F452930

General Info

Members Datasets Scaffolds Average Seq Length
484 309 409 217

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10086807|Ga0099796_100868072
Length 249
Sequence MQPIDFNQTKRRAAVIPASFRLYLFQPDQEASMKFFLDTANLDEIRKAAALGLADGVTTNPTLVAKEGSVDFKEHIGEICKIVSGPVSAEVTSPNKDDMLREGREYVKIAPNVVIKCPLTVDGLEATQILNDEGIKVNVTLCFSAAQAICAAKAGASFISPFLGRLDDIGDNGLRLLEEIIEIYDNYGWKTEVLAASMRHPIHIIEAARMGADIATMPYKVLEQLLKHPLTDKGQDQFLADWKKRSAKA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
4 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
5 2554235283 Bacillus safensis VK Isolate Rhizosphere
6 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
7 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
8 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
11 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
12 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
13 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
14 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
15 2643221729 Bacillus sp. Root11 Isolate Unclassified
16 2643221730 Bacillus sp. Root131 Isolate Unclassified
17 2643221735 Bacillus sp. Root920 Isolate Unclassified
18 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
19 2684622632 Bacillus cereus 905 Isolate Unclassified
20 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
21 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
22 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
23 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
24 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
25 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
26 2738541358 Bacillus sp. OV752 Isolate Unclassified
27 2738543006 Bacillus sp. OK077 Isolate Unclassified
28 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
29 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
30 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
31 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
32 2811994870 Bacillus sp. JB4 Isolate Unclassified
33 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
34 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
35 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
36 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
37 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
38 2842682962 Bacillus sp. R-72492 Isolate Unclassified
39 2849139964 Bacillus sp. R-71875 Isolate Unclassified
40 2857581216 Bacillus sp. R-71922 Isolate Unclassified
41 2860837431 Bacillus sp. WR11 Isolate Unclassified
42 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
43 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
44 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
45 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
46 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
47 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
48 2919726948 Bacillus pumilus 4489 Isolate Unclassified
49 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
50 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
51 2938917290 Bacillus sp. CR71 Isolate Unclassified
52 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
53 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
54 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
55 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
56 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
57 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
58 2965761152 Bacillus sp. COPE52 Isolate Unclassified
59 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
60 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
61 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
62 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
63 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
64 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
65 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
66 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
67 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
68 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
69 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
70 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
71 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
72 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
73 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
74 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
75 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
76 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
77 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
78 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
79 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
80 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
81 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
82 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
83 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
84 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
87 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
88 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
89 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
90 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
91 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
92 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
93 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
94 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
95 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
96 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
97 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
98 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
99 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
100 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
101 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
102 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
103 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
104 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
105 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
106 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
107 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
108 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
109 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
110 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
117 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
118 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
119 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
120 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
121 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
130 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
131 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
132 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
158 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
209 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
210 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
211 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
214 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
215 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
292 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
306 8022653035 Bacillus sp. Rc4 Isolate Unclassified
307 8023438354 Bacillus sp. BH2 Isolate Unclassified
308 8023444577 Bacillus sp. BH32 Isolate Unclassified
309 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.97
Metatranscriptomes 10.54
Isolates 15.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 2.48
Nodule 0.21
Rhizoplane 1.03
Rhizosphere 81.2
Stem 0
Stem Tuber 0.21
Unclassified 14.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_579756 2162886007 Bacteria 2125
2 JGI24034J14986_100234 3300001432 Bacteria 3020
3 JGI24741J21665_1004742 3300001915 Bacteria 2954
4 JGI24748J21848_1000003 3300002074 Bacteria 323921
5 JGI24034J26672_10000005 3300002239 Bacteria 404185
6 JGI25159J45721_1002376 3300002987 Bacteria 7174
7 JGI25151J46595_10007366 3300003187 Bacteria 5405
8 JGI25151J46595_10065904 3300003187 Bacteria 1125
9 rootL2_10021294 3300003322 Bacteria 1146
10 rootL2_10177623 3300003322 Bacteria 6321
11 Ga0006562J51391_1000183 3300003578 Bacteria 13240
12 Ga0006562J51391_1000188 3300003578 Bacteria 1740
13 Ga0058859_11633299 3300004798 Bacteria 726
14 Ga0065714_10064704 3300005288 Bacteria 22455
15 Ga0065704_10074532 3300005289 Bacteria 6203
16 Ga0065704_10089699 3300005289 Bacteria 2838
17 Ga0065704_10247563 3300005289 Bacteria 998
18 Ga0065715_10038495 3300005293 Bacteria 1106
19 Ga0065707_10102996 3300005295 Unclassified 2773
20 Ga0065707_10126167 3300005295 Bacteria 2008
21 Ga0070658_10163684 3300005327 Bacteria 1867
22 Ga0070676_10057654 3300005328 Bacteria 2299
23 Ga0070676_10588381 3300005328 Bacteria 801
24 Ga0070683_100006415 3300005329 Bacteria 9865
25 Ga0070683_100009683 3300005329 Bacteria 8248
26 Ga0070690_100013041 3300005330 Bacteria 4903
27 Ga0070690_100112844 3300005330 Bacteria 1816
28 Ga0070690_100121271 3300005330 Bacteria 1755
29 Ga0068869_100104057 3300005334 Bacteria 2151
30 Ga0068869_100846101 3300005334 Unclassified 789
31 Ga0068868_100045355 3300005338 Bacteria 3439
32 Ga0070687_100343837 3300005343 Unclassified 961
33 Ga0070687_100365208 3300005343 Bacteria 936
34 Ga0070668_100011045 3300005347 Bacteria 6723
35 Ga0070675_100372560 3300005354 Bacteria 1270
36 Ga0070671_100062155 3300005355 Bacteria 3110
37 Ga0070674_100437558 3300005356 Bacteria 1077
38 Ga0070673_100229838 3300005364 Bacteria 1609
39 Ga0070673_100781112 3300005364 Unclassified 881
40 Ga0070703_10000018 3300005406 Bacteria 79554
41 Ga0070703_10056343 3300005406 Bacteria 1272
42 Ga0070705_100161274 3300005440 Bacteria 1499
43 Ga0070705_100323991 3300005440 Unclassified 1114
44 Ga0070705_100341254 3300005440 Bacteria 1089
45 Ga0070705_100449826 3300005440 Bacteria 966
46 Ga0070700_100507773 3300005441 Unclassified 929
47 Ga0070694_100001324 3300005444 Bacteria 14428
48 Ga0070694_100155418 3300005444 Unclassified 1674
49 Ga0070694_100170999 3300005444 Bacteria 1601
50 Ga0070708_100046349 3300005445 Bacteria 3836
51 Ga0070708_100102862 3300005445 Bacteria 2618
52 Ga0070708_100164389 3300005445 Bacteria 2069
53 Ga0070708_100263631 3300005445 Bacteria 1620
54 Ga0070706_100007016 3300005467 Bacteria 10621
55 Ga0070707_100002341 3300005468 Bacteria 18074
56 Ga0070707_100080875 3300005468 Bacteria 3137
57 Ga0070707_100327336 3300005468 Bacteria 1489
58 Ga0070707_100350359 3300005468 Bacteria 1434
59 Ga0070698_100072066 3300005471 Bacteria 3463
60 Ga0070698_100161908 3300005471 Unclassified 2181
61 Ga0070698_100205839 3300005471 Bacteria 1903
62 Ga0070698_100253172 3300005471 Unclassified 1693
63 Ga0070698_100407855 3300005471 Bacteria 1293
64 Ga0070698_100650977 3300005471 Bacteria 995
65 Ga0070698_100663922 3300005471 Bacteria 984
66 Ga0070684_100004934 3300005535 Bacteria 10180
67 Ga0070697_100001018 3300005536 Bacteria 21143
68 Ga0070697_100013612 3300005536 Bacteria 6380
69 Ga0070697_100014164 3300005536 Bacteria 6263
70 Ga0070695_100289802 3300005545 Bacteria 1206
71 Ga0070695_100380800 3300005545 Bacteria 1065
72 Ga0070695_101003737 3300005545 Bacteria 679
73 Ga0070696_100201073 3300005546 Bacteria 1488
74 Ga0070696_100393189 3300005546 Bacteria 1083
75 Ga0070696_100419922 3300005546 Bacteria 1050
76 Ga0070693_100093486 3300005547 Bacteria 1817
77 Ga0070704_100000831 3300005549 Bacteria 15339
78 Ga0070704_100221136 3300005549 Bacteria 1540
79 Ga0070704_100241668 3300005549 Bacteria 1478
80 Ga0070704_100543952 3300005549 Bacteria 1014
81 Ga0068855_100396630 3300005563 Bacteria 1513
82 Ga0068855_100772139 3300005563 Unclassified 1023
83 Ga0070702_100018840 3300005615 Bacteria 3588
84 Ga0068859_100016701 3300005617 Bacteria 7370
85 Ga0068859_100166838 3300005617 Bacteria 2282
86 Ga0068859_100173230 3300005617 Bacteria 2240
87 Ga0068859_100298516 3300005617 Bacteria 1704
88 Ga0068864_100090439 3300005618 Bacteria 2698
89 Ga0068861_100036425 3300005719 Bacteria 3651
90 Ga0068861_100373964 3300005719 Bacteria 1257
91 Ga0068863_100777672 3300005841 Unclassified 954
92 Ga0068858_100000134 3300005842 Bacteria 77566
93 Ga0068858_100918909 3300005842 Bacteria 856
94 Ga0068860_100193070 3300005843 Bacteria 1971
95 Ga0068860_100501437 3300005843 Bacteria 1212
96 Ga0068860_100742403 3300005843 Bacteria 993
97 Ga0081539_10166823 3300005985 Bacteria 1044
98 Ga0070715_10000062 3300006163 Bacteria 36134
99 Ga0070716_100000012 3300006173 Bacteria 104713
100 Ga0070716_100050615 3300006173 Bacteria 2359
101 Ga0097621_100487509 3300006237 Unclassified 1115
102 Ga0075428_100015459 3300006844 Bacteria 8462
103 Ga0075428_100165558 3300006844 Bacteria 2398
104 Ga0075433_10032574 3300006852 Bacteria 4464
105 Ga0075433_10132045 3300006852 Bacteria 2218
106 Ga0075434_100070920 3300006871 Bacteria 3475
107 Ga0075434_100093911 3300006871 Bacteria 3004
108 Ga0075434_100152769 3300006871 Bacteria 2329
109 Ga0075434_100424323 3300006871 Bacteria 1351
110 Ga0075429_100476889 3300006880 Bacteria 1093
111 Ga0075436_100000008 3300006914 Bacteria 279288
112 Ga0097620_100016700 3300006931 Bacteria 7370
113 Ga0097620_100166844 3300006931 Bacteria 2282
114 Ga0097620_100173244 3300006931 Bacteria 2240
115 Ga0097620_100298525 3300006931 Bacteria 1704
116 Ga0079104_1000084 3300006946 Bacteria 136884
117 Ga0075435_100000657 3300007076 Bacteria 21295
118 Ga0099794_10000926 3300007265 Bacteria 9905
119 Ga0099794_10234571 3300007265 Unclassified 944
120 Ga0099795_10192661 3300007788 Bacteria 856
121 Ga0105244_10064609 3300009036 Bacteria 1835
122 Ga0105244_10089620 3300009036 Bacteria 1514
123 Ga0111539_10033033 3300009094 Bacteria 6282
124 Ga0105245_10113233 3300009098 Bacteria 2526
125 Ga0105247_10000022 3300009101 Bacteria 219796
126 Ga0114129_10012953 3300009147 Bacteria 11870
127 Ga0114129_10018693 3300009147 Bacteria 9870
128 Ga0114129_10335497 3300009147 Bacteria 2006
129 Ga0114129_10643465 3300009147 Unclassified 1369
130 Ga0105243_10000086 3300009148 Bacteria 105723
131 Ga0105243_10015316 3300009148 Bacteria 5800
132 Ga0105243_11001715 3300009148 Bacteria 838
133 Ga0105242_10000544 3300009176 Bacteria 29862
134 Ga0105242_10002881 3300009176 Bacteria 13470
135 Ga0105242_10032841 3300009176 Bacteria 4152
136 Ga0105242_10345245 3300009176 Bacteria 1373
137 Ga0105242_11051561 3300009176 Bacteria 825
138 Ga0105248_10034689 3300009177 Bacteria 5645
139 Ga0105248_10073288 3300009177 Bacteria 3849
140 Ga0105238_10864202 3300009551 Unclassified 922
141 Ga0105249_10000142 3300009553 Bacteria 92745
142 Ga0105249_10054149 3300009553 Bacteria 3668
143 Ga0099796_10055249 3300010159 Unclassified 1390
144 Ga0099796_10086807 3300010159 Unclassified 1157
145 Ga0099796_10090208 3300010159 Unclassified 1138
146 Ga0099796_10127997 3300010159 Bacteria 982
147 Ga0105239_10066662 3300010375 Bacteria 3954
148 Ga0105239_10959629 3300010375 Unclassified 982
149 Ga0105246_10627424 3300011119 Unclassified 932
150 Ga0105246_10688337 3300011119 Bacteria 894
151 Ga0157373_10000036 3300013100 Bacteria 122723
152 Ga0157373_10141846 3300013100 Bacteria 1690
153 Ga0157370_10057057 3300013104 Bacteria 3715
154 Ga0157378_10000051 3300013297 Bacteria 102008
155 Ga0157378_10025190 3300013297 Bacteria 5242
156 Ga0157378_10118731 3300013297 Bacteria 2435
157 Ga0157378_10471181 3300013297 Bacteria 1250
158 Ga0157378_10591992 3300013297 Bacteria 1119
159 Ga0157378_10613016 3300013297 Unclassified 1101
160 Ga0163162_10000553 3300013306 Bacteria 34596
161 Ga0163162_10018460 3300013306 Bacteria 6834
162 Ga0163162_10464968 3300013306 Bacteria 1397
163 Ga0163162_11089300 3300013306 Bacteria 905
164 Ga0157372_10205086 3300013307 Bacteria 2284
165 Ga0157375_10001734 3300013308 Bacteria 18740
166 Ga0157375_10004126 3300013308 Bacteria 12607
167 Ga0157380_10174955 3300014326 Bacteria 1880
168 Ga0157380_10350220 3300014326 Bacteria 1382
169 Ga0182008_10000039 3300014497 Bacteria 124930
170 Ga0157379_10298901 3300014968 Bacteria 1467
171 Ga0182006_1000012 3300015261 Bacteria 394239
172 Ga0163161_10001071 3300017792 Bacteria 20729
173 Ga0163161_10003649 3300017792 Bacteria 10799
174 Ga0163161_10060176 3300017792 Bacteria 2764
175 Ga0163161_10519344 3300017792 Bacteria 972
176 Ga0213875_10263533 3300021388 Unclassified 813
177 Ga0207672_1000360 3300025223 Bacteria 5980
178 Ga0209130_1000293 3300025284 Bacteria 60879
179 Ga0209025_1000011 3300025294 Bacteria 976387
180 Ga0209025_1000752 3300025294 Bacteria 54324
181 Ga0209025_1001685 3300025294 Bacteria 27007
182 Ga0209025_1002689 3300025294 Bacteria 18126
183 Ga0209025_1022245 3300025294 Bacteria 3373
184 Ga0209025_1024706 3300025294 Bacteria 3091
185 Ga0209564_1037252 3300025295 Bacteria 1374
186 Ga0207696_1107508 3300025711 Bacteria 757
187 Ga0207655_1001334 3300025728 Bacteria 23265
188 Ga0207655_1098221 3300025728 Bacteria 1014
189 Ga0207713_1015111 3300025735 Bacteria 3977
190 Ga0207653_10000008 3300025885 Bacteria 197323
191 Ga0207642_10104194 3300025899 Bacteria 1431
192 Ga0207710_10000001 3300025900 Bacteria 1797433
193 Ga0207688_10049532 3300025901 Bacteria 2348
194 Ga0207685_10000053 3300025905 Bacteria 37895
195 Ga0207699_10017173 3300025906 Bacteria 3802
196 Ga0207645_10598570 3300025907 Bacteria 748
197 Ga0207684_10025631 3300025910 Bacteria 5026
198 Ga0207662_10107490 3300025918 Unclassified 1736
199 Ga0207662_10269089 3300025918 Bacteria 1124
200 Ga0207646_10003372 3300025922 Bacteria 18079
201 Ga0207646_10066025 3300025922 Bacteria 3230
202 Ga0207646_10128284 3300025922 Bacteria 2281
203 Ga0207646_10164572 3300025922 Bacteria 2002
204 Ga0207646_10726789 3300025922 Bacteria 887
205 Ga0207646_10749041 3300025922 Unclassified 872
206 Ga0207687_10858899 3300025927 Bacteria 775
207 Ga0207644_10000374 3300025931 Bacteria 29257
208 Ga0207686_10000037 3300025934 Bacteria 127619
209 Ga0207686_10000959 3300025934 Bacteria 17204
210 Ga0207686_10964987 3300025934 Bacteria 690
211 Ga0207709_10000113 3300025935 Bacteria 126620
212 Ga0207709_10008642 3300025935 Bacteria 5624
213 Ga0207709_10304896 3300025935 Unclassified 1186
214 Ga0207665_10000083 3300025939 Bacteria 61629
215 Ga0207665_10186157 3300025939 Bacteria 1506
216 Ga0207711_10443321 3300025941 Unclassified 1208
217 Ga0207689_10024513 3300025942 Bacteria 5062
218 Ga0207661_10000702 3300025944 Bacteria 21697
219 Ga0207651_10355586 3300025960 Unclassified 1235
220 Ga0207651_10639310 3300025960 Bacteria 933
221 Ga0207712_10000106 3300025961 Bacteria 94950
222 Ga0207712_10392845 3300025961 Unclassified 1164
223 Ga0207668_10008157 3300025972 Bacteria 6234
224 Ga0207640_10646087 3300025981 Bacteria 901
225 Ga0207677_10135032 3300026023 Bacteria 1879
226 Ga0207703_10000024 3300026035 Bacteria 217968
227 Ga0207703_10102555 3300026035 Unclassified 2428
228 Ga0207708_10049309 3300026075 Bacteria 3205
229 Ga0207708_10712472 3300026075 Bacteria 859
230 Ga0207641_10217031 3300026088 Bacteria 1772
231 Ga0207648_10074396 3300026089 Bacteria 2960
232 Ga0207676_10807254 3300026095 Unclassified 916
233 Ga0207675_100022312 3300026118 Bacteria 5895
234 Ga0207675_100397835 3300026118 Bacteria 1357
235 Ga0207675_100622192 3300026118 Bacteria 1084
236 Ga0210000_1017034 3300027462 Bacteria 1100
237 Ga0209588_1009284 3300027671 Bacteria 2937
238 Ga0209971_1004749 3300027682 Bacteria 3225
239 Ga0207428_10011657 3300027907 Bacteria 7756
240 Ga0268265_10341006 3300028380 Bacteria 1364
241 Ga0268264_10312160 3300028381 Unclassified 1484
242 Ga0268264_10826174 3300028381 Bacteria 927
243 Ga0237817_10086 3300030083 Bacteria 28492
244 Ga0307408_100131736 3300031548 Bacteria 1951
245 Ga0307405_10153718 3300031731 Bacteria 1621
246 Ga0307405_10262941 3300031731 Bacteria 1290
247 Ga0307412_10000007 3300031911 Bacteria 486267
248 Ga0307412_10000373 3300031911 Bacteria 28018
249 Ga0307412_10425790 3300031911 Bacteria 1087
250 Ga0307409_100579980 3300031995 Bacteria 1105
251 Ga0307416_100000003 3300032002 Bacteria 509060
252 Ga0307416_100243242 3300032002 Bacteria 1745
253 Ga0307416_100347956 3300032002 Bacteria 1498
254 Ga0307414_10000009 3300032004 Bacteria 359782
255 Ga0307414_10740967 3300032004 Bacteria 892
256 Ga0436364_1281593 3300037853 Unclassified 1071
257 Ga0242422_05268 3300038699 Bacteria 791
258 Ga0237819_00136 3300038705 Bacteria 27619
259 Ga0242420_009475 3300038996 Bacteria 1598
260 Ga0242420_025515 3300038996 Bacteria 1074
261 Ga0439466_0121998 3300041411 Bacteria 804
262 Ga0439465_0002293 3300041413 Bacteria 6284
263 Ga0439445_0004176 3300042004 Bacteria 3263
264 Ga0450889_008399 3300042144 Bacteria 1048
265 Ga0439434_0021468 3300042435 Unclassified 1939
266 Ga0439464_0008042 3300042439 Bacteria 2766
267 Ga0451577_0078160 3300042876 Bacteria 2951
268 Ga0453683_0039924 3300044673 Bacteria 2949
269 Ga0453683_0105223 3300044673 Bacteria 1772
270 Ga0453683_0258917 3300044673 Bacteria 1110
271 Ga0453684_0000219 3300044712 Bacteria 250149
272 Ga0453684_0329752 3300044712 Bacteria 1726
273 Ga0451576_0000010 3300045051 Bacteria 679007
274 Ga0451576_0499018 3300045051 Bacteria 1278
275 Ga0495627_000003 3300046453 Bacteria 704557
276 Ga0495627_008055 3300046453 Bacteria 3973
277 Ga0495651_0321772 3300046462 Unclassified 1031
278 Ga0495662_0128852 3300046476 Bacteria 1244
279 Ga0495606_0008642 3300046507 Bacteria 8796
280 Ga0495610_0000032 3300046512 Bacteria 216443
281 Ga0495610_0000302 3300046512 Bacteria 51984
282 Ga0495620_0024490 3300046515 Bacteria 2870
283 Ga0495620_0073476 3300046515 Bacteria 1394
284 Ga0495630_0293659 3300046517 Bacteria 1242
285 Ga0495632_0003226 3300046519 Bacteria 11713
286 Ga0495643_0038259 3300046522 Bacteria 2628
287 Ga0495643_0115476 3300046522 Bacteria 1361
288 Ga0495663_0009797 3300046525 Bacteria 2659
289 Ga0495663_0019863 3300046525 Bacteria 1925
290 Ga0495654_0125151 3300046530 Bacteria 1159
291 Ga0495640_0381022 3300046533 Unclassified 868
292 Ga0495609_0000083 3300046538 Bacteria 115045
293 Ga0495633_0000109 3300046558 Bacteria 110841
294 Ga0495633_0001489 3300046558 Bacteria 18168
295 Ga0495633_0132840 3300046558 Bacteria 1152
296 Ga0495656_0221721 3300046615 Bacteria 946
297 Ga0495669_0134316 3300046684 Bacteria 1166
298 Ga0495600_0096088 3300046809 Unclassified 1932
299 Ga0495636_0038456 3300047318 Bacteria 1980
300 Ga0495674_0541174 3300047319 Unclassified 928
301 Ga0495672_0151300 3300047320 Bacteria 1203
302 Ga0495676_0140050 3300047321 Bacteria 1735
303 Ga0495680_0237177 3300047322 Bacteria 1297
304 Ga0495686_0000200 3300047472 Bacteria 111089
305 Ga0496101_0234292 3300048904 Bacteria 1428
306 Ga0496103_0433282 3300048906 Bacteria 844
307 Ga0496106_0016819 3300048909 Bacteria 5411
308 Ga0496110_0000418 3300048913 Bacteria 28889
309 Ga0496113_0296846 3300048916 Bacteria 1293
310 Ga0496116_0002232 3300048919 Bacteria 20601
311 Ga0496116_0011741 3300048919 Bacteria 7216
312 Ga0496116_0017684 3300048919 Bacteria 5524
313 Ga0496116_0040630 3300048919 Bacteria 3201
314 Ga0496117_0000746 3300048920 Bacteria 51203
315 Ga0496117_0326982 3300048920 Bacteria 801
316 Ga0496119_0001349 3300048922 Bacteria 30008
317 Ga0496119_0006147 3300048922 Bacteria 11239
318 Ga0496119_0039315 3300048922 Bacteria 3041
319 Ga0496120_0000026 3300048923 Bacteria 235131
320 Ga0496120_0041829 3300048923 Bacteria 2680
321 Ga0496122_0000015 3300048925 Bacteria 489028
322 Ga0496122_0000139 3300048925 Bacteria 169425
323 Ga0496122_0003988 3300048925 Bacteria 18830
324 Ga0496122_0011777 3300048925 Bacteria 8807
325 Ga0496122_0118365 3300048925 Bacteria 1717
326 Ga0496123_0001608 3300048926 Bacteria 30619
327 Ga0496123_0005641 3300048926 Bacteria 12494
328 Ga0496123_0006044 3300048926 Bacteria 11889
329 Ga0496124_0068394 3300048927 Bacteria 2952
330 Ga0496124_0257134 3300048927 Bacteria 1288
331 Ga0496125_0000043 3300048928 Bacteria 301512
332 Ga0496125_0018968 3300048928 Bacteria 6510
333 Ga0496126_0000076 3300048929 Bacteria 234420
334 Ga0496126_0000144 3300048929 Bacteria 164342
335 Ga0496126_0000413 3300048929 Bacteria 86439
336 Ga0496126_0020508 3300048929 Bacteria 6475
337 Ga0501306_000769 3300049127 Bacteria 2682
338 Ga0501310_012120 3300049130 Bacteria 984
339 Ga0501341_01644 3300049131 Bacteria 1142
340 Ga0501343_001307 3300049132 Bacteria 1666
341 Ga0501344_00368 3300049133 Bacteria 1824
342 Ga0501345_00006 3300049134 Bacteria 5068
343 Ga0501305_000481 3300049161 Bacteria 3283
344 Ga0501305_005054 3300049161 Bacteria 1580
345 Ga0501305_005436 3300049161 Bacteria 1543
346 Ga0501311_015877 3300049527 Bacteria 976
347 Ga0501312_000672 3300049528 Bacteria 2916
348 Ga0501312_003760 3300049528 Bacteria 1747
349 Ga0501312_005983 3300049528 Bacteria 1502
350 Ga0501312_007668 3300049528 Bacteria 1381
351 Ga0501313_000843 3300049529 Bacteria 2361
352 Ga0501313_009438 3300049529 Bacteria 1099
353 Ga0501313_015432 3300049529 Bacteria 911
354 Ga0501314_009792 3300049530 Bacteria 885
355 Ga0501315_000131 3300049531 Bacteria 4130
356 Ga0501315_002057 3300049531 Bacteria 1839
357 Ga0501315_002642 3300049531 Bacteria 1710
358 Ga0501316_000012 3300049532 Bacteria 7603
359 Ga0501316_005933 3300049532 Bacteria 1284
360 Ga0501316_007320 3300049532 Bacteria 1196
361 Ga0501317_000046 3300049533 Bacteria 5477
362 Ga0501317_013770 3300049533 Bacteria 1016
363 Ga0501318_014944 3300049534 Bacteria 922
364 Ga0501320_001442 3300049536 Bacteria 1753
365 Ga0501321_000160 3300049537 Bacteria 3645
366 Ga0501321_000428 3300049537 Bacteria 2668
367 Ga0501321_013862 3300049537 Bacteria 931
368 Ga0501322_001098 3300049538 Bacteria 1452
369 Ga0501323_001482 3300049539 Bacteria 2095
370 Ga0501330_000056 3300049546 Bacteria 3056
371 Ga0501330_000436 3300049546 Bacteria 1753
372 Ga0501331_00124 3300049547 Bacteria 2537
373 Ga0501332_00068 3300049548 Bacteria 3068
374 Ga0501333_000158 3300049549 Bacteria 2585
375 Ga0501333_000385 3300049549 Bacteria 1977
376 Ga0501334_01167 3300049550 Bacteria 1406
377 Ga0501335_005571 3300049551 Bacteria 1127
378 Ga0501336_000457 3300049552 Bacteria 2030
379 Ga0501336_000687 3300049552 Bacteria 1790
380 Ga0501337_001645 3300049553 Bacteria 1297
381 Ga0501338_00096 3300049554 Bacteria 2808
382 Ga0501340_000075 3300049556 Bacteria 2997
383 Ga0501340_003381 3300049556 Bacteria 965
384 Ga0501048_0272211 3300049582 Bacteria 1204
385 Ga0501071_0445399 3300049587 Bacteria 991
386 Ga0501251_047124 3300049681 Bacteria 672
387 Ga0501081_0221706 3300049743 Bacteria 1375
388 Ga0501241_000015 3300049758 Bacteria 100297
389 Ga0501269_000486 3300049766 Bacteria 8423
390 Ga0501045_0539518 3300049824 Bacteria 865
391 nmdc:mga05p37_1002687_c1 3300050507 Unclassified 887
392 nmdc:mga05p37_144879_c1 3300050507 Bacteria 2909
393 nmdc:mga05p37_91797_c1 3300050507 Bacteria 3742
394 nmdc:mga08y16_87123_c1 3300050511 Unclassified 3254
395 nmdc:mga0n895_222103_c1 3300050512 Bacteria 1918
396 nmdc:mga0n895_249183_c1 3300050512 Unclassified 1802
397 nmdc:mga0n895_50250_c1 3300050512 Bacteria 4087
398 nmdc:mga0n895_847639_c1 3300050512 Bacteria 902
399 nmdc:mga0n895_898624_c1 3300050512 Bacteria 871
400 nmdc:mga0rr50_1215_c1 3300050513 Bacteria 13997
401 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
402 nmdc:mga0a205_174767_c1 3300050515 Bacteria 2043
403 nmdc:mga0a205_19117_c1 3300050515 Bacteria 6458
404 nmdc:mga0a205_44162_c1 3300050515 Bacteria 4295
405 Ga0495655_0008316 3300053083 Viruses 1967
406 Ga0500616_0000675 3300053153 Bacteria 40054
407 Ga0501084_0081629 3300054114 Bacteria 2712
408 Ga0587073_0056536 3300059492 Bacteria 906
409 Ga0501082_0489391 3300060353 Bacteria 1075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0115476 Ga0495643_0115476_781_1341 186
2 3300049681 Ga0501251_047124 Ga0501251_047124_30_590 186
3 3300009551 Ga0105238_10864202 Ga0105238_108642022 191
4 3300003187 JGI25151J46595_10065904 JGI25151J46595_100659041 201
5 3300050512 nmdc:mga0n895_847639_c1 nmdc:mga0n895_847639_c1_250_879 205
6 3300048919 Ga0496116_0002232 Ga0496116_0002232_14601_15254 206
7 3300021388 Ga0213875_10263533 Ga0213875_102635332 207
8 3300037853 Ga0436364_1281593 Ga0436364_1281593_174_830 207
9 iso_pu_bacteria 2540341094 2540608632 208
10 iso_pu_bacteria 2551306519 2553394158 208
11 iso_pu_bacteria 2554235283 2555468593 208
12 iso_pu_bacteria 2643221729 2644708310 208
13 iso_pu_bacteria 2643221730 2644714908 208
14 iso_pu_bacteria 2643221735 2644738610 208
15 iso_pu_bacteria 2684622632 2685148584 208
16 iso_pu_bacteria 2684623153 2686998733 208
17 iso_pu_bacteria 2687453109 2687500009 208
18 iso_pu_bacteria 2695420987 2698324590 208
19 iso_pu_bacteria 2703719227 2705992516 208
20 iso_pu_bacteria 2718218445 2721503965 208
21 iso_pu_bacteria 2738541358 2739158260 208
22 iso_pu_bacteria 2738543006 2739211329 208
23 iso_pu_bacteria 2808606399 2809053773 208
24 iso_pu_bacteria 2811994870 2812313922 208
25 iso_pu_bacteria 2818991443 2819583386 208
26 iso_pu_bacteria 2818991468 2819722932 208
27 iso_pu_bacteria 2823526263 2823529956 208
28 iso_pu_bacteria 2860837431 2860841444 208
29 iso_pu_bacteria 2908665501 2908667203 208
30 iso_pu_bacteria 2919093281 2919094781 208
31 iso_pu_bacteria 2919726948 2919727351 208
32 iso_pu_bacteria 2929233124 2929233833 208
33 iso_pu_bacteria 2938917290 2938918002 208
34 iso_pu_bacteria 2947426588 2947427327 208
35 iso_pu_bacteria 2954773129 2954776620 208
36 iso_pu_bacteria 2962290636 2962294685 208
37 iso_pu_bacteria 2964375228 2964375423 208
38 iso_pu_bacteria 2965761152 2965761895 208
39 iso_pu_bacteria 2969136845 2969140612 208
40 iso_pu_bacteria 2969765954 2969768566 208
41 iso_pu_bacteria 2969770375 2969770913 208
42 iso_pu_bacteria 2979083700 2979084322 208
43 iso_pu_bacteria 2980492589 2980496447 208
44 iso_pu_bacteria 8022621104 8022621769 208
45 iso_pu_bacteria 8022653035 8022656902 208
46 iso_pu_bacteria 8023438354 8023438830 208
47 iso_pu_bacteria 8023444577 8023450451 208
48 iso_pu_bacteria 8057582654 8057583396 208
49 iso_pu_bacteria 2671180330 2672338671 209
50 iso_pu_bacteria 2816332186 2816865405 209
51 iso_pu_bacteria 2842682962 2842687522 209
52 iso_pu_bacteria 2849139964 2849142934 209
53 iso_pu_bacteria 2857581216 2857583194 209
54 iso_pu_bacteria 2885427238 2885427882 209
55 iso_pu_bacteria 2936361878 2936363315 209
56 iso_pu_bacteria 2977254563 2977254999 209
57 iso_pu_bacteria 2990275345 2990275983 209
58 iso_pu_bacteria 3006978542 3006980458 209
59 3300002987 JGI25159J45721_1002376 JGI25159J45721_10023761 212
60 3300003187 JGI25151J46595_10007366 JGI25151J46595_100073664 212
61 3300003578 Ga0006562J51391_1000183 Ga0006562J51391_10001834 212
62 3300003578 Ga0006562J51391_1000188 Ga0006562J51391_10001882 212
63 3300005289 Ga0065704_10247563 Ga0065704_102475631 212
64 3300005471 Ga0070698_100205839 Ga0070698_1002058392 212
65 3300006946 Ga0079104_1000084 Ga0079104_10000845 212
66 3300009036 Ga0105244_10064609 Ga0105244_100646092 212
67 3300011119 Ga0105246_10688337 Ga0105246_106883371 212
68 3300025284 Ga0209130_1000293 Ga0209130_100029343 212
69 3300025294 Ga0209025_1000011 Ga0209025_1000011399 212
70 3300025294 Ga0209025_1000752 Ga0209025_100075245 212
71 3300025294 Ga0209025_1001685 Ga0209025_100168516 212
72 3300025294 Ga0209025_1002689 Ga0209025_10026895 212
73 3300025294 Ga0209025_1022245 Ga0209025_10222452 212
74 3300025295 Ga0209564_1037252 Ga0209564_10372521 212
75 3300025711 Ga0207696_1107508 Ga0207696_11075081 212
76 3300025728 Ga0207655_1001334 Ga0207655_10013347 212
77 3300025735 Ga0207713_1015111 Ga0207713_10151112 212
78 3300030083 Ga0237817_10086 Ga0237817_1008617 212
79 3300038705 Ga0237819_00136 Ga0237819_00136_17304_17951 212
80 3300046515 Ga0495620_0024490 Ga0495620_0024490_1069_1716 212
81 3300046530 Ga0495654_0125151 Ga0495654_0125151_220_867 212
82 3300047320 Ga0495672_0151300 Ga0495672_0151300_279_926 212
83 3300048906 Ga0496103_0433282 Ga0496103_0433282_140_787 212
84 3300048919 Ga0496116_0011741 Ga0496116_0011741_1227_1883 212
85 3300048919 Ga0496116_0017684 Ga0496116_0017684_199_852 212
86 3300048919 Ga0496116_0040630 Ga0496116_0040630_1755_2393 212
87 3300048920 Ga0496117_0000746 Ga0496117_0000746_17960_18613 212
88 3300048922 Ga0496119_0001349 Ga0496119_0001349_14778_15431 212
89 3300048922 Ga0496119_0006147 Ga0496119_0006147_3546_4202 212
90 3300048922 Ga0496119_0039315 Ga0496119_0039315_1604_2257 212
91 3300048923 Ga0496120_0000026 Ga0496120_0000026_9377_10030 212
92 3300048923 Ga0496120_0041829 Ga0496120_0041829_92_745 212
93 3300048925 Ga0496122_0000015 Ga0496122_0000015_484979_485632 212
94 3300048925 Ga0496122_0000139 Ga0496122_0000139_127613_128269 212
95 3300048925 Ga0496122_0003988 Ga0496122_0003988_11676_12329 212
96 3300048925 Ga0496122_0118365 Ga0496122_0118365_799_1437 212
97 3300048926 Ga0496123_0001608 Ga0496123_0001608_15123_15776 212
98 3300048926 Ga0496123_0005641 Ga0496123_0005641_2706_3359 212
99 3300048926 Ga0496123_0006044 Ga0496123_0006044_9530_10186 212
100 3300048927 Ga0496124_0068394 Ga0496124_0068394_876_1529 212
101 3300048928 Ga0496125_0000043 Ga0496125_0000043_286016_286669 212
102 3300048929 Ga0496126_0000076 Ga0496126_0000076_230221_230874 212
103 3300048929 Ga0496126_0000144 Ga0496126_0000144_73454_74101 212
104 3300048929 Ga0496126_0000413 Ga0496126_0000413_44627_45283 212
105 3300048929 Ga0496126_0020508 Ga0496126_0020508_5230_5883 212
106 3300004798 Ga0058859_11633299 Ga0058859_116332991 213
107 3300005293 Ga0065715_10038495 Ga0065715_100384951 213
108 3300005327 Ga0070658_10163684 Ga0070658_101636842 213
109 3300005328 Ga0070676_10057654 Ga0070676_100576542 213
110 3300005329 Ga0070683_100009683 Ga0070683_1000096835 213
111 3300005330 Ga0070690_100013041 Ga0070690_1000130412 213
112 3300005330 Ga0070690_100121271 Ga0070690_1001212711 213
113 3300005356 Ga0070674_100437558 Ga0070674_1004375581 213
114 3300005440 Ga0070705_100341254 Ga0070705_1003412542 213
115 3300005445 Ga0070708_100263631 Ga0070708_1002636313 213
116 3300005563 Ga0068855_100772139 Ga0068855_1007721391 213
117 3300005843 Ga0068860_100742403 Ga0068860_1007424032 213
118 3300006844 Ga0075428_100015459 Ga0075428_1000154595 213
119 3300006880 Ga0075429_100476889 Ga0075429_1004768892 213
120 3300009036 Ga0105244_10089620 Ga0105244_100896201 213
121 3300009177 Ga0105248_10034689 Ga0105248_100346891 213
122 3300010159 Ga0099796_10127997 Ga0099796_101279971 213
123 3300013297 Ga0157378_10591992 Ga0157378_105919922 213
124 3300013306 Ga0163162_11089300 Ga0163162_110893001 213
125 3300025294 Ga0209025_1024706 Ga0209025_10247063 213
126 3300025728 Ga0207655_1098221 Ga0207655_10982211 213
127 3300027462 Ga0210000_1017034 Ga0210000_10170342 213
128 3300027682 Ga0209971_1004749 Ga0209971_10047492 213
129 3300031548 Ga0307408_100131736 Ga0307408_1001317361 213
130 3300031731 Ga0307405_10153718 Ga0307405_101537182 213
131 3300031911 Ga0307412_10425790 Ga0307412_104257901 213
132 3300031995 Ga0307409_100579980 Ga0307409_1005799801 213
133 3300032002 Ga0307416_100243242 Ga0307416_1002432422 213
134 3300032002 Ga0307416_100347956 Ga0307416_1003479562 213
135 3300042876 Ga0451577_0078160 Ga0451577_0078160_1940_2587 213
136 3300044673 Ga0453683_0105223 Ga0453683_0105223_460_1107 213
137 3300044712 Ga0453684_0000219 Ga0453684_0000219_39150_39797 213
138 3300044712 Ga0453684_0329752 Ga0453684_0329752_535_1179 213
139 3300045051 Ga0451576_0000010 Ga0451576_0000010_592315_592962 213
140 3300046515 Ga0495620_0073476 Ga0495620_0073476_599_1249 213
141 3300046558 Ga0495633_0132840 Ga0495633_0132840_210_860 213
142 3300046615 Ga0495656_0221721 Ga0495656_0221721_31_684 213
143 3300047321 Ga0495676_0140050 Ga0495676_0140050_191_841 213
144 3300047322 Ga0495680_0237177 Ga0495680_0237177_100_765 213
145 3300048913 Ga0496110_0000418 Ga0496110_0000418_27834_28484 213
146 3300048916 Ga0496113_0296846 Ga0496113_0296846_196_846 213
147 3300049127 Ga0501306_000769 Ga0501306_000769_1108_1758 213
148 3300049130 Ga0501310_012120 Ga0501310_012120_183_833 213
149 3300049131 Ga0501341_01644 Ga0501341_01644_299_949 213
150 3300049132 Ga0501343_001307 Ga0501343_001307_835_1485 213
151 3300049133 Ga0501344_00368 Ga0501344_00368_1112_1762 213
152 3300049134 Ga0501345_00006 Ga0501345_00006_4304_4954 213
153 3300049161 Ga0501305_000481 Ga0501305_000481_716_1378 213
154 3300049161 Ga0501305_005054 Ga0501305_005054_602_1252 213
155 3300049161 Ga0501305_005436 Ga0501305_005436_709_1359 213
156 3300049527 Ga0501311_015877 Ga0501311_015877_132_782 213
157 3300049528 Ga0501312_000672 Ga0501312_000672_456_1118 213
158 3300049528 Ga0501312_003760 Ga0501312_003760_200_850 213
159 3300049528 Ga0501312_005983 Ga0501312_005983_529_1179 213
160 3300049528 Ga0501312_007668 Ga0501312_007668_371_1066 213
161 3300049529 Ga0501313_000843 Ga0501313_000843_1062_1712 213
162 3300049529 Ga0501313_009438 Ga0501313_009438_268_918 213
163 3300049529 Ga0501313_015432 Ga0501313_015432_30_725 213
164 3300049530 Ga0501314_009792 Ga0501314_009792_168_830 213
165 3300049531 Ga0501315_000131 Ga0501315_000131_1971_2633 213
166 3300049531 Ga0501315_002057 Ga0501315_002057_272_922 213
167 3300049531 Ga0501315_002642 Ga0501315_002642_406_1056 213
168 3300049532 Ga0501316_000012 Ga0501316_000012_5097_5759 213
169 3300049532 Ga0501316_005933 Ga0501316_005933_187_837 213
170 3300049532 Ga0501316_007320 Ga0501316_007320_371_1066 213
171 3300049533 Ga0501317_000046 Ga0501317_000046_1196_1846 213
172 3300049533 Ga0501317_013770 Ga0501317_013770_284_946 213
173 3300049534 Ga0501318_014944 Ga0501318_014944_188_838 213
174 3300049536 Ga0501320_001442 Ga0501320_001442_918_1568 213
175 3300049537 Ga0501321_000160 Ga0501321_000160_958_1608 213
176 3300049537 Ga0501321_000428 Ga0501321_000428_1720_2415 213
177 3300049537 Ga0501321_013862 Ga0501321_013862_39_689 213
178 3300049538 Ga0501322_001098 Ga0501322_001098_182_832 213
179 3300049539 Ga0501323_001482 Ga0501323_001482_188_838 213
180 3300049546 Ga0501330_000056 Ga0501330_000056_1161_1811 213
181 3300049546 Ga0501330_000436 Ga0501330_000436_758_1453 213
182 3300049547 Ga0501331_00124 Ga0501331_00124_593_1255 213
183 3300049548 Ga0501332_00068 Ga0501332_00068_1785_2447 213
184 3300049549 Ga0501333_000158 Ga0501333_000158_207_869 213
185 3300049549 Ga0501333_000385 Ga0501333_000385_1108_1758 213
186 3300049550 Ga0501334_01167 Ga0501334_01167_574_1224 213
187 3300049551 Ga0501335_005571 Ga0501335_005571_284_934 213
188 3300049552 Ga0501336_000457 Ga0501336_000457_1200_1850 213
189 3300049552 Ga0501336_000687 Ga0501336_000687_705_1367 213
190 3300049553 Ga0501337_001645 Ga0501337_001645_210_860 213
191 3300049554 Ga0501338_00096 Ga0501338_00096_1841_2503 213
192 3300049556 Ga0501340_000075 Ga0501340_000075_564_1226 213
193 3300049556 Ga0501340_003381 Ga0501340_003381_188_838 213
194 3300049582 Ga0501048_0272211 Ga0501048_0272211_543_1193 213
195 3300049587 Ga0501071_0445399 Ga0501071_0445399_299_949 213
196 3300049743 Ga0501081_0221706 Ga0501081_0221706_540_1190 213
197 3300049824 Ga0501045_0539518 Ga0501045_0539518_168_818 213
198 3300050515 nmdc:mga0a205_174767_c1 nmdc:mga0a205_174767_c1_58_726 213
199 3300054114 Ga0501084_0081629 Ga0501084_0081629_1835_2485 213
200 3300060353 Ga0501082_0489391 Ga0501082_0489391_292_942 213
201 iso_pu_bacteria 2511231000 2511233175 213
202 iso_pu_bacteria 2582581281 2585157261 213
203 iso_pu_bacteria 2582581282 2585161772 213
204 iso_pu_bacteria 2582581873 2585424821 213
205 iso_pu_bacteria 2585428060 2587749929 213
206 iso_pu_bacteria 2585428061 2587750221 213
207 iso_pu_bacteria 2585428095 2587866690 213
208 iso_pu_bacteria 2585428115 2587942675 213
209 iso_pu_bacteria 2585428187 2588233159 213
210 iso_pu_bacteria 2588253712 2588446891 213
211 iso_pu_bacteria 2728369107 2729198984 213
212 iso_pu_bacteria 2739367874 2740058118 213
213 iso_pu_bacteria 2751185877 2753671345 213
214 iso_pu_bacteria 2775506739 2775672622 213
215 iso_pu_bacteria 2842083920 2842086888 213
216 iso_pu_bacteria 2905999023 2906003168 213
217 iso_pu_bacteria 2919097161 2919099850 213
218 iso_pu_bacteria 2919399522 2919403962 213
219 iso_pu_bacteria 2945924605 2945927010 213
220 iso_pu_bacteria 2946019816 2946021794 213
221 iso_pu_bacteria 2977243572 2977245881 213
222 iso_pu_bacteria 2984572630 2984576235 213
223 iso_pu_bacteria 2984606641 2984609691 213
224 iso_pu_bacteria 2993372514 2993373229 213
225 iso_pu_bacteria 2993480792 2993483913 213
226 3300001432 JGI24034J14986_100234 JGI24034J14986_1002342 214
227 3300002074 JGI24748J21848_1000003 JGI24748J21848_1000003108 214
228 3300002239 JGI24034J26672_10000005 JGI24034J26672_10000005293 214
229 3300003322 rootL2_10177623 rootL2_101776237 214
230 3300005295 Ga0065707_10102996 Ga0065707_101029962 214
231 3300005295 Ga0065707_10126167 Ga0065707_101261672 214
232 3300005328 Ga0070676_10588381 Ga0070676_105883811 214
233 3300005330 Ga0070690_100112844 Ga0070690_1001128442 214
234 3300005334 Ga0068869_100104057 Ga0068869_1001040571 214
235 3300005334 Ga0068869_100846101 Ga0068869_1008461011 214
236 3300005338 Ga0068868_100045355 Ga0068868_1000453553 214
237 3300005343 Ga0070687_100343837 Ga0070687_1003438372 214
238 3300005343 Ga0070687_100365208 Ga0070687_1003652081 214
239 3300005347 Ga0070668_100011045 Ga0070668_1000110454 214
240 3300005354 Ga0070675_100372560 Ga0070675_1003725602 214
241 3300005355 Ga0070671_100062155 Ga0070671_1000621553 214
242 3300005364 Ga0070673_100229838 Ga0070673_1002298382 214
243 3300005364 Ga0070673_100781112 Ga0070673_1007811121 214
244 3300005406 Ga0070703_10000018 Ga0070703_1000001838 214
245 3300005406 Ga0070703_10056343 Ga0070703_100563431 214
246 3300005440 Ga0070705_100161274 Ga0070705_1001612741 214
247 3300005440 Ga0070705_100323991 Ga0070705_1003239911 214
248 3300005440 Ga0070705_100449826 Ga0070705_1004498261 214
249 3300005441 Ga0070700_100507773 Ga0070700_1005077732 214
250 3300005444 Ga0070694_100001324 Ga0070694_1000013243 214
251 3300005444 Ga0070694_100155418 Ga0070694_1001554182 214
252 3300005444 Ga0070694_100170999 Ga0070694_1001709992 214
253 3300005445 Ga0070708_100046349 Ga0070708_1000463494 214
254 3300005445 Ga0070708_100102862 Ga0070708_1001028622 214
255 3300005467 Ga0070706_100007016 Ga0070706_1000070166 214
256 3300005468 Ga0070707_100002341 Ga0070707_10000234118 214
257 3300005468 Ga0070707_100080875 Ga0070707_1000808752 214
258 3300005468 Ga0070707_100327336 Ga0070707_1003273362 214
259 3300005468 Ga0070707_100350359 Ga0070707_1003503592 214
260 3300005471 Ga0070698_100072066 Ga0070698_1000720662 214
261 3300005471 Ga0070698_100161908 Ga0070698_1001619083 214
262 3300005471 Ga0070698_100253172 Ga0070698_1002531722 214
263 3300005471 Ga0070698_100407855 Ga0070698_1004078552 214
264 3300005471 Ga0070698_100650977 Ga0070698_1006509772 214
265 3300005536 Ga0070697_100001018 Ga0070697_1000010182 214
266 3300005536 Ga0070697_100013612 Ga0070697_1000136125 214
267 3300005536 Ga0070697_100014164 Ga0070697_1000141645 214
268 3300005545 Ga0070695_100289802 Ga0070695_1002898022 214
269 3300005545 Ga0070695_100380800 Ga0070695_1003808002 214
270 3300005545 Ga0070695_101003737 Ga0070695_1010037371 214
271 3300005546 Ga0070696_100201073 Ga0070696_1002010732 214
272 3300005546 Ga0070696_100393189 Ga0070696_1003931891 214
273 3300005546 Ga0070696_100419922 Ga0070696_1004199222 214
274 3300005547 Ga0070693_100093486 Ga0070693_1000934861 214
275 3300005549 Ga0070704_100000831 Ga0070704_1000008316 214
276 3300005549 Ga0070704_100221136 Ga0070704_1002211362 214
277 3300005549 Ga0070704_100241668 Ga0070704_1002416682 214
278 3300005549 Ga0070704_100543952 Ga0070704_1005439522 214
279 3300005563 Ga0068855_100396630 Ga0068855_1003966302 214
280 3300005615 Ga0070702_100018840 Ga0070702_1000188402 214
281 3300005617 Ga0068859_100016701 Ga0068859_1000167012 214
282 3300005617 Ga0068859_100166838 Ga0068859_1001668383 214
283 3300005617 Ga0068859_100173230 Ga0068859_1001732301 214
284 3300005617 Ga0068859_100298516 Ga0068859_1002985162 214
285 3300005618 Ga0068864_100090439 Ga0068864_1000904392 214
286 3300005719 Ga0068861_100036425 Ga0068861_1000364252 214
287 3300005719 Ga0068861_100373964 Ga0068861_1003739642 214
288 3300005841 Ga0068863_100777672 Ga0068863_1007776722 214
289 3300005842 Ga0068858_100000134 Ga0068858_10000013451 214
290 3300005842 Ga0068858_100918909 Ga0068858_1009189091 214
291 3300005843 Ga0068860_100193070 Ga0068860_1001930702 214
292 3300005843 Ga0068860_100501437 Ga0068860_1005014372 214
293 3300005985 Ga0081539_10166823 Ga0081539_101668231 214
294 3300006163 Ga0070715_10000062 Ga0070715_1000006214 214
295 3300006173 Ga0070716_100000012 Ga0070716_10000001223 214
296 3300006173 Ga0070716_100050615 Ga0070716_1000506153 214
297 3300006237 Ga0097621_100487509 Ga0097621_1004875091 214
298 3300006844 Ga0075428_100165558 Ga0075428_1001655582 214
299 3300006852 Ga0075433_10032574 Ga0075433_100325744 214
300 3300006852 Ga0075433_10132045 Ga0075433_101320453 214
301 3300006871 Ga0075434_100070920 Ga0075434_1000709202 214
302 3300006871 Ga0075434_100093911 Ga0075434_1000939111 214
303 3300006871 Ga0075434_100152769 Ga0075434_1001527692 214
304 3300006871 Ga0075434_100424323 Ga0075434_1004243232 214
305 3300006914 Ga0075436_100000008 Ga0075436_10000000876 214
306 3300006931 Ga0097620_100016700 Ga0097620_1000167006 214
307 3300006931 Ga0097620_100166844 Ga0097620_1001668443 214
308 3300006931 Ga0097620_100173244 Ga0097620_1001732443 214
309 3300006931 Ga0097620_100298525 Ga0097620_1002985252 214
310 3300007076 Ga0075435_100000657 Ga0075435_10000065723 214
311 3300007265 Ga0099794_10000926 Ga0099794_100009267 214
312 3300007265 Ga0099794_10234571 Ga0099794_102345711 214
313 3300007788 Ga0099795_10192661 Ga0099795_101926611 214
314 3300009094 Ga0111539_10033033 Ga0111539_100330336 214
315 3300009098 Ga0105245_10113233 Ga0105245_101132333 214
316 3300009101 Ga0105247_10000022 Ga0105247_10000022100 214
317 3300009147 Ga0114129_10012953 Ga0114129_100129532 214
318 3300009147 Ga0114129_10018693 Ga0114129_100186937 214
319 3300009147 Ga0114129_10335497 Ga0114129_103354972 214
320 3300009147 Ga0114129_10643465 Ga0114129_106434652 214
321 3300009148 Ga0105243_10000086 Ga0105243_100000864 214
322 3300009148 Ga0105243_10015316 Ga0105243_100153165 214
323 3300009148 Ga0105243_11001715 Ga0105243_110017151 214
324 3300009176 Ga0105242_10000544 Ga0105242_1000054425 214
325 3300009176 Ga0105242_10002881 Ga0105242_100028815 214
326 3300009176 Ga0105242_10032841 Ga0105242_100328413 214
327 3300009176 Ga0105242_10345245 Ga0105242_103452451 214
328 3300009176 Ga0105242_11051561 Ga0105242_110515611 214
329 3300009177 Ga0105248_10073288 Ga0105248_100732881 214
330 3300009553 Ga0105249_10000142 Ga0105249_100001425 214
331 3300009553 Ga0105249_10054149 Ga0105249_100541492 214
332 3300010159 Ga0099796_10055249 Ga0099796_100552491 214
333 3300010159 Ga0099796_10086807 Ga0099796_100868072 214
334 3300010159 Ga0099796_10090208 Ga0099796_100902081 214
335 3300010375 Ga0105239_10066662 Ga0105239_100666623 214
336 3300010375 Ga0105239_10959629 Ga0105239_109596291 214
337 3300011119 Ga0105246_10627424 Ga0105246_106274242 214
338 3300013297 Ga0157378_10000051 Ga0157378_1000005117 214
339 3300013297 Ga0157378_10025190 Ga0157378_100251907 214
340 3300013297 Ga0157378_10118731 Ga0157378_101187313 214
341 3300013297 Ga0157378_10471181 Ga0157378_104711811 214
342 3300013297 Ga0157378_10613016 Ga0157378_106130162 214
343 3300013306 Ga0163162_10000553 Ga0163162_1000055330 214
344 3300013306 Ga0163162_10018460 Ga0163162_100184605 214
345 3300013306 Ga0163162_10464968 Ga0163162_104649682 214
346 3300013307 Ga0157372_10205086 Ga0157372_102050864 214
347 3300013308 Ga0157375_10001734 Ga0157375_1000173411 214
348 3300014326 Ga0157380_10174955 Ga0157380_101749552 214
349 3300014326 Ga0157380_10350220 Ga0157380_103502201 214
350 3300014968 Ga0157379_10298901 Ga0157379_102989012 214
351 3300017792 Ga0163161_10003649 Ga0163161_100036498 214
352 3300017792 Ga0163161_10519344 Ga0163161_105193441 214
353 3300025223 Ga0207672_1000360 Ga0207672_10003607 214
354 3300025885 Ga0207653_10000008 Ga0207653_1000000877 214
355 3300025899 Ga0207642_10104194 Ga0207642_101041942 214
356 3300025900 Ga0207710_10000001 Ga0207710_10000001306 214
357 3300025901 Ga0207688_10049532 Ga0207688_100495322 214
358 3300025905 Ga0207685_10000053 Ga0207685_1000005324 214
359 3300025906 Ga0207699_10017173 Ga0207699_100171731 214
360 3300025907 Ga0207645_10598570 Ga0207645_105985701 214
361 3300025910 Ga0207684_10025631 Ga0207684_100256312 214
362 3300025918 Ga0207662_10107490 Ga0207662_101074902 214
363 3300025918 Ga0207662_10269089 Ga0207662_102690891 214
364 3300025922 Ga0207646_10003372 Ga0207646_100033722 214
365 3300025922 Ga0207646_10066025 Ga0207646_100660252 214
366 3300025922 Ga0207646_10128284 Ga0207646_101282842 214
367 3300025922 Ga0207646_10164572 Ga0207646_101645722 214
368 3300025922 Ga0207646_10726789 Ga0207646_107267891 214
369 3300025922 Ga0207646_10749041 Ga0207646_107490411 214
370 3300025927 Ga0207687_10858899 Ga0207687_108588991 214
371 3300025931 Ga0207644_10000374 Ga0207644_100003742 214
372 3300025934 Ga0207686_10000037 Ga0207686_1000003723 214
373 3300025934 Ga0207686_10000959 Ga0207686_100009598 214
374 3300025934 Ga0207686_10964987 Ga0207686_109649871 214
375 3300025935 Ga0207709_10000113 Ga0207709_1000011390 214
376 3300025935 Ga0207709_10008642 Ga0207709_100086422 214
377 3300025935 Ga0207709_10304896 Ga0207709_103048962 214
378 3300025939 Ga0207665_10000083 Ga0207665_1000008337 214
379 3300025939 Ga0207665_10186157 Ga0207665_101861572 214
380 3300025941 Ga0207711_10443321 Ga0207711_104433212 214
381 3300025942 Ga0207689_10024513 Ga0207689_100245134 214
382 3300025960 Ga0207651_10355586 Ga0207651_103555862 214
383 3300025960 Ga0207651_10639310 Ga0207651_106393102 214
384 3300025961 Ga0207712_10000106 Ga0207712_1000010630 214
385 3300025961 Ga0207712_10392845 Ga0207712_103928451 214
386 3300025972 Ga0207668_10008157 Ga0207668_100081574 214
387 3300025981 Ga0207640_10646087 Ga0207640_106460872 214
388 3300026023 Ga0207677_10135032 Ga0207677_101350321 214
389 3300026035 Ga0207703_10000024 Ga0207703_1000002411 214
390 3300026035 Ga0207703_10102555 Ga0207703_101025552 214
391 3300026075 Ga0207708_10049309 Ga0207708_100493093 214
392 3300026075 Ga0207708_10712472 Ga0207708_107124721 214
393 3300026088 Ga0207641_10217031 Ga0207641_102170311 214
394 3300026089 Ga0207648_10074396 Ga0207648_100743961 214
395 3300026095 Ga0207676_10807254 Ga0207676_108072541 214
396 3300026118 Ga0207675_100022312 Ga0207675_1000223124 214
397 3300026118 Ga0207675_100397835 Ga0207675_1003978352 214
398 3300026118 Ga0207675_100622192 Ga0207675_1006221922 214
399 3300027671 Ga0209588_1009284 Ga0209588_10092845 214
400 3300027907 Ga0207428_10011657 Ga0207428_100116578 214
401 3300028380 Ga0268265_10341006 Ga0268265_103410062 214
402 3300028381 Ga0268264_10312160 Ga0268264_103121602 214
403 3300028381 Ga0268264_10826174 Ga0268264_108261741 214
404 3300038699 Ga0242422_05268 Ga0242422_05268_32_688 214
405 3300038996 Ga0242420_009475 Ga0242420_009475_693_1343 214
406 3300038996 Ga0242420_025515 Ga0242420_025515_316_972 214
407 3300042144 Ga0450889_008399 Ga0450889_008399_24_668 214
408 3300042435 Ga0439434_0021468 Ga0439434_0021468_740_1384 214
409 3300042439 Ga0439464_0008042 Ga0439464_0008042_1277_1921 214
410 3300044673 Ga0453683_0039924 Ga0453683_0039924_617_1273 214
411 3300044673 Ga0453683_0258917 Ga0453683_0258917_405_1058 214
412 3300045051 Ga0451576_0499018 Ga0451576_0499018_583_1239 214
413 3300046462 Ga0495651_0321772 Ga0495651_0321772_318_974 214
414 3300046476 Ga0495662_0128852 Ga0495662_0128852_13_669 214
415 3300046517 Ga0495630_0293659 Ga0495630_0293659_439_1095 214
416 3300046533 Ga0495640_0381022 Ga0495640_0381022_11_667 214
417 3300046684 Ga0495669_0134316 Ga0495669_0134316_465_1121 214
418 3300046809 Ga0495600_0096088 Ga0495600_0096088_741_1397 214
419 3300047318 Ga0495636_0038456 Ga0495636_0038456_628_1284 214
420 3300047319 Ga0495674_0541174 Ga0495674_0541174_213_869 214
421 3300048904 Ga0496101_0234292 Ga0496101_0234292_398_1054 214
422 3300048909 Ga0496106_0016819 Ga0496106_0016819_497_1153 214
423 3300050507 nmdc:mga05p37_1002687_c1 nmdc:mga05p37_1002687_c1_231_875 214
424 3300050507 nmdc:mga05p37_144879_c1 nmdc:mga05p37_144879_c1_1664_2320 214
425 3300050507 nmdc:mga05p37_91797_c1 nmdc:mga05p37_91797_c1_2061_2717 214
426 3300050511 nmdc:mga08y16_87123_c1 nmdc:mga08y16_87123_c1_1513_2241 214
427 3300050512 nmdc:mga0n895_222103_c1 nmdc:mga0n895_222103_c1_20_676 214
428 3300050512 nmdc:mga0n895_249183_c1 nmdc:mga0n895_249183_c1_91_747 214
429 3300050512 nmdc:mga0n895_50250_c1 nmdc:mga0n895_50250_c1_2794_3450 214
430 3300050512 nmdc:mga0n895_898624_c1 nmdc:mga0n895_898624_c1_132_788 214
431 3300050513 nmdc:mga0rr50_1215_c1 nmdc:mga0rr50_1215_c1_11338_11994 214
432 3300050514 nmdc:mga08x19_16_c1 nmdc:mga08x19_16_c1_81083_81739 214
433 3300050515 nmdc:mga0a205_19117_c1 nmdc:mga0a205_19117_c1_5299_5955 214
434 3300050515 nmdc:mga0a205_44162_c1 nmdc:mga0a205_44162_c1_1819_2475 214
435 3300053083 Ga0495655_0008316 Ga0495655_0008316_1053_1709 214
436 3300053153 Ga0500616_0000675 Ga0500616_0000675_16006_16656 214
437 3300059492 Ga0587073_0056536 Ga0587073_0056536_104_757 214
438 3300005445 Ga0070708_100164389 Ga0070708_1001643892 215
439 3300005471 Ga0070698_100663922 Ga0070698_1006639221 215
440 2162886007 SwRhRL2b_contig_579756 SwRhRL2b_0415.00008150 217
441 3300001915 JGI24741J21665_1004742 JGI24741J21665_10047424 217
442 3300003322 rootL2_10021294 rootL2_100212941 217
443 3300005288 Ga0065714_10064704 Ga0065714_100647047 217
444 3300005289 Ga0065704_10074532 Ga0065704_100745322 217
445 3300005289 Ga0065704_10089699 Ga0065704_100896991 217
446 3300005329 Ga0070683_100006415 Ga0070683_1000064156 217
447 3300005535 Ga0070684_100004934 Ga0070684_1000049348 217
448 3300013100 Ga0157373_10000036 Ga0157373_1000003634 217
449 3300013100 Ga0157373_10141846 Ga0157373_101418462 217
450 3300013104 Ga0157370_10057057 Ga0157370_100570572 217
451 3300013308 Ga0157375_10004126 Ga0157375_100041262 217
452 3300014497 Ga0182008_10000039 Ga0182008_1000003967 217
453 3300015261 Ga0182006_1000012 Ga0182006_1000012233 217
454 3300017792 Ga0163161_10001071 Ga0163161_1000107116 217
455 3300017792 Ga0163161_10060176 Ga0163161_100601762 217
456 3300025944 Ga0207661_10000702 Ga0207661_100007026 217
457 3300031731 Ga0307405_10262941 Ga0307405_102629412 217
458 3300031911 Ga0307412_10000007 Ga0307412_10000007186 217
459 3300031911 Ga0307412_10000373 Ga0307412_1000037319 217
460 3300032002 Ga0307416_100000003 Ga0307416_10000000378 217
461 3300032004 Ga0307414_10000009 Ga0307414_10000009233 217
462 3300032004 Ga0307414_10740967 Ga0307414_107409672 217
463 3300041411 Ga0439466_0121998 Ga0439466_0121998_130_783 217
464 3300041413 Ga0439465_0002293 Ga0439465_0002293_299_952 217
465 3300042004 Ga0439445_0004176 Ga0439445_0004176_1602_2255 217
466 3300046453 Ga0495627_000003 Ga0495627_000003_159492_160145 217
467 3300046453 Ga0495627_008055 Ga0495627_008055_2058_2711 217
468 3300046507 Ga0495606_0008642 Ga0495606_0008642_8002_8655 217
469 3300046512 Ga0495610_0000032 Ga0495610_0000032_9387_10040 217
470 3300046512 Ga0495610_0000302 Ga0495610_0000302_12851_13510 217
471 3300046519 Ga0495632_0003226 Ga0495632_0003226_7619_8272 217
472 3300046522 Ga0495643_0038259 Ga0495643_0038259_234_887 217
473 3300046525 Ga0495663_0009797 Ga0495663_0009797_139_792 217
474 3300046525 Ga0495663_0019863 Ga0495663_0019863_1054_1707 217
475 3300046538 Ga0495609_0000083 Ga0495609_0000083_103345_103998 217
476 3300046558 Ga0495633_0000109 Ga0495633_0000109_6458_7111 217
477 3300046558 Ga0495633_0001489 Ga0495633_0001489_6030_6683 217
478 3300047472 Ga0495686_0000200 Ga0495686_0000200_70713_71366 217
479 3300048920 Ga0496117_0326982 Ga0496117_0326982_76_729 217
480 3300048925 Ga0496122_0011777 Ga0496122_0011777_5870_6523 217
481 3300048927 Ga0496124_0257134 Ga0496124_0257134_613_1266 217
482 3300048928 Ga0496125_0018968 Ga0496125_0018968_868_1521 217
483 3300049758 Ga0501241_000015 Ga0501241_000015_90410_91063 217
484 3300049766 Ga0501269_000486 Ga0501269_000486_2491_3144 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

35

249

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r8r-assembly2.cif.gz_L transaldolase from bacillus subtilis 0.9753 1 214
3r8r-assembly2.cif.gz_N transaldolase from bacillus subtilis 0.9753 1 212
3r8r-assembly1.cif.gz_J transaldolase from bacillus subtilis 0.9752 1 212
1vpx-assembly1.cif.gz_A crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.9727 1 216
3r8r-assembly2.cif.gz_P transaldolase from bacillus subtilis 0.9725 1 212
ID Description Score Start End Superfamily
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9714 1 214 3.20.20.70
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9624 1 214 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9094 1 216 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8934 1 216 3.20.20.70
af_Q84ZL6_63_393_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8441 2 196 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A442LUU8-F1-model_v4 Fructose-6-phosphate aldolase 0.9999 59 127 GO:0005975
AF-A0A2D7VSZ6-F1-model_v4 Fructose-6-phosphate aldolase 0.9998 1 106 GO:0005975
AF-A0A349NT29-F1-model_v4 deleted 0.9973 1 88
AF-A0A353R607-F1-model_v4 Fructose-6-phosphate aldolase 0.9953 23 126 GO:0005975
AF-A0A3D6BWL1-F1-model_v4 Fructose-6-phosphate aldolase 0.995 1 133 GO:0005975

Feature Viewer

pLDDT pTM Quality
94.02 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map