F452909

General Info

Members Datasets Scaffolds Average Seq Length
484 268 968 140

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100365174|Ga0075428_1003651742
Length 152
Sequence MPEEDGVSQTKPRRRPDGEVISQRAAEAVGPYPHARRAGSLLFVSGIGPRKRGTKEIPGATLDSQGKVVSYDIDAQCRSVFENLRYILEDAGTSWDKIVDVTAFLTNMDDFAAYNKVYAEHFPDNRPARTTVEVNRLPTPIAVELKVIATLD

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
212 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
213 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
217 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
218 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
254 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
255 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
256 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
257 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
258 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
259 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.31
Rhizosphere 95.66
Stem 0
Stem Tuber 0
Unclassified 9.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100365174 3300006844 Bacteria 1548
2 JGI24747J21853_1001606 3300001978 Bacteria 1724
3 JGI24739J22299_10083034 3300001989 Bacteria 982
4 JGI24737J22298_10014448 3300001990 Bacteria 2563
5 JGI24748J21848_1000717 3300002074 Bacteria 3581
6 JGI24749J21850_1001969 3300002076 Bacteria 2899
7 JGI24744J21845_10011636 3300002077 Bacteria 1797
8 JGI24034J26672_10000720 3300002239 Bacteria 4257
9 JGI25404J52841_10004682 3300003659 Bacteria 2789
10 Ga0065712_10141030 3300005290 Bacteria 1450
11 Ga0065715_10162607 3300005293 Bacteria 1615
12 Ga0065707_10173559 3300005295 Bacteria 1467
13 Ga0070658_10001254 3300005327 Bacteria 21751
14 Ga0070658_10111228 3300005327 Bacteria 2270
15 Ga0070676_10003356 3300005328 Bacteria 8331
16 Ga0070676_10023647 3300005328 Bacteria 3455
17 Ga0070683_100001622 3300005329 Bacteria 17399
18 Ga0070683_100191096 3300005329 Bacteria 1944
19 Ga0070690_100000327 3300005330 Bacteria 24351
20 Ga0070670_100013423 3300005331 Bacteria 7016
21 Ga0070670_100823608 3300005331 Unclassified 839
22 Ga0070670_101511527 3300005331 Bacteria 617
23 Ga0070677_10000209 3300005333 Bacteria 20187
24 Ga0070677_10004018 3300005333 Unclassified 4777
25 Ga0068869_100000286 3300005334 Bacteria 26923
26 Ga0068869_100783364 3300005334 Bacteria 818
27 Ga0070666_10000805 3300005335 Bacteria 19067
28 Ga0070680_100002873 3300005336 Bacteria 12792
29 Ga0070680_101118957 3300005336 Bacteria 681
30 Ga0068868_100000557 3300005338 Bacteria 24976
31 Ga0068868_100002964 3300005338 Bacteria 11784
32 Ga0068868_100654478 3300005338 Unclassified 936
33 Ga0070660_100000479 3300005339 Bacteria 26732
34 Ga0070660_101111525 3300005339 Unclassified 669
35 Ga0070689_100000344 3300005340 Bacteria 27203
36 Ga0070689_100061892 3300005340 Bacteria 2911
37 Ga0070689_100394678 3300005340 Bacteria 1168
38 Ga0070691_10043824 3300005341 Bacteria 2120
39 Ga0070687_100000032 3300005343 Bacteria 43649
40 Ga0070661_100000412 3300005344 Bacteria 33114
41 Ga0070661_100001964 3300005344 Bacteria 14204
42 Ga0070661_100537879 3300005344 Bacteria 939
43 Ga0070661_100756225 3300005344 Bacteria 795
44 Ga0070692_10013772 3300005345 Bacteria 3780
45 Ga0070668_100000345 3300005347 Bacteria 30655
46 Ga0070669_100000307 3300005353 Bacteria 38485
47 Ga0070675_100001155 3300005354 Bacteria 19067
48 Ga0070675_100003395 3300005354 Bacteria 12063
49 Ga0070671_100003430 3300005355 Bacteria 12374
50 Ga0070671_100014228 3300005355 Bacteria 6425
51 Ga0070674_100000600 3300005356 Bacteria 18217
52 Ga0070673_100001765 3300005364 Bacteria 12883
53 Ga0070673_100130339 3300005364 Bacteria 2109
54 Ga0070673_100370496 3300005364 Bacteria 1275
55 Ga0070688_100000122 3300005365 Bacteria 41175
56 Ga0070688_100006427 3300005365 Bacteria 6282
57 Ga0070659_100000635 3300005366 Bacteria 25714
58 Ga0070667_100008888 3300005367 Bacteria 8315
59 Ga0070667_100064873 3300005367 Bacteria 3099
60 Ga0070667_100669535 3300005367 Bacteria 959
61 Ga0070714_100001058 3300005435 Bacteria 19666
62 Ga0070714_100367459 3300005435 Bacteria 1354
63 Ga0070713_100333705 3300005436 Bacteria 1403
64 Ga0070701_10013876 3300005438 Bacteria 3677
65 Ga0070711_100213767 3300005439 Bacteria 1495
66 Ga0070705_100000279 3300005440 Bacteria 30554
67 Ga0070705_100195785 3300005440 Bacteria 1381
68 Ga0070700_100271301 3300005441 Unclassified 1226
69 Ga0070694_100026838 3300005444 Bacteria 3736
70 Ga0070694_100295778 3300005444 Bacteria 1239
71 Ga0070663_100000597 3300005455 Bacteria 19230
72 Ga0070663_101234806 3300005455 Bacteria 658
73 Ga0070678_100002705 3300005456 Bacteria 9783
74 Ga0070678_100070930 3300005456 Bacteria 2607
75 Ga0070678_100110605 3300005456 Bacteria 2149
76 Ga0070678_100143443 3300005456 Bacteria 1914
77 Ga0070662_100000190 3300005457 Bacteria 35766
78 Ga0070662_100366060 3300005457 Unclassified 1184
79 Ga0070662_100897507 3300005457 Bacteria 756
80 Ga0070681_10033955 3300005458 Bacteria 5122
81 Ga0070681_10395984 3300005458 Bacteria 1292
82 Ga0068867_100003036 3300005459 Bacteria 11838
83 Ga0068867_100702639 3300005459 Bacteria 892
84 Ga0070685_10000369 3300005466 Bacteria 27325
85 Ga0070685_10003127 3300005466 Bacteria 8418
86 Ga0070685_10110872 3300005466 Bacteria 1689
87 Ga0070679_100525456 3300005530 Bacteria 1127
88 Ga0070684_100014406 3300005535 Bacteria 6407
89 Ga0070684_100115556 3300005535 Bacteria 2410
90 Ga0070684_100117499 3300005535 Bacteria 2390
91 Ga0068853_100000259 3300005539 Bacteria 37244
92 Ga0068853_100020356 3300005539 Bacteria 5517
93 Ga0068853_100020783 3300005539 Bacteria 5462
94 Ga0070672_100000406 3300005543 Bacteria 24976
95 Ga0070672_100254736 3300005543 Bacteria 1479
96 Ga0070672_100608040 3300005543 Bacteria 953
97 Ga0070686_100000081 3300005544 Bacteria 69623
98 Ga0070686_100192419 3300005544 Unclassified 1457
99 Ga0070695_100221738 3300005545 Bacteria 1363
100 Ga0070695_100275547 3300005545 Bacteria 1234
101 Ga0070696_100523859 3300005546 Bacteria 946
102 Ga0070693_100010235 3300005547 Bacteria 4692
103 Ga0070665_100010946 3300005548 Bacteria 9174
104 Ga0070704_100039510 3300005549 Bacteria 3240
105 Ga0070704_101784141 3300005549 Unclassified 569
106 Ga0068855_100001159 3300005563 Bacteria 32670
107 Ga0068855_100218694 3300005563 Bacteria 2137
108 Ga0070664_100001026 3300005564 Bacteria 21934
109 Ga0070664_100001532 3300005564 Bacteria 18458
110 Ga0070664_100081494 3300005564 Bacteria 2789
111 Ga0070664_100081850 3300005564 Bacteria 2783
112 Ga0070664_100147350 3300005564 Bacteria 2076
113 Ga0070664_100161764 3300005564 Bacteria 1981
114 Ga0070664_100211844 3300005564 Bacteria 1732
115 Ga0070664_100818572 3300005564 Unclassified 871
116 Ga0068857_100001061 3300005577 Bacteria 21266
117 Ga0068857_100002895 3300005577 Bacteria 14124
118 Ga0068857_100003310 3300005577 Bacteria 13395
119 Ga0068854_100000223 3300005578 Bacteria 38461
120 Ga0068854_100198645 3300005578 Bacteria 1575
121 Ga0068854_100410763 3300005578 Bacteria 1122
122 Ga0068854_100414154 3300005578 Bacteria 1118
123 Ga0068856_100005028 3300005614 Bacteria 13094
124 Ga0070702_100000849 3300005615 Bacteria 11781
125 Ga0070702_100037042 3300005615 Bacteria 2707
126 Ga0068852_100000420 3300005616 Bacteria 28321
127 Ga0068859_100006848 3300005617 Bacteria 11576
128 Ga0068859_100010357 3300005617 Bacteria 9379
129 Ga0068859_101316544 3300005617 Bacteria 796
130 Ga0068864_100004095 3300005618 Bacteria 11973
131 Ga0068864_100543608 3300005618 Bacteria 1122
132 Ga0068864_100657632 3300005618 Unclassified 1021
133 Ga0068866_10000018 3300005718 Bacteria 65387
134 Ga0068861_100000738 3300005719 Bacteria 19593
135 Ga0068861_100507398 3300005719 Bacteria 1091
136 Ga0068861_101015914 3300005719 Bacteria 792
137 Ga0068851_10000206 3300005834 Bacteria 28472
138 Ga0068870_10000033 3300005840 Bacteria 44161
139 Ga0068863_100000937 3300005841 Bacteria 29293
140 Ga0068863_100197632 3300005841 Bacteria 1933
141 Ga0068863_100970094 3300005841 Unclassified 852
142 Ga0068858_100009300 3300005842 Bacteria 9379
143 Ga0068858_100535078 3300005842 Bacteria 1134
144 Ga0068860_100002378 3300005843 Bacteria 19763
145 Ga0068860_101926977 3300005843 Unclassified 612
146 Ga0068862_100000659 3300005844 Bacteria 35380
147 Ga0081455_10250594 3300005937 Bacteria 1295
148 Ga0081540_1000141 3300005983 Bacteria 75070
149 Ga0081540_1000258 3300005983 Bacteria 55927
150 Ga0081540_1003160 3300005983 Bacteria 13144
151 Ga0070716_100062423 3300006173 Bacteria 2160
152 Ga0070712_100675148 3300006175 Bacteria 879
153 Ga0097621_100000812 3300006237 Bacteria 22030
154 Ga0097621_100030223 3300006237 Bacteria 4286
155 Ga0097621_100072090 3300006237 Bacteria 2857
156 Ga0068871_100000098 3300006358 Bacteria 51943
157 Ga0068871_100135927 3300006358 Bacteria 2088
158 Ga0068871_100739222 3300006358 Bacteria 904
159 Ga0075428_100104825 3300006844 Bacteria 3084
160 Ga0075428_100132211 3300006844 Bacteria 2714
161 Ga0075428_102410331 3300006844 Bacteria 540
162 Ga0075430_100042980 3300006846 Bacteria 3821
163 Ga0075430_100658664 3300006846 Bacteria 863
164 Ga0075431_100082748 3300006847 Bacteria 3314
165 Ga0075431_100111246 3300006847 Bacteria 2827
166 Ga0068865_100000442 3300006881 Bacteria 23069
167 Ga0068865_100002265 3300006881 Bacteria 11321
168 Ga0068865_100600064 3300006881 Bacteria 930
169 Ga0097620_100006848 3300006931 Bacteria 11576
170 Ga0097620_100010356 3300006931 Bacteria 9379
171 Ga0097620_101316710 3300006931 Bacteria 796
172 Ga0075435_100172002 3300007076 Bacteria 1828
173 Ga0105251_10403807 3300009011 Bacteria 628
174 Ga0111539_10067497 3300009094 Bacteria 4223
175 Ga0111539_10486995 3300009094 Bacteria 1437
176 Ga0111539_10734943 3300009094 Bacteria 1149
177 Ga0105247_10001005 3300009101 Bacteria 21321
178 Ga0105247_10150749 3300009101 Unclassified 1532
179 Ga0105243_10876152 3300009148 Bacteria 891
180 Ga0105241_10063266 3300009174 Bacteria 2854
181 Ga0105241_11443901 3300009174 Bacteria 660
182 Ga0105242_10013836 3300009176 Bacteria 6245
183 Ga0105242_10078050 3300009176 Bacteria 2764
184 Ga0105248_11661553 3300009177 Unclassified 724
185 Ga0105249_10187736 3300009553 Unclassified 2015
186 Ga0105239_10130361 3300010375 Bacteria 2796
187 Ga0157373_11297372 3300013100 Bacteria 551
188 Ga0157371_10306352 3300013102 Bacteria 1150
189 Ga0157370_10552174 3300013104 Bacteria 1056
190 Ga0157370_11787658 3300013104 Unclassified 552
191 Ga0157369_10039346 3300013105 Bacteria 5168
192 Ga0157374_10042545 3300013296 Bacteria 4190
193 Ga0157378_10038348 3300013297 Bacteria 4246
194 Ga0157378_10676549 3300013297 Bacteria 1050
195 Ga0163162_10015627 3300013306 Bacteria 7418
196 Ga0163162_10443316 3300013306 Bacteria 1431
197 Ga0157372_10052414 3300013307 Bacteria 4543
198 Ga0157372_10953665 3300013307 Bacteria 994
199 Ga0157372_11214980 3300013307 Bacteria 871
200 Ga0157375_10038134 3300013308 Bacteria 4611
201 Ga0157375_10822580 3300013308 Unclassified 1077
202 Ga0157375_11405627 3300013308 Bacteria 822
203 Ga0163163_10010007 3300014325 Bacteria 8503
204 Ga0163163_10150011 3300014325 Bacteria 2375
205 Ga0163163_10388908 3300014325 Bacteria 1452
206 Ga0157380_10003019 3300014326 Bacteria 11465
207 Ga0157380_10021836 3300014326 Bacteria 4808
208 Ga0157380_12212053 3300014326 Unclassified 614
209 Ga0157377_10593386 3300014745 Bacteria 789
210 Ga0157379_10000098 3300014968 Bacteria 59060
211 Ga0157376_10303037 3300014969 Bacteria 1513
212 Ga0163161_10038345 3300017792 Bacteria 3437
213 Ga0213874_10050054 3300021377 Bacteria 1279
214 Ga0207697_10001247 3300025315 Bacteria 13947
215 Ga0207697_10175681 3300025315 Bacteria 938
216 Ga0207656_10001481 3300025321 Bacteria 7773
217 Ga0207696_1086637 3300025711 Bacteria 861
218 Ga0207696_1133225 3300025711 Unclassified 667
219 Ga0207682_10001691 3300025893 Bacteria 10110
220 Ga0207682_10045741 3300025893 Unclassified 1797
221 Ga0207642_10000386 3300025899 Bacteria 13199
222 Ga0207710_10001837 3300025900 Bacteria 10231
223 Ga0207710_10128523 3300025900 Bacteria 1215
224 Ga0207688_10000100 3300025901 Bacteria 34208
225 Ga0207680_10000207 3300025903 Bacteria 28427
226 Ga0207680_10235738 3300025903 Bacteria 1259
227 Ga0207647_10001302 3300025904 Bacteria 19206
228 Ga0207645_10000386 3300025907 Bacteria 36411
229 Ga0207645_10121851 3300025907 Unclassified 1693
230 Ga0207643_10000002 3300025908 Bacteria 224909
231 Ga0207643_10041137 3300025908 Bacteria 2604
232 Ga0207705_10093046 3300025909 Bacteria 2210
233 Ga0207705_10434375 3300025909 Bacteria 1017
234 Ga0207705_10769426 3300025909 Unclassified 748
235 Ga0207654_10004228 3300025911 Bacteria 7243
236 Ga0207707_10077681 3300025912 Bacteria 2898
237 Ga0207707_10165983 3300025912 Bacteria 1929
238 Ga0207695_10043836 3300025913 Bacteria 4763
239 Ga0207695_10525955 3300025913 Bacteria 1064
240 Ga0207671_10000756 3300025914 Bacteria 41002
241 Ga0207693_10315580 3300025915 Bacteria 1224
242 Ga0207693_10647017 3300025915 Bacteria 821
243 Ga0207663_10703922 3300025916 Bacteria 800
244 Ga0207660_10072347 3300025917 Bacteria 2511
245 Ga0207662_10000011 3300025918 Bacteria 90777
246 Ga0207662_10797204 3300025918 Bacteria 666
247 Ga0207657_10000607 3300025919 Bacteria 38122
248 Ga0207657_10046911 3300025919 Bacteria 3783
249 Ga0207657_10635555 3300025919 Unclassified 831
250 Ga0207649_10000627 3300025920 Bacteria 23719
251 Ga0207649_10002450 3300025920 Bacteria 10388
252 Ga0207649_10417225 3300025920 Bacteria 1007
253 Ga0207649_10436449 3300025920 Bacteria 986
254 Ga0207649_10885504 3300025920 Bacteria 699
255 Ga0207681_10000108 3300025923 Bacteria 71434
256 Ga0207694_10007411 3300025924 Bacteria 8322
257 Ga0207650_10000349 3300025925 Bacteria 44570
258 Ga0207650_10051679 3300025925 Bacteria 3042
259 Ga0207659_10000123 3300025926 Bacteria 45421
260 Ga0207659_10095313 3300025926 Bacteria 2231
261 Ga0207659_10836088 3300025926 Unclassified 791
262 Ga0207659_11717215 3300025926 Bacteria 534
263 Ga0207687_10003914 3300025927 Bacteria 9981
264 Ga0207700_10038833 3300025928 Bacteria 3459
265 Ga0207664_10000874 3300025929 Bacteria 20374
266 Ga0207644_10000565 3300025931 Bacteria 23709
267 Ga0207644_10038923 3300025931 Bacteria 3353
268 Ga0207644_10626306 3300025931 Bacteria 894
269 Ga0207690_10001018 3300025932 Bacteria 17940
270 Ga0207706_10000078 3300025933 Bacteria 100847
271 Ga0207686_10005642 3300025934 Bacteria 6707
272 Ga0207686_10067400 3300025934 Bacteria 2290
273 Ga0207686_10613968 3300025934 Bacteria 857
274 Ga0207709_10035162 3300025935 Bacteria 2960
275 Ga0207670_10000224 3300025936 Bacteria 36974
276 Ga0207670_10029508 3300025936 Bacteria 3495
277 Ga0207670_10366866 3300025936 Bacteria 1144
278 Ga0207670_10984911 3300025936 Unclassified 709
279 Ga0207669_10002589 3300025937 Bacteria 7729
280 Ga0207704_10000199 3300025938 Bacteria 30848
281 Ga0207704_10004475 3300025938 Bacteria 6387
282 Ga0207665_10036565 3300025939 Bacteria 3266
283 Ga0207691_10000389 3300025940 Bacteria 43983
284 Ga0207691_10069210 3300025940 Bacteria 3188
285 Ga0207691_10458894 3300025940 Bacteria 1084
286 Ga0207711_10001003 3300025941 Bacteria 27077
287 Ga0207711_10002221 3300025941 Bacteria 17432
288 Ga0207711_11503053 3300025941 Bacteria 616
289 Ga0207711_11940229 3300025941 Bacteria 532
290 Ga0207689_10000523 3300025942 Bacteria 36411
291 Ga0207689_11339220 3300025942 Unclassified 601
292 Ga0207661_10002620 3300025944 Bacteria 12385
293 Ga0207661_10107033 3300025944 Bacteria 2358
294 Ga0207661_10142520 3300025944 Bacteria 2064
295 Ga0207661_11788429 3300025944 Bacteria 560
296 Ga0207679_10000442 3300025945 Bacteria 29194
297 Ga0207679_10003533 3300025945 Bacteria 9676
298 Ga0207679_10071960 3300025945 Bacteria 2610
299 Ga0207679_10155171 3300025945 Bacteria 1868
300 Ga0207679_10297315 3300025945 Bacteria 1390
301 Ga0207679_10890048 3300025945 Bacteria 814
302 Ga0207667_10011534 3300025949 Bacteria 10268
303 Ga0207651_10000020 3300025960 Bacteria 83049
304 Ga0207651_10243616 3300025960 Bacteria 1467
305 Ga0207651_10325237 3300025960 Bacteria 1287
306 Ga0207712_10000666 3300025961 Bacteria 26658
307 Ga0207712_10015934 3300025961 Unclassified 4859
308 Ga0207668_10228178 3300025972 Bacteria 1499
309 Ga0207640_10000302 3300025981 Bacteria 32782
310 Ga0207640_10161961 3300025981 Bacteria 1656
311 Ga0207640_10162573 3300025981 Bacteria 1654
312 Ga0207640_10583028 3300025981 Bacteria 944
313 Ga0207658_10000437 3300025986 Bacteria 39386
314 Ga0207658_10029516 3300025986 Bacteria 3874
315 Ga0207677_10000079 3300026023 Bacteria 79753
316 Ga0207703_10000148 3300026035 Bacteria 81341
317 Ga0207703_10000236 3300026035 Bacteria 62877
318 Ga0207703_10022917 3300026035 Bacteria 4904
319 Ga0207639_10000609 3300026041 Bacteria 24634
320 Ga0207639_10006727 3300026041 Bacteria 7820
321 Ga0207639_10265571 3300026041 Bacteria 1503
322 Ga0207678_10001757 3300026067 Bacteria 19846
323 Ga0207702_10009610 3300026078 Bacteria 8116
324 Ga0207702_10905682 3300026078 Bacteria 874
325 Ga0207641_10016042 3300026088 Bacteria 6134
326 Ga0207641_10030088 3300026088 Bacteria 4495
327 Ga0207648_10000497 3300026089 Bacteria 43780
328 Ga0207648_10349450 3300026089 Bacteria 1333
329 Ga0207648_10963701 3300026089 Bacteria 798
330 Ga0207676_10000636 3300026095 Bacteria 28319
331 Ga0207676_10004297 3300026095 Bacteria 10070
332 Ga0207676_10072105 3300026095 Bacteria 2775
333 Ga0207676_10406456 3300026095 Bacteria 1274
334 Ga0207676_10810414 3300026095 Bacteria 914
335 Ga0207674_10000427 3300026116 Bacteria 54893
336 Ga0207674_10001529 3300026116 Bacteria 29791
337 Ga0207674_10004939 3300026116 Bacteria 15929
338 Ga0207675_100000006 3300026118 Bacteria 189749
339 Ga0207675_100487832 3300026118 Bacteria 1225
340 Ga0207675_101064670 3300026118 Unclassified 828
341 Ga0207683_10000589 3300026121 Bacteria 33426
342 Ga0207683_10059352 3300026121 Bacteria 3360
343 Ga0207683_10180310 3300026121 Bacteria 1915
344 Ga0207683_10197510 3300026121 Bacteria 1828
345 Ga0207683_10207331 3300026121 Bacteria 1783
346 Ga0207698_10000382 3300026142 Bacteria 25568
347 Ga0207698_10124618 3300026142 Bacteria 2188
348 Ga0209998_10115156 3300027717 Bacteria 674
349 Ga0209974_10110939 3300027876 Bacteria 965
350 Ga0268266_10000687 3300028379 Bacteria 45601
351 Ga0268265_10001081 3300028380 Bacteria 24268
352 Ga0268265_10177097 3300028380 Bacteria 1829
353 Ga0268265_11506065 3300028380 Bacteria 676
354 Ga0268264_10000447 3300028381 Bacteria 56371
355 Ga0268264_10000705 3300028381 Bacteria 38562
356 Ga0265334_10000008 3300028573 Bacteria 200602
357 Ga0265318_10217117 3300028577 Bacteria 699
358 Ga0265338_10081181 3300028800 Bacteria 2720
359 Ga0265327_10016046 3300031251 Bacteria 4789
360 Ga0307408_100325215 3300031548 Unclassified 1297
361 Ga0307408_100338213 3300031548 Bacteria 1273
362 Ga0265313_10000076 3300031595 Bacteria 96542
363 Ga0265313_10101286 3300031595 Bacteria 1278
364 Ga0316575_10070913 3300031665 Bacteria 1400
365 Ga0307405_10464328 3300031731 Bacteria 1007
366 Ga0307413_10046948 3300031824 Bacteria 2572
367 Ga0307413_10053134 3300031824 Bacteria 2451
368 Ga0307413_10136229 3300031824 Unclassified 1689
369 Ga0307413_10184857 3300031824 Bacteria 1490
370 Ga0307413_10315465 3300031824 Unclassified 1192
371 Ga0307410_10009777 3300031852 Bacteria 5398
372 Ga0307410_10124776 3300031852 Unclassified 1883
373 Ga0307410_10201804 3300031852 Bacteria 1518
374 Ga0307410_11255698 3300031852 Bacteria 647
375 Ga0307406_10455148 3300031901 Bacteria 1028
376 Ga0307406_10660201 3300031901 Bacteria 869
377 Ga0307406_10969620 3300031901 Unclassified 728
378 Ga0307407_10054050 3300031903 Unclassified 2314
379 Ga0307407_10085155 3300031903 Bacteria 1922
380 Ga0307407_10147956 3300031903 Bacteria 1523
381 Ga0307412_10054463 3300031911 Bacteria 2656
382 Ga0307409_100029637 3300031995 Bacteria 3919
383 Ga0307409_100118184 3300031995 Bacteria 2239
384 Ga0307409_100357742 3300031995 Bacteria 1380
385 Ga0307416_100079109 3300032002 Bacteria 2769
386 Ga0307416_100319685 3300032002 Bacteria 1553
387 Ga0307416_101849660 3300032002 Bacteria 707
388 Ga0307416_101881537 3300032002 Bacteria 702
389 Ga0307414_10060830 3300032004 Bacteria 2673
390 Ga0307414_10329323 3300032004 Bacteria 1303
391 Ga0307411_10044503 3300032005 Bacteria 2848
392 Ga0307411_10068429 3300032005 Bacteria 2393
393 Ga0307411_10201339 3300032005 Bacteria 1529
394 Ga0307411_10302549 3300032005 Unclassified 1283
395 Ga0307415_100013136 3300032126 Bacteria 4822
396 Ga0307415_100167250 3300032126 Bacteria 1711
397 Ga0307415_100466095 3300032126 Unclassified 1096
398 Ga0307415_101300274 3300032126 Unclassified 689
399 Ga0373930_0058637 3300034816 Bacteria 855
400 Ga0373926_0160987 3300035083 Bacteria 857
401 Ga0373929_0159636 3300035085 Bacteria 610
402 Ga0373951_0206030 3300035091 Bacteria 575
403 Ga0373932_0218669 3300035112 Bacteria 684
404 Ga0373945_0005329 3300035116 Bacteria 4116
405 Ga0373943_0681693 3300035170 Bacteria 608
406 Ga0373946_0063103 3300035171 Bacteria 1581
407 Ga0373927_0000001 3300035695 Bacteria 1082160
408 Ga0373937_0169878 3300036401 Bacteria 2046
409 Ga0373937_0259919 3300036401 Bacteria 1637
410 Ga0373925_0000241 3300037068 Bacteria 57902
411 Ga0395900_0006717 3300037418 Bacteria 11943
412 Ga0436360_0998048 3300039438 Bacteria 1156
413 Ga0451807_0616362 3300041486 Bacteria 656
414 Ga0451837_1605580 3300041494 Bacteria 2290
415 Ga0451839_0704564 3300041496 Bacteria 723
416 Ga0451853_1538364 3300041512 Bacteria 1061
417 Ga0439448_0024925 3300042005 Bacteria 1873
418 Ga0439455_0018316 3300042012 Bacteria 1641
419 Ga0439458_0025879 3300042157 Bacteria 1378
420 Ga0439444_0073343 3300042437 Bacteria 737
421 Ga0451577_0049141 3300042876 Bacteria 3767
422 Ga0451577_0217602 3300042876 Bacteria 1726
423 Ga0453683_0463980 3300044673 Bacteria 820
424 Ga0453684_1465337 3300044712 Bacteria 705
425 Ga0451576_0014574 3300045051 Bacteria 8738
426 Ga0451576_2154280 3300045051 Bacteria 573
427 Ga0495629_0000009 3300046459 Bacteria 348242
428 Ga0495639_0000260 3300046475 Bacteria 26124
429 Ga0495628_0331839 3300046516 Bacteria 1121
430 Ga0495630_0091499 3300046517 Bacteria 2298
431 Ga0495630_0153888 3300046517 Bacteria 1750
432 Ga0495630_0314949 3300046517 Bacteria 1196
433 Ga0495666_0000238 3300046526 Bacteria 23620
434 Ga0495586_0000473 3300046535 Bacteria 23970
435 Ga0495622_0131207 3300046557 Bacteria 1141
436 Ga0495668_0001246 3300046616 Bacteria 25534
437 Ga0495635_0007147 3300046663 Bacteria 7800
438 Ga0495588_0075776 3300046674 Bacteria 1753
439 Ga0495658_0030579 3300046683 Bacteria 2925
440 Ga0495613_0020956 3300046689 Bacteria 4873
441 Ga0495613_0113908 3300046689 Bacteria 1947
442 Ga0495613_0218704 3300046689 Bacteria 1338
443 Ga0495624_0115201 3300046690 Bacteria 1652
444 Ga0495672_0357305 3300047320 Unclassified 677
445 Ga0495676_0003955 3300047321 Bacteria 13490
446 Ga0495680_0003926 3300047322 Bacteria 14379
447 Ga0495684_0017103 3300047471 Bacteria 5585
448 Ga0495684_0228053 3300047471 Bacteria 1363
449 Ga0495684_0889207 3300047471 Unclassified 575
450 Ga0496101_0181012 3300048904 Bacteria 1623
451 Ga0496101_0291299 3300048904 Bacteria 1277
452 Ga0496102_0000795 3300048905 Bacteria 30629
453 Ga0496104_0158071 3300048907 Unclassified 2175
454 Ga0496104_0191104 3300048907 Bacteria 1959
455 Ga0496106_0000648 3300048909 Bacteria 24888
456 Ga0496107_0235819 3300048910 Bacteria 1361
457 Ga0496108_0025501 3300048911 Bacteria 4872
458 Ga0496109_0020726 3300048912 Bacteria 5806
459 Ga0496109_0206018 3300048912 Unclassified 1849
460 Ga0496112_0000385 3300048915 Bacteria 28974
461 Ga0496113_0102667 3300048916 Bacteria 2217
462 Ga0496114_0685335 3300048917 Bacteria 899
463 Ga0496114_0814574 3300048917 Bacteria 813
464 Ga0496115_0413236 3300048918 Bacteria 1094
465 Ga0501046_0136130 3300049580 Bacteria 1860
466 Ga0501047_0113778 3300049581 Bacteria 2588
467 Ga0501198_068338 3300049649 Bacteria 665
468 Ga0501239_015282 3300049672 Bacteria 896
469 Ga0501242_039648 3300049674 Bacteria 662
470 Ga0501257_043849 3300049686 Bacteria 1103
471 Ga0501266_024690 3300049763 Unclassified 836
472 Ga0501272_059112 3300049769 Unclassified 545
473 Ga0501273_020402 3300049770 Bacteria 894
474 nmdc:mga05p37_926826_c1 3300050507 Bacteria 935
475 nmdc:mga0qj67_32404_c1 3300050509 Bacteria 4075
476 nmdc:mga06r32_517526_c1 3300050510 Unclassified 1169
477 nmdc:mga06r32_70187_c1 3300050510 Bacteria 3387
478 nmdc:mga08y16_1665732_c1 3300050511 Unclassified 594
479 nmdc:mga08y16_572646_c1 3300050511 Bacteria 1141
480 nmdc:mga0n895_783139_c1 3300050512 Bacteria 945
481 nmdc:mga0rr50_120422_c1 3300050513 Bacteria 2088
482 Ga0495619_0192897 3300053085 Bacteria 1410
483 Ga0501082_0585465 3300060353 Bacteria 976
484 2673162361 2671180531 Bacteria 9045424
485 Ga0075428_100365174
486 JGI24747J21853_1001606
487 JGI24739J22299_10083034
488 JGI24737J22298_10014448
489 JGI24748J21848_1000717
490 JGI24749J21850_1001969
491 JGI24744J21845_10011636
492 JGI24034J26672_10000720
493 JGI25404J52841_10004682
494 Ga0065712_10141030
495 Ga0065715_10162607
496 Ga0065707_10173559
497 Ga0070658_10001254
498 Ga0070658_10111228
499 Ga0070676_10003356
500 Ga0070676_10023647
501 Ga0070683_100001622
502 Ga0070683_100191096
503 Ga0070690_100000327
504 Ga0070670_100013423
505 Ga0070670_100823608
506 Ga0070670_101511527
507 Ga0070677_10000209
508 Ga0070677_10004018
509 Ga0068869_100000286
510 Ga0068869_100783364
511 Ga0070666_10000805
512 Ga0070680_100002873
513 Ga0070680_101118957
514 Ga0068868_100000557
515 Ga0068868_100002964
516 Ga0068868_100654478
517 Ga0070660_100000479
518 Ga0070660_101111525
519 Ga0070689_100000344
520 Ga0070689_100061892
521 Ga0070689_100394678
522 Ga0070691_10043824
523 Ga0070687_100000032
524 Ga0070661_100000412
525 Ga0070661_100001964
526 Ga0070661_100537879
527 Ga0070661_100756225
528 Ga0070692_10013772
529 Ga0070668_100000345
530 Ga0070669_100000307
531 Ga0070675_100001155
532 Ga0070675_100003395
533 Ga0070671_100003430
534 Ga0070671_100014228
535 Ga0070674_100000600
536 Ga0070673_100001765
537 Ga0070673_100130339
538 Ga0070673_100370496
539 Ga0070688_100000122
540 Ga0070688_100006427
541 Ga0070659_100000635
542 Ga0070667_100008888
543 Ga0070667_100064873
544 Ga0070667_100669535
545 Ga0070714_100001058
546 Ga0070714_100367459
547 Ga0070713_100333705
548 Ga0070701_10013876
549 Ga0070711_100213767
550 Ga0070705_100000279
551 Ga0070705_100195785
552 Ga0070700_100271301
553 Ga0070694_100026838
554 Ga0070694_100295778
555 Ga0070663_100000597
556 Ga0070663_101234806
557 Ga0070678_100002705
558 Ga0070678_100070930
559 Ga0070678_100110605
560 Ga0070678_100143443
561 Ga0070662_100000190
562 Ga0070662_100366060
563 Ga0070662_100897507
564 Ga0070681_10033955
565 Ga0070681_10395984
566 Ga0068867_100003036
567 Ga0068867_100702639
568 Ga0070685_10000369
569 Ga0070685_10003127
570 Ga0070685_10110872
571 Ga0070679_100525456
572 Ga0070684_100014406
573 Ga0070684_100115556
574 Ga0070684_100117499
575 Ga0068853_100000259
576 Ga0068853_100020356
577 Ga0068853_100020783
578 Ga0070672_100000406
579 Ga0070672_100254736
580 Ga0070672_100608040
581 Ga0070686_100000081
582 Ga0070686_100192419
583 Ga0070695_100221738
584 Ga0070695_100275547
585 Ga0070696_100523859
586 Ga0070693_100010235
587 Ga0070665_100010946
588 Ga0070704_100039510
589 Ga0070704_101784141
590 Ga0068855_100001159
591 Ga0068855_100218694
592 Ga0070664_100001026
593 Ga0070664_100001532
594 Ga0070664_100081494
595 Ga0070664_100081850
596 Ga0070664_100147350
597 Ga0070664_100161764
598 Ga0070664_100211844
599 Ga0070664_100818572
600 Ga0068857_100001061
601 Ga0068857_100002895
602 Ga0068857_100003310
603 Ga0068854_100000223
604 Ga0068854_100198645
605 Ga0068854_100410763
606 Ga0068854_100414154
607 Ga0068856_100005028
608 Ga0070702_100000849
609 Ga0070702_100037042
610 Ga0068852_100000420
611 Ga0068859_100006848
612 Ga0068859_100010357
613 Ga0068859_101316544
614 Ga0068864_100004095
615 Ga0068864_100543608
616 Ga0068864_100657632
617 Ga0068866_10000018
618 Ga0068861_100000738
619 Ga0068861_100507398
620 Ga0068861_101015914
621 Ga0068851_10000206
622 Ga0068870_10000033
623 Ga0068863_100000937
624 Ga0068863_100197632
625 Ga0068863_100970094
626 Ga0068858_100009300
627 Ga0068858_100535078
628 Ga0068860_100002378
629 Ga0068860_101926977
630 Ga0068862_100000659
631 Ga0081455_10250594
632 Ga0081540_1000141
633 Ga0081540_1000258
634 Ga0081540_1003160
635 Ga0070716_100062423
636 Ga0070712_100675148
637 Ga0097621_100000812
638 Ga0097621_100030223
639 Ga0097621_100072090
640 Ga0068871_100000098
641 Ga0068871_100135927
642 Ga0068871_100739222
643 Ga0075428_100104825
644 Ga0075428_100132211
645 Ga0075428_102410331
646 Ga0075430_100042980
647 Ga0075430_100658664
648 Ga0075431_100082748
649 Ga0075431_100111246
650 Ga0068865_100000442
651 Ga0068865_100002265
652 Ga0068865_100600064
653 Ga0097620_100006848
654 Ga0097620_100010356
655 Ga0097620_101316710
656 Ga0075435_100172002
657 Ga0105251_10403807
658 Ga0111539_10067497
659 Ga0111539_10486995
660 Ga0111539_10734943
661 Ga0105247_10001005
662 Ga0105247_10150749
663 Ga0105243_10876152
664 Ga0105241_10063266
665 Ga0105241_11443901
666 Ga0105242_10013836
667 Ga0105242_10078050
668 Ga0105248_11661553
669 Ga0105249_10187736
670 Ga0105239_10130361
671 Ga0157373_11297372
672 Ga0157371_10306352
673 Ga0157370_10552174
674 Ga0157370_11787658
675 Ga0157369_10039346
676 Ga0157374_10042545
677 Ga0157378_10038348
678 Ga0157378_10676549
679 Ga0163162_10015627
680 Ga0163162_10443316
681 Ga0157372_10052414
682 Ga0157372_10953665
683 Ga0157372_11214980
684 Ga0157375_10038134
685 Ga0157375_10822580
686 Ga0157375_11405627
687 Ga0163163_10010007
688 Ga0163163_10150011
689 Ga0163163_10388908
690 Ga0157380_10003019
691 Ga0157380_10021836
692 Ga0157380_12212053
693 Ga0157377_10593386
694 Ga0157379_10000098
695 Ga0157376_10303037
696 Ga0163161_10038345
697 Ga0213874_10050054
698 Ga0207697_10001247
699 Ga0207697_10175681
700 Ga0207656_10001481
701 Ga0207696_1086637
702 Ga0207696_1133225
703 Ga0207682_10001691
704 Ga0207682_10045741
705 Ga0207642_10000386
706 Ga0207710_10001837
707 Ga0207710_10128523
708 Ga0207688_10000100
709 Ga0207680_10000207
710 Ga0207680_10235738
711 Ga0207647_10001302
712 Ga0207645_10000386
713 Ga0207645_10121851
714 Ga0207643_10000002
715 Ga0207643_10041137
716 Ga0207705_10093046
717 Ga0207705_10434375
718 Ga0207705_10769426
719 Ga0207654_10004228
720 Ga0207707_10077681
721 Ga0207707_10165983
722 Ga0207695_10043836
723 Ga0207695_10525955
724 Ga0207671_10000756
725 Ga0207693_10315580
726 Ga0207693_10647017
727 Ga0207663_10703922
728 Ga0207660_10072347
729 Ga0207662_10000011
730 Ga0207662_10797204
731 Ga0207657_10000607
732 Ga0207657_10046911
733 Ga0207657_10635555
734 Ga0207649_10000627
735 Ga0207649_10002450
736 Ga0207649_10417225
737 Ga0207649_10436449
738 Ga0207649_10885504
739 Ga0207681_10000108
740 Ga0207694_10007411
741 Ga0207650_10000349
742 Ga0207650_10051679
743 Ga0207659_10000123
744 Ga0207659_10095313
745 Ga0207659_10836088
746 Ga0207659_11717215
747 Ga0207687_10003914
748 Ga0207700_10038833
749 Ga0207664_10000874
750 Ga0207644_10000565
751 Ga0207644_10038923
752 Ga0207644_10626306
753 Ga0207690_10001018
754 Ga0207706_10000078
755 Ga0207686_10005642
756 Ga0207686_10067400
757 Ga0207686_10613968
758 Ga0207709_10035162
759 Ga0207670_10000224
760 Ga0207670_10029508
761 Ga0207670_10366866
762 Ga0207670_10984911
763 Ga0207669_10002589
764 Ga0207704_10000199
765 Ga0207704_10004475
766 Ga0207665_10036565
767 Ga0207691_10000389
768 Ga0207691_10069210
769 Ga0207691_10458894
770 Ga0207711_10001003
771 Ga0207711_10002221
772 Ga0207711_11503053
773 Ga0207711_11940229
774 Ga0207689_10000523
775 Ga0207689_11339220
776 Ga0207661_10002620
777 Ga0207661_10107033
778 Ga0207661_10142520
779 Ga0207661_11788429
780 Ga0207679_10000442
781 Ga0207679_10003533
782 Ga0207679_10071960
783 Ga0207679_10155171
784 Ga0207679_10297315
785 Ga0207679_10890048
786 Ga0207667_10011534
787 Ga0207651_10000020
788 Ga0207651_10243616
789 Ga0207651_10325237
790 Ga0207712_10000666
791 Ga0207712_10015934
792 Ga0207668_10228178
793 Ga0207640_10000302
794 Ga0207640_10161961
795 Ga0207640_10162573
796 Ga0207640_10583028
797 Ga0207658_10000437
798 Ga0207658_10029516
799 Ga0207677_10000079
800 Ga0207703_10000148
801 Ga0207703_10000236
802 Ga0207703_10022917
803 Ga0207639_10000609
804 Ga0207639_10006727
805 Ga0207639_10265571
806 Ga0207678_10001757
807 Ga0207702_10009610
808 Ga0207702_10905682
809 Ga0207641_10016042
810 Ga0207641_10030088
811 Ga0207648_10000497
812 Ga0207648_10349450
813 Ga0207648_10963701
814 Ga0207676_10000636
815 Ga0207676_10004297
816 Ga0207676_10072105
817 Ga0207676_10406456
818 Ga0207676_10810414
819 Ga0207674_10000427
820 Ga0207674_10001529
821 Ga0207674_10004939
822 Ga0207675_100000006
823 Ga0207675_100487832
824 Ga0207675_101064670
825 Ga0207683_10000589
826 Ga0207683_10059352
827 Ga0207683_10180310
828 Ga0207683_10197510
829 Ga0207683_10207331
830 Ga0207698_10000382
831 Ga0207698_10124618
832 Ga0209998_10115156
833 Ga0209974_10110939
834 Ga0268266_10000687
835 Ga0268265_10001081
836 Ga0268265_10177097
837 Ga0268265_11506065
838 Ga0268264_10000447
839 Ga0268264_10000705
840 Ga0265334_10000008
841 Ga0265318_10217117
842 Ga0265338_10081181
843 Ga0265327_10016046
844 Ga0307408_100325215
845 Ga0307408_100338213
846 Ga0265313_10000076
847 Ga0265313_10101286
848 Ga0316575_10070913
849 Ga0307405_10464328
850 Ga0307413_10046948
851 Ga0307413_10053134
852 Ga0307413_10136229
853 Ga0307413_10184857
854 Ga0307413_10315465
855 Ga0307410_10009777
856 Ga0307410_10124776
857 Ga0307410_10201804
858 Ga0307410_11255698
859 Ga0307406_10455148
860 Ga0307406_10660201
861 Ga0307406_10969620
862 Ga0307407_10054050
863 Ga0307407_10085155
864 Ga0307407_10147956
865 Ga0307412_10054463
866 Ga0307409_100029637
867 Ga0307409_100118184
868 Ga0307409_100357742
869 Ga0307416_100079109
870 Ga0307416_100319685
871 Ga0307416_101849660
872 Ga0307416_101881537
873 Ga0307414_10060830
874 Ga0307414_10329323
875 Ga0307411_10044503
876 Ga0307411_10068429
877 Ga0307411_10201339
878 Ga0307411_10302549
879 Ga0307415_100013136
880 Ga0307415_100167250
881 Ga0307415_100466095
882 Ga0307415_101300274
883 Ga0373930_0058637
884 Ga0373926_0160987
885 Ga0373929_0159636
886 Ga0373951_0206030
887 Ga0373932_0218669
888 Ga0373945_0005329
889 Ga0373943_0681693
890 Ga0373946_0063103
891 Ga0373927_0000001
892 Ga0373937_0169878
893 Ga0373937_0259919
894 Ga0373925_0000241
895 Ga0395900_0006717
896 Ga0436360_0998048
897 Ga0451807_0616362
898 Ga0451837_1605580
899 Ga0451839_0704564
900 Ga0451853_1538364
901 Ga0439448_0024925
902 Ga0439455_0018316
903 Ga0439458_0025879
904 Ga0439444_0073343
905 Ga0451577_0049141
906 Ga0451577_0217602
907 Ga0453683_0463980
908 Ga0453684_1465337
909 Ga0451576_0014574
910 Ga0451576_2154280
911 Ga0495629_0000009
912 Ga0495639_0000260
913 Ga0495628_0331839
914 Ga0495630_0091499
915 Ga0495630_0153888
916 Ga0495630_0314949
917 Ga0495666_0000238
918 Ga0495586_0000473
919 Ga0495622_0131207
920 Ga0495668_0001246
921 Ga0495635_0007147
922 Ga0495588_0075776
923 Ga0495658_0030579
924 Ga0495613_0020956
925 Ga0495613_0113908
926 Ga0495613_0218704
927 Ga0495624_0115201
928 Ga0495672_0357305
929 Ga0495676_0003955
930 Ga0495680_0003926
931 Ga0495684_0017103
932 Ga0495684_0228053
933 Ga0495684_0889207
934 Ga0496101_0181012
935 Ga0496101_0291299
936 Ga0496102_0000795
937 Ga0496104_0158071
938 Ga0496104_0191104
939 Ga0496106_0000648
940 Ga0496107_0235819
941 Ga0496108_0025501
942 Ga0496109_0020726
943 Ga0496109_0206018
944 Ga0496112_0000385
945 Ga0496113_0102667
946 Ga0496114_0685335
947 Ga0496114_0814574
948 Ga0496115_0413236
949 Ga0501046_0136130
950 Ga0501047_0113778
951 Ga0501198_068338
952 Ga0501239_015282
953 Ga0501242_039648
954 Ga0501257_043849
955 Ga0501266_024690
956 Ga0501272_059112
957 Ga0501273_020402
958 nmdc:mga05p37_926826_c1
959 nmdc:mga0qj67_32404_c1
960 nmdc:mga06r32_517526_c1
961 nmdc:mga06r32_70187_c1
962 nmdc:mga08y16_1665732_c1
963 nmdc:mga08y16_572646_c1
964 nmdc:mga0n895_783139_c1
965 nmdc:mga0rr50_120422_c1
966 Ga0495619_0192897
967 Ga0501082_0585465
968 2673162361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

22

151

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3quw-assembly1.cif.gz_A crystal structure of yeast mmf1 0.9509 4 138
2dyy-assembly2.cif.gz_E crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9504 1 136
3l7q-assembly2.cif.gz_E crystal structure of aldr from streptococcus mutans 0.943 4 138
3m1x-assembly1.cif.gz_A crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, rhomobohedral form 0.9397 4 137
5v4d-assembly2.cif.gz_F crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis 0.9385 4 137
ID Description Score Start End Superfamily
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9403 19 137 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9397 4 137 3.30.1330.40
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9388 4 137 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9382 4 138 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9376 4 138 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A5C6QRB9-F1-model_v4 RidA family protein 0.9909 4 139 GO:0005829
GO:0019239
AF-A0A328BJP6-F1-model_v4 RidA family protein 0.9904 4 139 GO:0005829
GO:0019239
AF-A0A2E0D955-F1-model_v4 deleted 0.9882 2 137
AF-Q08XM2-F1-model_v4 Endoribonuclease L-PSP family 0.9864 3 139 GO:0005829
GO:0019239
AF-J0V3C2-F1-model_v4 2-aminomuconate deaminase 0.9833 1 138 GO:0005829
GO:0019239

Map