Ga0268264_10006955 3300028381 Bacteria 9495
280 Ga0268264_10050267 3300028381 Bacteria 3471
281 Ga0316576_10444635 3300031727 Bacteria 958
282 Ga0307410_11013581 3300031852 Bacteria 716
283 Ga0307412_10021188 3300031911 Bacteria 3966
284 Ga0307412_10200718 3300031911 Bacteria 1514
285 Ga0307409_100064896 3300031995 Bacteria 2870
286 Ga0307409_101802520 3300031995 Bacteria 641
287 Ga0307416_100147855 3300032002 Bacteria 2149
288 Ga0307414_10585655 3300032004 Bacteria 999
289 Ga0307411_10892314 3300032005 Bacteria 789
290 Ga0373951_0087769 3300035091 Bacteria 813
291 Ga0373943_0216339 3300035170 Bacteria 1066
292 Ga0373947_0097476 3300035725 Bacteria 1843
293 Ga0373925_0042983 3300037068 Bacteria 3353
294 Ga0395900_0192176 3300037418 Bacteria 2070
295 Ga0395905_0043435 3300037471 Bacteria 4217
296 Ga0395901_0088460 3300038443 Bacteria 3240
297 Ga0436363_0207275 3300039450 Bacteria 1419
298 Ga0436363_1140649 3300039450 Bacteria 765
299 Ga0436362_0579887 3300039453 Bacteria 2245
300 Ga0451793_1551097 3300041452 Bacteria 1515
301 Ga0451800_1276273 3300041459 Bacteria 1602
302 Ga0451806_474095 3300041462 Bacteria 2112
303 Ga0451807_0784523 3300041486 Bacteria 3896
304 Ga0439448_0010868 3300042005 Bacteria 2705
305 Ga0450899_007325 3300042135 Bacteria 1201
306 Ga0451577_0061545 3300042876 Bacteria 3348
307 Ga0466969_0307744 3300044656 Bacteria 717
308 Ga0466972_0035983 3300044658 Bacteria 2423
309 Ga0466972_0467214 3300044658 Bacteria 593
310 Ga0466966_0122835 3300044684 Bacteria 1594
311 Ga0466964_0019644 3300044706 Bacteria 2599
312 Ga0453684_0007018 3300044712 Bacteria 21044
313 Ga0466968_0287267 3300044735 Bacteria 788
314 Ga0466970_0037224 3300044765 Bacteria 2578
315 Ga0466970_0041444 3300044765 Bacteria 2447
316 Ga0466957_0102510 3300044842 Bacteria 1805
317 Ga0466960_0032165 3300044901 Bacteria 2426
318 Ga0466959_0139624 3300045049 Bacteria 1713
319 Ga0466958_0025534 3300045836 Bacteria 3484
320 Ga0495638_0015657 3300046460 Bacteria 5087
321 Ga0495638_0032109 3300046460 Bacteria 3369
322 Ga0495585_0024662 3300046492 Bacteria 3447
323 Ga0495594_0011771 3300046499 Bacteria 4547
324 Ga0495607_0009843 3300046501 Bacteria 6452
325 Ga0495607_0498363 3300046501 Bacteria 541
326 Ga0495583_0000840 3300046506 Bacteria 37393
327 Ga0495610_0105506 3300046512 Bacteria 1256
328 Ga0495610_0181681 3300046512 Bacteria 874
329 Ga0495643_0038971 3300046522 Bacteria 2600
330 Ga0495643_0120013 3300046522 Bacteria 1329
331 Ga0495648_0271725 3300046524 Bacteria 808
332 Ga0495666_0250740 3300046526 Unclassified 806
333 Ga0495654_0010598 3300046530 Bacteria 5012
334 Ga0495654_0023927 3300046530 Bacteria 3160
335 Ga0495609_0017504 3300046538 Bacteria 3328
336 Ga0495621_0003746 3300046539 Bacteria 4215
337 Ga0495597_0002515 3300046542 Bacteria 11514
338 Ga0495668_0545865 3300046616 Bacteria 640
339 Ga0495625_0000112 3300046660 Bacteria 124365
340 Ga0495625_0277654 3300046660 Bacteria 1079
341 Ga0495661_0132074 3300046665 Bacteria 1367
342 Ga0495670_0064150 3300046691 Bacteria 1850
343 Ga0495670_0081318 3300046691 Bacteria 1651
344 Ga0495670_0166495 3300046691 Bacteria 1160
345 Ga0495670_0273268 3300046691 Bacteria 903
346 Ga0495660_0106550 3300046810 Bacteria 1436
347 Ga0495660_0144722 3300046810 Bacteria 1179
348 Ga0495683_0224880 3300047323 Bacteria 835
349 Ga0495686_0001111 3300047472 Bacteria 31908
350 Ga0495686_0025783 3300047472 Bacteria 3850
351 Ga0495615_0023425 3300048090 Bacteria 1415
352 Ga0495626_0055683 3300048091 Bacteria 1812
353 Ga0496100_1164828 3300048903 Bacteria 608
354 Ga0496101_0600439 3300048904 Bacteria 870
355 Ga0496102_0000043 3300048905 Bacteria 189201
356 Ga0496102_0159815 3300048905 Bacteria 2119
357 Ga0496102_0475139 3300048905 Bacteria 1171
358 Ga0496102_0671255 3300048905 Bacteria 959
359 Ga0496103_0000086 3300048906 Bacteria 104765
360 Ga0496103_0008529 3300048906 Bacteria 6090
361 Ga0496103_0219971 3300048906 Bacteria 1221
362 Ga0496104_0452560 3300048907 Bacteria 1195
363 Ga0496104_1603154 3300048907 Bacteria 554
364 Ga0496104_1636555 3300048907 Bacteria 546
365 Ga0496105_0081042 3300048908 Bacteria 2681
366 Ga0496106_0001368 3300048909 Bacteria 18276
367 Ga0496107_0115156 3300048910 Bacteria 1978
368 Ga0496107_0579846 3300048910 Bacteria 830
369 Ga0496108_0031293 3300048911 Bacteria 4414
370 Ga0496109_0143360 3300048912 Bacteria 2234
371 Ga0496109_0158116 3300048912 Bacteria 2123
372 Ga0496109_1115283 3300048912 Bacteria 726
373 Ga0496110_0287051 3300048913 Bacteria 1498
374 Ga0496111_0077000 3300048914 Bacteria 2431
375 Ga0496111_0348620 3300048914 Bacteria 1096
376 Ga0496113_0003385 3300048916 Bacteria 9537
377 Ga0496113_0274298 3300048916 Bacteria 1348
378 Ga0496116_0001567 3300048919 Bacteria 25245
379 Ga0496116_0121530 3300048919 Bacteria 1510
380 Ga0496117_0000104 3300048920 Bacteria 189201
381 Ga0496117_0026336 3300048920 Bacteria 4552
382 Ga0496117_0180408 3300048920 Bacteria 1214
383 Ga0496117_0364188 3300048920 Bacteria 742
384 Ga0496118_0000080 3300048921 Bacteria 189201
385 Ga0496118_0049198 3300048921 Bacteria 3249
386 Ga0496118_0078895 3300048921 Bacteria 2327
387 Ga0496119_0020026 3300048922 Bacteria 4897
388 Ga0496119_0039356 3300048922 Bacteria 3040
389 Ga0496121_0000580 3300048924 Bacteria 68713
390 Ga0496121_0001326 3300048924 Bacteria 42390
391 Ga0496121_0004094 3300048924 Bacteria 20003
392 Ga0496121_0009720 3300048924 Bacteria 11004
393 Ga0496121_0050823 3300048924 Bacteria 3498
394 Ga0496121_0127525 3300048924 Bacteria 1910
395 Ga0496121_0579274 3300048924 Bacteria 697
396 Ga0496122_0012325 3300048925 Bacteria 8532
397 Ga0496122_0124333 3300048925 Bacteria 1655
398 Ga0496123_0051639 3300048926 Bacteria 2736
399 Ga0496123_0188291 3300048926 Bacteria 1070
400 Ga0496124_0000093 3300048927 Bacteria 189201
401 Ga0496124_0102678 3300048927 Bacteria 2313
402 Ga0496124_0239378 3300048927 Bacteria 1351
403 Ga0496125_0031161 3300048928 Bacteria 4757
404 Ga0496125_0365437 3300048928 Bacteria 856
405 Ga0496126_0002621 3300048929 Bacteria 23931
406 Ga0496126_0023960 3300048929 Bacteria 5902
407 Ga0496126_0063465 3300048929 Bacteria 3311
408 Ga0496126_0069900 3300048929 Bacteria 3130
409 Ga0495682_0045995 3300049460 Bacteria 1594
410 Ga0501033_0143192 3300049570 Bacteria 1728
411 Ga0501042_0226218 3300049578 Bacteria 1349
412 Ga0501042_0260466 3300049578 Bacteria 1252
413 Ga0501043_0052967 3300049579 Bacteria 3187
414 Ga0501046_0492206 3300049580 Bacteria 879
415 Ga0501046_0493729 3300049580 Bacteria 877
416 Ga0501072_0001885 3300049588 Bacteria 15620
417 Ga0501202_197275 3300049652 Bacteria 549
418 Ga0501223_046671 3300049663 Bacteria 840
419 Ga0501227_073223 3300049665 Bacteria 891
420 Ga0501249_000872 3300049679 Bacteria 6662
421 Ga0501083_0811166 3300049744 Bacteria 609
422 Ga0501280_006590 3300049776 Bacteria 1634
423 Ga0501035_0279011 3300049822 Bacteria 1413
424 Ga0501035_0875009 3300049822 Bacteria 713
425 Ga0501044_0000340 3300049823 Bacteria 59157
426 Ga0501044_0041023 3300049823 Bacteria 4819
427 Ga0501044_0222665 3300049823 Bacteria 1837
428 Ga0501204_001921 3300049850 Bacteria 2088
429 nmdc:mga03683_7209_c1 3300050489 Bacteria 3850
430 nmdc:mga03683_7229_c1 3300050489 Bacteria 3847
431 nmdc:mga03n38_26160_c1 3300050490 Bacteria 2407
432 nmdc:mga00v17_4197_c1 3300050491 Bacteria 7476
433 nmdc:mga0yw44_344532_c1 3300050492 Bacteria 1003
434 nmdc:mga0k408_148495_c1 3300050493 Bacteria 1396
435 nmdc:mga0k408_2765_c1 3300050493 Bacteria 9329
436 nmdc:mga0k408_532957_c1 3300050493 Bacteria 695
437 nmdc:mga06z11_494_c1 3300050494 Bacteria 14527
438 nmdc:mga04h51_31_c1 3300050495 Bacteria 48962
439 nmdc:mga07m45_114168_c1 3300050496 Bacteria 1557
440 nmdc:mga07m45_23_c1 3300050496 Bacteria 115627
441 nmdc:mga07m45_687_c2 3300050496 Bacteria 10168
442 nmdc:mga07m45_78119_c1 3300050496 Bacteria 1888
443 nmdc:mga0sz30_206_c1 3300050516 Bacteria 22121
444 Ga0500643_050827 3300053087 Bacteria 1185
445 Ga0500647_0012526 3300053091 Bacteria 3821
446 Ga0500651_0011599 3300053093 Bacteria 5319
447 Ga0500651_0523523 3300053093 Unclassified 651
448 Ga0500566_0027494 3300053094 Bacteria 3330
449 Ga0500555_000430 3300053103 Bacteria 17416
450 Ga0500562_117522 3300053108 Bacteria 724
451 Ga0500592_000066 3300053116 Bacteria 28093
452 Ga0500595_055553 3300053119 Bacteria 1212
453 Ga0500607_000122 3300053121 Bacteria 62944
454 Ga0500614_002238 3300053123 Bacteria 4367
455 Ga0500618_006541 3300053125 Bacteria 3407
456 Ga0500642_0002935 3300053130 Bacteria 5075
457 Ga0500652_086794 3300053131 Bacteria 1305
458 Ga0500655_000291 3300053133 Bacteria 11350
459 Ga0500559_0002460 3300053136 Bacteria 9579
460 Ga0500568_0126429 3300053139 Bacteria 951
461 Ga0500590_002051 3300053148 Bacteria 8710
462 Ga0500604_0015046 3300053151 Bacteria 2113
463 Ga0500604_0045045 3300053151 Bacteria 1345
464 Ga0500604_0065457 3300053151 Bacteria 1150
465 Ga0500616_0001309 3300053153 Bacteria 24602
466 Ga0500616_0037641 3300053153 Bacteria 2618
467 Ga0500622_0000910 3300053156 Bacteria 25133
468 Ga0500622_0022407 3300053156 Bacteria 3349
469 Ga0500622_0042556 3300053156 Bacteria 2359
470 Ga0500627_0000176 3300053158 Bacteria 18715
471 Ga0500636_0079895 3300053177 Bacteria 1885
472 Ga0500570_013929 3300053724 Bacteria 4509
473 Ga0500645_005166 3300053730 Bacteria 4863
474 Ga0500645_010163 3300053730 Bacteria 3128
475 Ga0500645_022122 3300053730 Bacteria 1958
476 Ga0587069_067710 3300059642 Bacteria 672
477 Ga0466962_0173986 3300061719 Bacteria 1049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048091 Ga0495626_0055683 Ga0495626_0055683_1170_1637 129
2 3300049588 Ga0501072_0001885 Ga0501072_0001885_10052_10510 131
3 3300053093 Ga0500651_0523523 Ga0500651_0523523_46_504 131
4 3300032004 Ga0307414_10585655 Ga0307414_105856552 135
5 3300001990 JGI24737J22298_10013441 JGI24737J22298_100134412 139
6 3300005327 Ga0070658_10096950 Ga0070658_100969504 139
7 3300005338 Ga0068868_100000198 Ga0068868_10000019819 139
8 3300005455 Ga0070663_100022186 Ga0070663_1000221863 139
9 3300005577 Ga0068857_100023867 Ga0068857_1000238673 139
10 3300005614 Ga0068856_100475302 Ga0068856_1004753022 139
11 3300005616 Ga0068852_100000575 Ga0068852_10000057516 139
12 3300009098 Ga0105245_10001130 Ga0105245_100011303 139
13 3300009174 Ga0105241_10113754 Ga0105241_101137543 139
14 3300009551 Ga0105238_10211899 Ga0105238_102118991 139
15 3300009553 Ga0105249_10282351 Ga0105249_102823512 139
16 3300010375 Ga0105239_10017536 Ga0105239_100175362 139
17 3300013100 Ga0157373_10029044 Ga0157373_100290445 139
18 3300013296 Ga0157374_10009193 Ga0157374_100091938 139
19 3300013297 Ga0157378_10000727 Ga0157378_1000072725 139
20 3300013306 Ga0163162_10645642 Ga0163162_106456421 139
21 3300013307 Ga0157372_10418619 Ga0157372_104186191 139
22 3300013307 Ga0157372_12613415 Ga0157372_126134151 139
23 3300014745 Ga0157377_10055620 Ga0157377_100556203 139
24 3300026078 Ga0207702_10017286 Ga0207702_100172867 139
25 3300026078 Ga0207702_10064783 Ga0207702_100647833 139
26 3300026116 Ga0207674_10120198 Ga0207674_101201983 139
27 3300026142 Ga0207698_10000355 Ga0207698_1000035515 139
28 3300037471 Ga0395905_0043435 Ga0395905_0043435_1716_2141 139
29 3300044656 Ga0466969_0307744 Ga0466969_0307744_15_443 139
30 3300044658 Ga0466972_0035983 Ga0466972_0035983_874_1302 139
31 3300044684 Ga0466966_0122835 Ga0466966_0122835_922_1350 139
32 3300044706 Ga0466964_0019644 Ga0466964_0019644_722_1150 139
33 3300044735 Ga0466968_0287267 Ga0466968_0287267_268_696 139
34 3300044765 Ga0466970_0037224 Ga0466970_0037224_1649_2077 139
35 3300044765 Ga0466970_0041444 Ga0466970_0041444_1737_2165 139
36 3300044842 Ga0466957_0102510 Ga0466957_0102510_17_439 139
37 3300044901 Ga0466960_0032165 Ga0466960_0032165_1929_2357 139
38 3300045049 Ga0466959_0139624 Ga0466959_0139624_863_1291 139
39 3300045836 Ga0466958_0025534 Ga0466958_0025534_786_1214 139
40 3300048904 Ga0496101_0600439 Ga0496101_0600439_273_698 139
41 3300048912 Ga0496109_1115283 Ga0496109_1115283_237_665 139
42 3300048916 Ga0496113_0274298 Ga0496113_0274298_755_1180 139
43 3300048920 Ga0496117_0180408 Ga0496117_0180408_534_959 139
44 3300048920 Ga0496117_0364188 Ga0496117_0364188_252_674 139
45 3300048921 Ga0496118_0049198 Ga0496118_0049198_2728_3153 139
46 3300048924 Ga0496121_0127525 Ga0496121_0127525_489_914 139
47 3300048924 Ga0496121_0579274 Ga0496121_0579274_212_637 139
48 3300048925 Ga0496122_0012325 Ga0496122_0012325_6551_6976 139
49 3300048926 Ga0496123_0051639 Ga0496123_0051639_587_1012 139
50 iso_pu_bacteria 2848297114 2848297670 140
51 iso_pu_bacteria 3000865235 3000866620 140
52 iso_pu_bacteria 8054302542 8054302796 140
53 3300001989 JGI24739J22299_10001175 JGI24739J22299_100011757 142
54 3300001990 JGI24737J22298_10001420 JGI24737J22298_100014207 142
55 3300002067 JGI24735J21928_10003072 JGI24735J21928_100030725 142
56 3300002075 JGI24738J21930_10000047 JGI24738J21930_100000475 142
57 3300005457 Ga0070662_100000531 Ga0070662_10000053110 142
58 3300005539 Ga0068853_100070986 Ga0068853_1000709862 142
59 3300005616 Ga0068852_100526408 Ga0068852_1005264082 142
60 3300013307 Ga0157372_10007288 Ga0157372_100072884 142
61 3300025904 Ga0207647_10001365 Ga0207647_1000136511 142
62 3300025932 Ga0207690_11581096 Ga0207690_115810961 142
63 3300025933 Ga0207706_10002418 Ga0207706_100024185 142
64 3300026041 Ga0207639_10125656 Ga0207639_101256562 142
65 3300026142 Ga0207698_10495587 Ga0207698_104955872 142
66 3300037418 Ga0395900_0192176 Ga0395900_0192176_969_1406 142
67 3300038443 Ga0395901_0088460 Ga0395901_0088460_1792_2229 142
68 3300046460 Ga0495638_0032109 Ga0495638_0032109_836_1273 142
69 3300047472 Ga0495686_0025783 Ga0495686_0025783_1944_2381 142
70 3300053136 Ga0500559_0002460 Ga0500559_0002460_6614_7051 142
71 3300002459 JGI24751J29686_10000052 JGI24751J29686_1000005244 143
72 3300005262 Ga0065165_1001234 Ga0065165_100123415 143
73 3300005295 Ga0065707_10093884 Ga0065707_100938844 143
74 3300005331 Ga0070670_100000024 Ga0070670_100000024106 143
75 3300005353 Ga0070669_100000047 Ga0070669_100000047110 143
76 3300005445 Ga0070708_100540877 Ga0070708_1005408772 143
77 3300005467 Ga0070706_101849799 Ga0070706_1018497991 143
78 3300005577 Ga0068857_100023682 Ga0068857_1000236823 143
79 3300005578 Ga0068854_100008636 Ga0068854_1000086364 143
80 3300005617 Ga0068859_100002222 Ga0068859_10000222212 143
81 3300005618 Ga0068864_100000036 Ga0068864_100000036107 143
82 3300006931 Ga0097620_100002222 Ga0097620_10000222212 143
83 3300009177 Ga0105248_10007718 Ga0105248_100077188 143
84 3300009551 Ga0105238_11223018 Ga0105238_112230182 143
85 3300012513 Ga0157326_1004264 Ga0157326_10042642 143
86 3300014326 Ga0157380_10001527 Ga0157380_1000152713 143
87 3300025923 Ga0207681_10000014 Ga0207681_10000014192 143
88 3300025925 Ga0207650_10000015 Ga0207650_10000015207 143
89 3300025941 Ga0207711_10000252 Ga0207711_1000025216 143
90 3300025981 Ga0207640_10007576 Ga0207640_100075764 143
91 3300026095 Ga0207676_10000021 Ga0207676_10000021195 143
92 3300026116 Ga0207674_10016269 Ga0207674_100162696 143
93 3300031911 Ga0307412_10200718 Ga0307412_102007181 143
94 3300046499 Ga0495594_0011771 Ga0495594_0011771_15_497 143
95 3300046526 Ga0495666_0250740 Ga0495666_0250740_289_771 143
96 3300048928 Ga0496125_0365437 Ga0496125_0365437_181_621 143
97 3300049578 Ga0501042_0260466 Ga0501042_0260466_478_909 143
98 3300049580 Ga0501046_0493729 Ga0501046_0493729_146_577 143
99 3300049744 Ga0501083_0811166 Ga0501083_0811166_119_550 143
100 3300050496 nmdc:mga07m45_114168_c1 nmdc:mga07m45_114168_c1_50_490 143
101 3300053730 Ga0500645_005166 Ga0500645_005166_1922_2362 143
102 iso_pu_bacteria 2582581305 2585260042 143
103 iso_pu_bacteria 2599185354 2600201011 143
104 iso_pu_bacteria 2751185897 2753765303 143
105 2162886007 SwRhRL2b_contig_3108969 SwRhRL2b_0430.00000990 144
106 3300001979 JGI24740J21852_10008630 JGI24740J21852_100086307 144
107 3300002067 JGI24735J21928_10013286 JGI24735J21928_100132861 144
108 3300002067 JGI24735J21928_10019507 JGI24735J21928_100195073 144
109 3300003214 JGI25165J46597_1000021 JGI25165J46597_100002122 144
110 3300003214 JGI25165J46597_1000050 JGI25165J46597_1000050159 144
111 3300003316 rootH1_10036854 rootH1_100368541 144
112 3300003759 Ga0055525_1000070 Ga0055525_1000070116 144
113 3300003762 Ga0055542_1009933 Ga0055542_10099332 144
114 3300005289 Ga0065704_10021604 Ga0065704_100216042 144
115 3300005289 Ga0065704_10070270 Ga0065704_1007027034 144
116 3300005327 Ga0070658_10000735 Ga0070658_100007353 144
117 3300005327 Ga0070658_10000736 Ga0070658_1000073627 144
118 3300005327 Ga0070658_10005617 Ga0070658_100056173 144
119 3300005327 Ga0070658_11405066 Ga0070658_114050661 144
120 3300005328 Ga0070676_10009733 Ga0070676_100097334 144
121 3300005331 Ga0070670_100063821 Ga0070670_1000638213 144
122 3300005331 Ga0070670_100203340 Ga0070670_1002033402 144
123 3300005334 Ga0068869_100000680 Ga0068869_1000006802 144
124 3300005335 Ga0070666_10098989 Ga0070666_100989893 144
125 3300005335 Ga0070666_10152379 Ga0070666_101523792 144
126 3300005335 Ga0070666_10206544 Ga0070666_102065442 144
127 3300005337 Ga0070682_100834325 Ga0070682_1008343251 144
128 3300005339 Ga0070660_100000950 Ga0070660_10000095016 144
129 3300005339 Ga0070660_100001991 Ga0070660_1000019916 144
130 3300005347 Ga0070668_100214219 Ga0070668_1002142192 144
131 3300005353 Ga0070669_100001347 Ga0070669_10000134715 144
132 3300005353 Ga0070669_100003039 Ga0070669_10000303911 144
133 3300005353 Ga0070669_100612967 Ga0070669_1006129672 144
134 3300005355 Ga0070671_100000040 Ga0070671_10000004011 144
135 3300005355 Ga0070671_100000565 Ga0070671_1000005655 144
136 3300005355 Ga0070671_100030283 Ga0070671_1000302832 144
137 3300005364 Ga0070673_100000002 Ga0070673_10000000219 144
138 3300005366 Ga0070659_100606316 Ga0070659_1006063161 144
139 3300005366 Ga0070659_101588680 Ga0070659_1015886801 144
140 3300005367 Ga0070667_100004441 Ga0070667_10000444112 144
141 3300005367 Ga0070667_100248802 Ga0070667_1002488022 144
142 3300005455 Ga0070663_101290050 Ga0070663_1012900501 144
143 3300005456 Ga0070678_100765810 Ga0070678_1007658101 144
144 3300005457 Ga0070662_100030913 Ga0070662_1000309133 144
145 3300005459 Ga0068867_100000017 Ga0068867_10000001719 144
146 3300005530 Ga0070679_100009522 Ga0070679_1000095224 144
147 3300005539 Ga0068853_100041760 Ga0068853_1000417603 144
148 3300005543 Ga0070672_100205029 Ga0070672_1002050293 144
149 3300005544 Ga0070686_100050761 Ga0070686_1000507613 144
150 3300005548 Ga0070665_100000631 Ga0070665_10000063131 144
151 3300005548 Ga0070665_100477132 Ga0070665_1004771322 144
152 3300005563 Ga0068855_100019025 Ga0068855_1000190256 144
153 3300005563 Ga0068855_100102842 Ga0068855_1001028423 144
154 3300005563 Ga0068855_100545239 Ga0068855_1005452392 144
155 3300005563 Ga0068855_101111057 Ga0068855_1011110571 144
156 3300005578 Ga0068854_100000235 Ga0068854_10000023528 144
157 3300005578 Ga0068854_100055482 Ga0068854_1000554822 144
158 3300005614 Ga0068856_100055594 Ga0068856_1000555943 144
159 3300005614 Ga0068856_100067337 Ga0068856_1000673374 144
160 3300005614 Ga0068856_101703606 Ga0068856_1017036062 144
161 3300005616 Ga0068852_100000727 Ga0068852_10000072719 144
162 3300005617 Ga0068859_100095833 Ga0068859_1000958332 144
163 3300005617 Ga0068859_100156696 Ga0068859_1001566962 144
164 3300005618 Ga0068864_101173416 Ga0068864_1011734162 144
165 3300005719 Ga0068861_100432942 Ga0068861_1004329422 144
166 3300005841 Ga0068863_100005364 Ga0068863_10000536412 144
167 3300005841 Ga0068863_100007039 Ga0068863_1000070398 144
168 3300005841 Ga0068863_100427434 Ga0068863_1004274341 144
169 3300005842 Ga0068858_100013531 Ga0068858_1000135315 144
170 3300005842 Ga0068858_100075261 Ga0068858_1000752612 144
171 3300005842 Ga0068858_100519401 Ga0068858_1005194012 144
172 3300005843 Ga0068860_100017336 Ga0068860_1000173369 144
173 3300005843 Ga0068860_100030224 Ga0068860_1000302245 144
174 3300005844 Ga0068862_100078605 Ga0068862_1000786053 144
175 3300005844 Ga0068862_100417128 Ga0068862_1004171282 144
176 3300006038 Ga0075365_10373821 Ga0075365_103738212 144
177 3300006042 Ga0075368_10001362 Ga0075368_100013628 144
178 3300006048 Ga0075363_100041275 Ga0075363_1000412753 144
179 3300006051 Ga0075364_10065428 Ga0075364_100654283 144
180 3300006051 Ga0075364_10161617 Ga0075364_101616172 144
181 3300006058 Ga0075432_10000042 Ga0075432_100000423 144
182 3300006177 Ga0075362_10016520 Ga0075362_100165202 144
183 3300006177 Ga0075362_10478500 Ga0075362_104785002 144
184 3300006178 Ga0075367_10018015 Ga0075367_100180155 144
185 3300006186 Ga0075369_10001547 Ga0075369_100015478 144
186 3300006195 Ga0075366_10023881 Ga0075366_100238813 144
187 3300006195 Ga0075366_10222032 Ga0075366_102220321 144
188 3300006237 Ga0097621_100025316 Ga0097621_1000253164 144
189 3300006353 Ga0075370_10030311 Ga0075370_100303113 144
190 3300006353 Ga0075370_10046112 Ga0075370_100461122 144
191 3300006353 Ga0075370_10118632 Ga0075370_101186322 144
192 3300006358 Ga0068871_100016308 Ga0068871_1000163085 144
193 3300006881 Ga0068865_100000004 Ga0068865_10000000420 144
194 3300006931 Ga0097620_100095827 Ga0097620_1000958272 144
195 3300006931 Ga0097620_100156697 Ga0097620_1001566972 144
196 3300006946 Ga0079104_1045864 Ga0079104_10458642 144
197 3300009011 Ga0105251_10004754 Ga0105251_1000475411 144
198 3300009093 Ga0105240_10001621 Ga0105240_1000162117 144
199 3300009093 Ga0105240_10047394 Ga0105240_100473945 144
200 3300009093 Ga0105240_10413090 Ga0105240_104130902 144
201 3300009093 Ga0105240_10548014 Ga0105240_105480142 144
202 3300009101 Ga0105247_10324319 Ga0105247_103243192 144
203 3300009101 Ga0105247_10470571 Ga0105247_104705712 144
204 3300009148 Ga0105243_10000097 Ga0105243_1000009720 144
205 3300009148 Ga0105243_10685260 Ga0105243_106852602 144
206 3300009176 Ga0105242_10000108 Ga0105242_1000010841 144
207 3300009177 Ga0105248_10011556 Ga0105248_100115566 144
208 3300009177 Ga0105248_10106722 Ga0105248_101067223 144
209 3300009177 Ga0105248_10215111 Ga0105248_102151112 144
210 3300009177 Ga0105248_10479228 Ga0105248_104792282 144
211 3300009177 Ga0105248_11313742 Ga0105248_113137422 144
212 3300009545 Ga0105237_10381120 Ga0105237_103811201 144
213 3300009545 Ga0105237_10700733 Ga0105237_107007331 144
214 3300009551 Ga0105238_10024172 Ga0105238_100241725 144
215 3300009551 Ga0105238_10061153 Ga0105238_100611533 144
216 3300009551 Ga0105238_10068892 Ga0105238_100688923 144
217 3300010375 Ga0105239_10000060 Ga0105239_10000060134 144
218 3300010375 Ga0105239_10158154 Ga0105239_101581543 144
219 3300010375 Ga0105239_10458772 Ga0105239_104587722 144
220 3300011119 Ga0105246_11257184 Ga0105246_112571842 144
221 3300013100 Ga0157373_10033813 Ga0157373_100338132 144
222 3300013105 Ga0157369_10073294 Ga0157369_100732942 144
223 3300013296 Ga0157374_10001088 Ga0157374_100010882 144
224 3300013297 Ga0157378_10006170 Ga0157378_100061707 144
225 3300013297 Ga0157378_10895595 Ga0157378_108955951 144
226 3300013306 Ga0163162_10256389 Ga0163162_102563892 144
227 3300013306 Ga0163162_11549194 Ga0163162_115491941 144
228 3300013307 Ga0157372_10079719 Ga0157372_100797193 144
229 3300013307 Ga0157372_10148211 Ga0157372_101482113 144
230 3300013308 Ga0157375_10000959 Ga0157375_1000095910 144
231 3300014326 Ga0157380_10262887 Ga0157380_102628872 144
232 3300014969 Ga0157376_10001012 Ga0157376_1000101213 144
233 3300017792 Ga0163161_10005639 Ga0163161_100056394 144
234 3300021358 Ga0213873_10103152 Ga0213873_101031522 144
235 3300025230 Ga0209563_100053 Ga0209563_10005380 144
236 3300025231 Ga0207427_100896 Ga0207427_10089613 144
237 3300025250 Ga0209026_1006145 Ga0209026_10061452 144
238 3300025254 Ga0209148_1000116 Ga0209148_1000116131 144
239 3300025261 Ga0209233_1000041 Ga0209233_1000041336 144
240 3300025261 Ga0209233_1000065 Ga0209233_100006521 144
241 3300025315 Ga0207697_10059757 Ga0207697_100597572 144
242 3300025315 Ga0207697_10186974 Ga0207697_101869742 144
243 3300025315 Ga0207697_10377449 Ga0207697_103774491 144
244 3300025735 Ga0207713_1025302 Ga0207713_10253023 144
245 3300025903 Ga0207680_10049710 Ga0207680_100497103 144
246 3300025903 Ga0207680_10057406 Ga0207680_100574063 144
247 3300025903 Ga0207680_10154267 Ga0207680_101542672 144
248 3300025904 Ga0207647_10022297 Ga0207647_100222973 144
249 3300025904 Ga0207647_10050806 Ga0207647_100508063 144
250 3300025907 Ga0207645_10001036 Ga0207645_1000103620 144
251 3300025909 Ga0207705_10000009 Ga0207705_10000009383 144
252 3300025909 Ga0207705_10000022 Ga0207705_10000022174 144
253 3300025909 Ga0207705_10000281 Ga0207705_1000028129 144
254 3300025909 Ga0207705_10117333 Ga0207705_101173333 144
255 3300025909 Ga0207705_10187979 Ga0207705_101879791 144
256 3300025909 Ga0207705_10535012 Ga0207705_105350122 144
257 3300025909 Ga0207705_10674732 Ga0207705_106747321 144
258 3300025909 Ga0207705_10940440 Ga0207705_109404402 144
259 3300025911 Ga0207654_10064142 Ga0207654_100641423 144
260 3300025911 Ga0207654_10129507 Ga0207654_101295072 144
261 3300025913 Ga0207695_10001572 Ga0207695_1000157213 144
262 3300025913 Ga0207695_10318467 Ga0207695_103184672 144
263 3300025914 Ga0207671_10714899 Ga0207671_107148991 144
264 3300025919 Ga0207657_10001837 Ga0207657_1000183717 144
265 3300025919 Ga0207657_10003867 Ga0207657_100038677 144
266 3300025921 Ga0207652_10017725 Ga0207652_100177255 144
267 3300025923 Ga0207681_10000396 Ga0207681_100003969 144
268 3300025923 Ga0207681_10003928 Ga0207681_100039287 144
269 3300025924 Ga0207694_10024090 Ga0207694_100240903 144
270 3300025924 Ga0207694_10026191 Ga0207694_100261914 144
271 3300025924 Ga0207694_10059209 Ga0207694_100592092 144
272 3300025925 Ga0207650_11084539 Ga0207650_110845392 144
273 3300025926 Ga0207659_10310445 Ga0207659_103104451 144
274 3300025927 Ga0207687_10000846 Ga0207687_1000084619 144
275 3300025931 Ga0207644_10000005 Ga0207644_10000005357 144
276 3300025931 Ga0207644_10010199 Ga0207644_100101996 144
277 3300025931 Ga0207644_10116397 Ga0207644_101163973 144
278 3300025933 Ga0207706_10078716 Ga0207706_100787163 144
279 3300025933 Ga0207706_10105296 Ga0207706_101052963 144
280 3300025934 Ga0207686_10001049 Ga0207686_1000104911 144
281 3300025935 Ga0207709_10000443 Ga0207709_1000044320 144
282 3300025938 Ga0207704_10000005 Ga0207704_10000005192 144
283 3300025940 Ga0207691_10240609 Ga0207691_102406092 144
284 3300025941 Ga0207711_10003787 Ga0207711_100037873 144
285 3300025941 Ga0207711_10414428 Ga0207711_104144282 144
286 3300025941 Ga0207711_10607664 Ga0207711_106076642 144
287 3300025941 Ga0207711_11000925 Ga0207711_110009252 144
288 3300025942 Ga0207689_10000285 Ga0207689_100002852 144
289 3300025949 Ga0207667_10001997 Ga0207667_1000199711 144
290 3300025949 Ga0207667_10024529 Ga0207667_100245293 144
291 3300025949 Ga0207667_10080397 Ga0207667_100803973 144
292 3300025949 Ga0207667_10287995 Ga0207667_102879952 144
293 3300025949 Ga0207667_10714339 Ga0207667_107143392 144
294 3300025960 Ga0207651_10000007 Ga0207651_10000007192 144
295 3300025961 Ga0207712_10175125 Ga0207712_101751252 144
296 3300025972 Ga0207668_10012797 Ga0207668_100127972 144
297 3300025972 Ga0207668_10544542 Ga0207668_105445422 144
298 3300025981 Ga0207640_10003333 Ga0207640_100033333 144
299 3300025981 Ga0207640_10007181 Ga0207640_100071817 144
300 3300025986 Ga0207658_10035761 Ga0207658_100357614 144
301 3300026023 Ga0207677_10000467 Ga0207677_1000046720 144
302 3300026035 Ga0207703_10006273 Ga0207703_100062736 144
303 3300026035 Ga0207703_10087722 Ga0207703_100877223 144
304 3300026041 Ga0207639_10169855 Ga0207639_101698551 144
305 3300026041 Ga0207639_11909778 Ga0207639_119097781 144
306 3300026067 Ga0207678_10000482 Ga0207678_1000048227 144
307 3300026078 Ga0207702_10014954 Ga0207702_100149542 144
308 3300026078 Ga0207702_10121993 Ga0207702_101219933 144
309 3300026078 Ga0207702_11150899 Ga0207702_111508992 144
310 3300026088 Ga0207641_10021696 Ga0207641_100216963 144
311 3300026088 Ga0207641_11448559 Ga0207641_114485592 144
312 3300026088 Ga0207641_11838925 Ga0207641_118389252 144
313 3300026089 Ga0207648_10000005 Ga0207648_10000005193 144
314 3300026095 Ga0207676_10060239 Ga0207676_100602392 144
315 3300026095 Ga0207676_10990427 Ga0207676_109904271 144
316 3300026118 Ga0207675_100075195 Ga0207675_1000751952 144
317 3300026121 Ga0207683_10014261 Ga0207683_100142618 144
318 3300026142 Ga0207698_10000084 Ga0207698_100000846 144
319 3300026142 Ga0207698_11138855 Ga0207698_111388551 144
320 3300027866 Ga0209813_10000044 Ga0209813_1000004434 144
321 3300027907 Ga0207428_10009543 Ga0207428_100095438 144
322 3300028379 Ga0268266_10000198 Ga0268266_1000019848 144
323 3300028379 Ga0268266_10251743 Ga0268266_102517431 144
324 3300028380 Ga0268265_10059643 Ga0268265_100596432 144
325 3300028381 Ga0268264_10006955 Ga0268264_100069554 144
326 3300028381 Ga0268264_10050267 Ga0268264_100502673 144
327 3300031727 Ga0316576_10444635 Ga0316576_104446352 144
328 3300031852 Ga0307410_11013581 Ga0307410_110135811 144
329 3300031911 Ga0307412_10021188 Ga0307412_100211882 144
330 3300031995 Ga0307409_100064896 Ga0307409_1000648962 144
331 3300031995 Ga0307409_101802520 Ga0307409_1018025201 144
332 3300032002 Ga0307416_100147855 Ga0307416_1001478552 144
333 3300032005 Ga0307411_10892314 Ga0307411_108923141 144
334 3300035091 Ga0373951_0087769 Ga0373951_0087769_64_519 144
335 3300035170 Ga0373943_0216339 Ga0373943_0216339_97_552 144
336 3300035725 Ga0373947_0097476 Ga0373947_0097476_1308_1763 144
337 3300037068 Ga0373925_0042983 Ga0373925_0042983_2575_3030 144
338 3300039450 Ga0436363_0207275 Ga0436363_0207275_129_578 144
339 3300039450 Ga0436363_1140649 Ga0436363_1140649_49_495 144
340 3300039453 Ga0436362_0579887 Ga0436362_0579887_1228_1689 144
341 3300041452 Ga0451793_1551097 Ga0451793_1551097_520_960 144
342 3300041459 Ga0451800_1276273 Ga0451800_1276273_522_962 144
343 3300041462 Ga0451806_474095 Ga0451806_474095_1321_1761 144
344 3300041486 Ga0451807_0784523 Ga0451807_0784523_467_907 144
345 3300042005 Ga0439448_0010868 Ga0439448_0010868_187_630 144
346 3300042135 Ga0450899_007325 Ga0450899_007325_601_1059 144
347 3300042876 Ga0451577_0061545 Ga0451577_0061545_647_1099 144
348 3300044658 Ga0466972_0467214 Ga0466972_0467214_104_556 144
349 3300044712 Ga0453684_0007018 Ga0453684_0007018_13232_13684 144
350 3300046460 Ga0495638_0015657 Ga0495638_0015657_1281_1760 144
351 3300046492 Ga0495585_0024662 Ga0495585_0024662_2480_2944 144
352 3300046501 Ga0495607_0009843 Ga0495607_0009843_1251_1706 144
353 3300046501 Ga0495607_0498363 Ga0495607_0498363_77_529 144
354 3300046506 Ga0495583_0000840 Ga0495583_0000840_903_1358 144
355 3300046512 Ga0495610_0105506 Ga0495610_0105506_333_812 144
356 3300046512 Ga0495610_0181681 Ga0495610_0181681_370_822 144
357 3300046522 Ga0495643_0038971 Ga0495643_0038971_2048_2503 144
358 3300046522 Ga0495643_0120013 Ga0495643_0120013_460_927 144
359 3300046524 Ga0495648_0271725 Ga0495648_0271725_213_668 144
360 3300046530 Ga0495654_0010598 Ga0495654_0010598_3011_3490 144
361 3300046530 Ga0495654_0023927 Ga0495654_0023927_225_686 144
362 3300046538 Ga0495609_0017504 Ga0495609_0017504_2102_2557 144
363 3300046539 Ga0495621_0003746 Ga0495621_0003746_2796_3233 144
364 3300046542 Ga0495597_0002515 Ga0495597_0002515_2830_3285 144
365 3300046616 Ga0495668_0545865 Ga0495668_0545865_35_514 144
366 3300046660 Ga0495625_0000112 Ga0495625_0000112_20029_20478 144
367 3300046660 Ga0495625_0277654 Ga0495625_0277654_308_787 144
368 3300046665 Ga0495661_0132074 Ga0495661_0132074_652_1107 144
369 3300046691 Ga0495670_0064150 Ga0495670_0064150_792_1247 144
370 3300046691 Ga0495670_0081318 Ga0495670_0081318_820_1281 144
371 3300046691 Ga0495670_0166495 Ga0495670_0166495_597_1058 144
372 3300046691 Ga0495670_0273268 Ga0495670_0273268_58_552 144
373 3300046810 Ga0495660_0106550 Ga0495660_0106550_915_1370 144
374 3300046810 Ga0495660_0144722 Ga0495660_0144722_118_585 144
375 3300047323 Ga0495683_0224880 Ga0495683_0224880_249_692 144
376 3300047472 Ga0495686_0001111 Ga0495686_0001111_17995_18444 144
377 3300048090 Ga0495615_0023425 Ga0495615_0023425_379_834 144
378 3300048903 Ga0496100_1164828 Ga0496100_1164828_31_468 144
379 3300048905 Ga0496102_0000043 Ga0496102_0000043_100772_101221 144
380 3300048905 Ga0496102_0159815 Ga0496102_0159815_1610_2062 144
381 3300048905 Ga0496102_0475139 Ga0496102_0475139_334_774 144
382 3300048905 Ga0496102_0671255 Ga0496102_0671255_285_722 144
383 3300048906 Ga0496103_0000086 Ga0496103_0000086_9352_9801 144
384 3300048906 Ga0496103_0008529 Ga0496103_0008529_5525_5965 144
385 3300048906 Ga0496103_0219971 Ga0496103_0219971_170_622 144
386 3300048907 Ga0496104_0452560 Ga0496104_0452560_45_497 144
387 3300048907 Ga0496104_1603154 Ga0496104_1603154_39_479 144
388 3300048907 Ga0496104_1636555 Ga0496104_1636555_13_450 144
389 3300048908 Ga0496105_0081042 Ga0496105_0081042_1968_2405 144
390 3300048909 Ga0496106_0001368 Ga0496106_0001368_9199_9651 144
391 3300048910 Ga0496107_0115156 Ga0496107_0115156_997_1449 144
392 3300048910 Ga0496107_0579846 Ga0496107_0579846_330_767 144
393 3300048911 Ga0496108_0031293 Ga0496108_0031293_2467_2919 144
394 3300048912 Ga0496109_0143360 Ga0496109_0143360_1760_2212 144
395 3300048912 Ga0496109_0158116 Ga0496109_0158116_819_1256 144
396 3300048913 Ga0496110_0287051 Ga0496110_0287051_341_778 144
397 3300048914 Ga0496111_0077000 Ga0496111_0077000_418_870 144
398 3300048914 Ga0496111_0348620 Ga0496111_0348620_84_521 144
399 3300048916 Ga0496113_0003385 Ga0496113_0003385_8665_9117 144
400 3300048919 Ga0496116_0001567 Ga0496116_0001567_9262_9711 144
401 3300048919 Ga0496116_0121530 Ga0496116_0121530_820_1260 144
402 3300048920 Ga0496117_0000104 Ga0496117_0000104_100772_101221 144
403 3300048920 Ga0496117_0026336 Ga0496117_0026336_821_1261 144
404 3300048921 Ga0496118_0000080 Ga0496118_0000080_87981_88430 144
405 3300048921 Ga0496118_0078895 Ga0496118_0078895_1490_1930 144
406 3300048922 Ga0496119_0020026 Ga0496119_0020026_373_840 144
407 3300048922 Ga0496119_0039356 Ga0496119_0039356_1231_1680 144
408 3300048924 Ga0496121_0000580 Ga0496121_0000580_15091_15540 144
409 3300048924 Ga0496121_0001326 Ga0496121_0001326_14228_14680 144
410 3300048924 Ga0496121_0004094 Ga0496121_0004094_15022_15474 144
411 3300048924 Ga0496121_0009720 Ga0496121_0009720_6071_6511 144
412 3300048924 Ga0496121_0050823 Ga0496121_0050823_29_478 144
413 3300048925 Ga0496122_0124333 Ga0496122_0124333_569_1009 144
414 3300048926 Ga0496123_0188291 Ga0496123_0188291_77_517 144
415 3300048927 Ga0496124_0000093 Ga0496124_0000093_87981_88430 144
416 3300048927 Ga0496124_0102678 Ga0496124_0102678_1010_1450 144
417 3300048927 Ga0496124_0239378 Ga0496124_0239378_592_1029 144
418 3300048928 Ga0496125_0031161 Ga0496125_0031161_1238_1684 144
419 3300048929 Ga0496126_0002621 Ga0496126_0002621_5744_6181 144
420 3300048929 Ga0496126_0023960 Ga0496126_0023960_1965_2405 144
421 3300048929 Ga0496126_0063465 Ga0496126_0063465_79_531 144
422 3300048929 Ga0496126_0069900 Ga0496126_0069900_103_552 144
423 3300049460 Ga0495682_0045995 Ga0495682_0045995_618_1073 144
424 3300049570 Ga0501033_0143192 Ga0501033_0143192_17_469 144
425 3300049578 Ga0501042_0226218 Ga0501042_0226218_486_935 144
426 3300049579 Ga0501043_0052967 Ga0501043_0052967_1271_1723 144
427 3300049580 Ga0501046_0492206 Ga0501046_0492206_412_864 144
428 3300049652 Ga0501202_197275 Ga0501202_197275_58_516 144
429 3300049663 Ga0501223_046671 Ga0501223_046671_371_829 144
430 3300049665 Ga0501227_073223 Ga0501227_073223_240_698 144
431 3300049679 Ga0501249_000872 Ga0501249_000872_1278_1736 144
432 3300049776 Ga0501280_006590 Ga0501280_006590_187_645 144
433 3300049822 Ga0501035_0279011 Ga0501035_0279011_674_1126 144
434 3300049822 Ga0501035_0875009 Ga0501035_0875009_237_695 144
435 3300049823 Ga0501044_0000340 Ga0501044_0000340_43211_43669 144
436 3300049823 Ga0501044_0041023 Ga0501044_0041023_3377_3829 144
437 3300049823 Ga0501044_0222665 Ga0501044_0222665_855_1304 144
438 3300049850 Ga0501204_001921 Ga0501204_001921_1041_1499 144
439 3300050489 nmdc:mga03683_7209_c1 nmdc:mga03683_7209_c1_3289_3744 144
440 3300050489 nmdc:mga03683_7229_c1 nmdc:mga03683_7229_c1_1434_1895 144
441 3300050490 nmdc:mga03n38_26160_c1 nmdc:mga03n38_26160_c1_1527_1988 144
442 3300050491 nmdc:mga00v17_4197_c1 nmdc:mga00v17_4197_c1_371_826 144
443 3300050492 nmdc:mga0yw44_344532_c1 nmdc:mga0yw44_344532_c1_446_907 144
444 3300050493 nmdc:mga0k408_148495_c1 nmdc:mga0k408_148495_c1_237_698 144
445 3300050493 nmdc:mga0k408_2765_c1 nmdc:mga0k408_2765_c1_2941_3381 144
446 3300050493 nmdc:mga0k408_532957_c1 nmdc:mga0k408_532957_c1_10_465 144
447 3300050494 nmdc:mga06z11_494_c1 nmdc:mga06z11_494_c1_9516_9977 144
448 3300050495 nmdc:mga04h51_31_c1 nmdc:mga04h51_31_c1_36013_36474 144
449 3300050496 nmdc:mga07m45_23_c1 nmdc:mga07m45_23_c1_91242_91703 144
450 3300050496 nmdc:mga07m45_687_c2 nmdc:mga07m45_687_c2_5584_6039 144
451 3300050496 nmdc:mga07m45_78119_c1 nmdc:mga07m45_78119_c1_715_1164 144
452 3300050516 nmdc:mga0sz30_206_c1 nmdc:mga0sz30_206_c1_19305_19766 144
453 3300053087 Ga0500643_050827 Ga0500643_050827_624_1103 144
454 3300053091 Ga0500647_0012526 Ga0500647_0012526_1570_2025 144
455 3300053093 Ga0500651_0011599 Ga0500651_0011599_3253_3708 144
456 3300053094 Ga0500566_0027494 Ga0500566_0027494_121_576 144
457 3300053103 Ga0500555_000430 Ga0500555_000430_2734_3189 144
458 3300053108 Ga0500562_117522 Ga0500562_117522_155_601 144
459 3300053116 Ga0500592_000066 Ga0500592_000066_7614_8075 144
460 3300053119 Ga0500595_055553 Ga0500595_055553_19_498 144
461 3300053121 Ga0500607_000122 Ga0500607_000122_58945_59406 144
462 3300053123 Ga0500614_002238 Ga0500614_002238_2808_3263 144
463 3300053125 Ga0500618_006541 Ga0500618_006541_317_772 144
464 3300053130 Ga0500642_0002935 Ga0500642_0002935_1162_1617 144
465 3300053131 Ga0500652_086794 Ga0500652_086794_499_954 144
466 3300053133 Ga0500655_000291 Ga0500655_000291_3973_4428 144
467 3300053139 Ga0500568_0126429 Ga0500568_0126429_450_899 144
468 3300053148 Ga0500590_002051 Ga0500590_002051_3987_4442 144
469 3300053151 Ga0500604_0015046 Ga0500604_0015046_1370_1831 144
470 3300053151 Ga0500604_0045045 Ga0500604_0045045_29_490 144
471 3300053151 Ga0500604_0065457 Ga0500604_0065457_80_523 144
472 3300053153 Ga0500616_0001309 Ga0500616_0001309_9656_10099 144
473 3300053153 Ga0500616_0037641 Ga0500616_0037641_546_995 144
474 3300053156 Ga0500622_0000910 Ga0500622_0000910_17929_18408 144
475 3300053156 Ga0500622_0022407 Ga0500622_0022407_2592_3047 144
476 3300053156 Ga0500622_0042556 Ga0500622_0042556_1739_2206 144
477 3300053158 Ga0500627_0000176 Ga0500627_0000176_13121_13582 144
478 3300053177 Ga0500636_0079895 Ga0500636_0079895_111_566 144
479 3300053724 Ga0500570_013929 Ga0500570_013929_3561_4016 144
480 3300053730 Ga0500645_010163 Ga0500645_010163_2034_2495 144
481 3300053730 Ga0500645_022122 Ga0500645_022122_1183_1626 144
482 3300059642 Ga0587069_067710 Ga0587069_067710_177_632 144
483 3300061719 Ga0466962_0173986 Ga0466962_0173986_41_487 144
484 iso_pu_bacteria 2946787523 2946789469 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00075

RNase_H

RNase H

20

160

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wsj-assembly5.cif.gz_E crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9774 1 141
2z1j-assembly1.cif.gz_A crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k) 0.9762 1 141
1wsj-assembly3.cif.gz_C crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.976 1 141
2z1h-assembly1.cif.gz_A crystal structure of e.coli rnase hi surface charged mutant(q4r/t92k/q105k/q113r/q115k/n143k/t145k) 0.9739 1 141
2zqb-assembly1.cif.gz_C crystal structure of a psychrotrophic rnasehi variant with sextuple thermostabilizing mutations 0.9708 1 143
ID Description Score Start End Superfamily
af_A0A0R0EHL2_85_153_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9764 4 56 3.30.420.10
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9647 2 141 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9583 1 144 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9261 1 144 3.30.420.10
4ibnA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9095 1 144 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A3D0XTL9-F1-model_v4 Ribonuclease HI 1.005 1 64 GO:0003676
GO:0004523
AF-A0A257YG02-F1-model_v4 Ribonuclease H (RNase H) (EC 3.1.26.4) 1.004 1 143 GO:0000287
GO:0003676
GO:0004523
GO:0005737
GO:0043137
AF-A0A0G9MSR0-F1-model_v4 Ribonuclease H (RNase H) (EC 3.1.26.4) 1.001 1 144 GO:0000287
GO:0003676
GO:0004523
GO:0005737
GO:0043137
AF-A0A259IBM5-F1-model_v4 Ribonuclease H (RNase H) (EC 3.1.26.4) 0.9998 1 142 GO:0000287
GO:0003676
GO:0004523
GO:0005737
GO:0043137
AF-A0A258X9Y1-F1-model_v4 Ribonuclease H (RNase H) (EC 3.1.26.4) 0.9997 1 142 GO:0000287
GO:0003676
GO:0004523
GO:0005737
GO:0043137

Feature Viewer

pLDDT pTM Quality
95.37 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map