F452932

General Info

Members Datasets Scaffolds Average Seq Length
484 298 968 156

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10231544|Ga0105246_102315442
Length 187
Sequence LPVRGEETGVAFDIEAIAHVRGGRTEAVDDDWDHETAVIELDPRFGPDALAGLEDFSHAEIAFVFDRVPSDKVETGARHPRNRADWPLIGIFAQRGKNRPNRIGITICRIEKVEGTRLHVRGLDAIDGTPVIDIKPVLREFLPRGDVRQPDWASELMAGYWRAWPAPRLARPAPAQGGRPCWDRASR

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
94 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
95 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
96 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
262 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
265 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
269 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
272 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
273 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
274 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
275 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
276 2643221729 Bacillus sp. Root11 Isolate Unclassified
277 2643221730 Bacillus sp. Root131 Isolate Unclassified
278 2684622632 Bacillus cereus 905 Isolate Unclassified
279 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
280 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
281 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
282 2738541358 Bacillus sp. OV752 Isolate Unclassified
283 2738543006 Bacillus sp. OK077 Isolate Unclassified
284 2738543017 Bacillus sp. OV186 Isolate Unclassified
285 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
286 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
287 2857586860 Bacillus sp. R-71935 Isolate Unclassified
288 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
289 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
290 2938917290 Bacillus sp. CR71 Isolate Unclassified
291 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
292 2965761152 Bacillus sp. COPE52 Isolate Unclassified
293 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
294 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
295 8022792930 Bacillus sp. Xin Isolate Rhizosphere
296 8023438354 Bacillus sp. BH2 Isolate Unclassified
297 8023444577 Bacillus sp. BH32 Isolate Unclassified
298 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.83
Metatranscriptomes 0
Isolates 5.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.08
Nodule 0.83
Rhizoplane 3.31
Rhizosphere 71.69
Stem 0
Stem Tuber 0
Unclassified 2.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10231544 3300011119 Bacteria 1455
2 JGI24741J21665_1000273 3300001915 Bacteria 15469
3 JGI24747J21853_1019216 3300001978 Bacteria 736
4 JGI24740J21852_10011128 3300001979 Bacteria 3435
5 JGI24737J22298_10000698 3300001990 Bacteria 11804
6 JGI24737J22298_10004668 3300001990 Bacteria 4764
7 JGI24744J21845_10052342 3300002077 Bacteria 751
8 JGI25159J45721_1001328 3300002987 Bacteria 10397
9 JGI25159J45721_1005749 3300002987 Bacteria 3837
10 JGI25159J45721_1019126 3300002987 Bacteria 1357
11 JGI25159J45721_1051519 3300002987 Bacteria 562
12 JGI25151J46595_10000173 3300003187 Bacteria 83223
13 JGI25151J46595_10002843 3300003187 Bacteria 9968
14 JGI25151J46595_10005549 3300003187 Bacteria 6497
15 JGI25151J46595_10006202 3300003187 Bacteria 6050
16 JGI25151J46595_10011124 3300003187 Bacteria 4148
17 JGI25151J46595_10044033 3300003187 Bacteria 1590
18 JGI25151J46595_10055319 3300003187 Bacteria 1309
19 JGI25151J46595_10110299 3300003187 Bacteria 721
20 JGI25151J46595_10158369 3300003187 Bacteria 535
21 JGI25153J46596_10000021 3300003215 Bacteria 252651
22 JGI25153J46596_10006222 3300003215 Bacteria 6108
23 rootH2_10061189 3300003320 Bacteria 2050
24 rootH1_10279068 3300003323 Bacteria 1032
25 Ga0055538_1000729 3300003751 Bacteria 9650
26 Ga0055532_1000490 3300003758 Bacteria 17635
27 Ga0055525_1000012 3300003759 Bacteria 486564
28 Ga0055542_1000094 3300003762 Bacteria 119899
29 Ga0055529_1000045 3300003763 Bacteria 209617
30 Ga0055536_1003107 3300003781 Bacteria 9031
31 Ga0055536_1007731 3300003781 Bacteria 4756
32 Ga0055536_1047830 3300003781 Bacteria 961
33 Ga0065715_10238104 3300005293 Bacteria 1209
34 Ga0065707_10010580 3300005295 Bacteria 2568
35 Ga0070658_10018031 3300005327 Bacteria 5645
36 Ga0070676_10337077 3300005328 Bacteria 1033
37 Ga0070670_100257536 3300005331 Bacteria 1521
38 Ga0070682_100254033 3300005337 Unclassified 1269
39 Ga0070660_100139110 3300005339 Bacteria 1947
40 Ga0070660_100863027 3300005339 Bacteria 762
41 Ga0070660_100890961 3300005339 Bacteria 750
42 Ga0070660_100994977 3300005339 Bacteria 708
43 Ga0070689_100066521 3300005340 Bacteria 2808
44 Ga0070661_100014248 3300005344 Bacteria 5601
45 Ga0070669_100867579 3300005353 Bacteria 770
46 Ga0070675_100111498 3300005354 Bacteria 2315
47 Ga0070675_100655644 3300005354 Bacteria 954
48 Ga0070674_100003272 3300005356 Bacteria 9056
49 Ga0070674_100014453 3300005356 Bacteria 4907
50 Ga0070674_100143583 3300005356 Bacteria 1794
51 Ga0070673_100009151 3300005364 Bacteria 6636
52 Ga0070659_100161682 3300005366 Bacteria 1831
53 Ga0070659_100459889 3300005366 Bacteria 1081
54 Ga0070659_100589472 3300005366 Bacteria 954
55 Ga0070667_100281088 3300005367 Bacteria 1494
56 Ga0070667_100991504 3300005367 Bacteria 784
57 Ga0070701_10079503 3300005438 Bacteria 1771
58 Ga0070700_100709600 3300005441 Bacteria 801
59 Ga0070694_100328030 3300005444 Bacteria 1180
60 Ga0070663_100396545 3300005455 Bacteria 1127
61 Ga0070663_100509571 3300005455 Bacteria 1000
62 Ga0070678_100000149 3300005456 Bacteria 29059
63 Ga0070678_100771642 3300005456 Bacteria 871
64 Ga0070678_100833829 3300005456 Bacteria 839
65 Ga0068867_100038847 3300005459 Bacteria 3467
66 Ga0068867_100267614 3300005459 Bacteria 1396
67 Ga0070698_100005242 3300005471 Bacteria 14179
68 Ga0070679_101405511 3300005530 Bacteria 644
69 Ga0070672_100166727 3300005543 Bacteria 1830
70 Ga0070672_100951174 3300005543 Bacteria 760
71 Ga0070686_100285611 3300005544 Bacteria 1218
72 Ga0070695_100099436 3300005545 Bacteria 1956
73 Ga0070693_100003881 3300005547 Bacteria 7011
74 Ga0070665_100000021 3300005548 Bacteria 389668
75 Ga0070665_100594023 3300005548 Bacteria 1120
76 Ga0068855_100298709 3300005563 Bacteria 1784
77 Ga0070664_100501138 3300005564 Bacteria 1119
78 Ga0068854_100006661 3300005578 Bacteria 7361
79 Ga0068854_100126720 3300005578 Bacteria 1945
80 Ga0068856_100121898 3300005614 Bacteria 2609
81 Ga0070702_100277755 3300005615 Bacteria 1149
82 Ga0068852_100002971 3300005616 Bacteria 11774
83 Ga0068852_100050318 3300005616 Bacteria 3570
84 Ga0068859_100016161 3300005617 Bacteria 7495
85 Ga0068859_100786486 3300005617 Bacteria 1040
86 Ga0068861_100000004 3300005719 Bacteria 105907
87 Ga0068861_100060663 3300005719 Bacteria 2899
88 Ga0068861_100459384 3300005719 Bacteria 1143
89 Ga0068851_10018246 3300005834 Bacteria 3379
90 Ga0068863_100012044 3300005841 Bacteria 8356
91 Ga0068863_100047629 3300005841 Bacteria 4066
92 Ga0068858_100091429 3300005842 Bacteria 2832
93 Ga0068858_100424053 3300005842 Bacteria 1279
94 Ga0068860_100056613 3300005843 Bacteria 3727
95 Ga0068860_100143279 3300005843 Bacteria 2298
96 Ga0068860_100311880 3300005843 Bacteria 1543
97 Ga0068862_100082451 3300005844 Bacteria 2791
98 Ga0068862_100273204 3300005844 Bacteria 1546
99 Ga0081455_10000431 3300005937 Bacteria 55069
100 Ga0070715_10570172 3300006163 Unclassified 659
101 Ga0075367_10398856 3300006178 Bacteria 870
102 Ga0075369_10103026 3300006186 Bacteria 1282
103 Ga0075366_10084487 3300006195 Bacteria 1898
104 Ga0097621_100803610 3300006237 Bacteria 872
105 Ga0097621_100934230 3300006237 Bacteria 809
106 Ga0068871_100009681 3300006358 Bacteria 6997
107 Ga0075430_101136538 3300006846 Unclassified 643
108 Ga0075431_100570431 3300006847 Bacteria 1118
109 Ga0075429_100195855 3300006880 Bacteria 1770
110 Ga0075436_100234220 3300006914 Bacteria 1305
111 Ga0097620_100016161 3300006931 Bacteria 7495
112 Ga0097620_100786551 3300006931 Bacteria 1040
113 Ga0075435_100003365 3300007076 Bacteria 10842
114 Ga0075435_100912115 3300007076 Bacteria 766
115 Ga0105251_10032877 3300009011 Bacteria 2580
116 Ga0105251_10191871 3300009011 Bacteria 920
117 Ga0105244_10019025 3300009036 Bacteria 3843
118 Ga0105244_10184530 3300009036 Bacteria 988
119 Ga0105250_10003183 3300009092 Bacteria 7855
120 Ga0105250_10018029 3300009092 Bacteria 2864
121 Ga0105250_10025112 3300009092 Bacteria 2402
122 Ga0105240_10418178 3300009093 Bacteria 1507
123 Ga0105245_10090931 3300009098 Bacteria 2808
124 Ga0105245_10416903 3300009098 Bacteria 1345
125 Ga0105245_11310822 3300009098 Bacteria 773
126 Ga0105247_10210204 3300009101 Bacteria 1312
127 Ga0105243_10000512 3300009148 Bacteria 39573
128 Ga0105243_10129370 3300009148 Bacteria 2140
129 Ga0105243_11778483 3300009148 Unclassified 647
130 Ga0105241_10180210 3300009174 Bacteria 1752
131 Ga0105241_10393422 3300009174 Bacteria 1214
132 Ga0105241_11030255 3300009174 Bacteria 771
133 Ga0105242_10078198 3300009176 Bacteria 2761
134 Ga0105248_10002150 3300009177 Bacteria 21793
135 Ga0105248_10010555 3300009177 Bacteria 10177
136 Ga0105248_10013044 3300009177 Bacteria 9160
137 Ga0105248_10815943 3300009177 Bacteria 1053
138 Ga0105237_10087434 3300009545 Bacteria 3106
139 Ga0105237_10182631 3300009545 Bacteria 2097
140 Ga0105237_10259990 3300009545 Bacteria 1739
141 Ga0105238_11268544 3300009551 Bacteria 762
142 Ga0105249_10199328 3300009553 Bacteria 1958
143 Ga0105249_10373239 3300009553 Bacteria 1451
144 Ga0105249_11588358 3300009553 Unclassified 727
145 Ga0105239_10119575 3300010375 Bacteria 2924
146 Ga0105246_10618466 3300011119 Bacteria 938
147 Ga0157371_10000032 3300013102 Bacteria 230252
148 Ga0157369_10359299 3300013105 Bacteria 1512
149 Ga0157378_11414409 3300013297 Bacteria 739
150 Ga0163162_10491175 3300013306 Bacteria 1359
151 Ga0163162_10729818 3300013306 Bacteria 1111
152 Ga0163162_12982025 3300013306 Bacteria 544
153 Ga0157372_10410444 3300013307 Bacteria 1578
154 Ga0157379_10385925 3300014968 Bacteria 1286
155 Ga0163161_10207610 3300017792 Bacteria 1512
156 Ga0214544_1011478 3300021320 Bacteria 12205
157 Ga0214542_1001823 3300021321 Bacteria 44037
158 Ga0214545_1001477 3300021324 Bacteria 44037
159 Ga0214543_1004144 3300021327 Bacteria 27673
160 Ga0213876_10156284 3300021384 Unclassified 1213
161 Ga0209784_100054 3300025224 Bacteria 178541
162 Ga0209147_100057 3300025229 Bacteria 253870
163 Ga0209147_100185 3300025229 Bacteria 74400
164 Ga0209563_100030 3300025230 Bacteria 489259
165 Ga0209646_1004008 3300025246 Bacteria 2767
166 Ga0209148_1000011 3300025254 Bacteria 1196503
167 Ga0209455_1000006 3300025272 Bacteria 1196503
168 Ga0209455_1009479 3300025272 Bacteria 2554
169 Ga0209130_1000633 3300025284 Bacteria 33023
170 Ga0209130_1002051 3300025284 Bacteria 10934
171 Ga0209130_1007551 3300025284 Bacteria 3336
172 Ga0209130_1016609 3300025284 Bacteria 1776
173 Ga0209130_1022916 3300025284 Bacteria 1386
174 Ga0209676_1000494 3300025292 Bacteria 63484
175 Ga0209676_1000649 3300025292 Bacteria 49872
176 Ga0209676_1006704 3300025292 Bacteria 5606
177 Ga0209676_1020397 3300025292 Bacteria 2252
178 Ga0209676_1023446 3300025292 Bacteria 2020
179 Ga0209676_1048516 3300025292 Bacteria 1133
180 Ga0209025_1000107 3300025294 Bacteria 222387
181 Ga0209025_1000266 3300025294 Bacteria 122782
182 Ga0209025_1000355 3300025294 Bacteria 98571
183 Ga0209025_1001564 3300025294 Bacteria 29032
184 Ga0209025_1002190 3300025294 Bacteria 21650
185 Ga0209025_1002944 3300025294 Bacteria 16932
186 Ga0209025_1003509 3300025294 Bacteria 14740
187 Ga0209025_1004192 3300025294 Bacteria 12718
188 Ga0209025_1004850 3300025294 Bacteria 11349
189 Ga0209025_1005049 3300025294 Bacteria 11003
190 Ga0209025_1006327 3300025294 Bacteria 9235
191 Ga0209025_1080211 3300025294 Bacteria 1112
192 Ga0209025_1103042 3300025294 Bacteria 897
193 Ga0209758_1000023 3300025297 Bacteria 612453
194 Ga0209758_1000032 3300025297 Bacteria 481623
195 Ga0207656_10000615 3300025321 Bacteria 11705
196 Ga0207696_1005843 3300025711 Bacteria 5051
197 Ga0207696_1015056 3300025711 Bacteria 2631
198 Ga0207696_1049915 3300025711 Bacteria 1199
199 Ga0207655_1022342 3300025728 Bacteria 3175
200 Ga0207713_1032264 3300025735 Bacteria 2303
201 Ga0207713_1101937 3300025735 Bacteria 989
202 Ga0207710_10248201 3300025900 Bacteria 889
203 Ga0207680_10048178 3300025903 Bacteria 2529
204 Ga0207647_10011819 3300025904 Bacteria 6102
205 Ga0207647_10036845 3300025904 Bacteria 3105
206 Ga0207685_10210861 3300025905 Bacteria 918
207 Ga0207645_10035604 3300025907 Bacteria 3197
208 Ga0207645_10079482 3300025907 Bacteria 2102
209 Ga0207645_10750247 3300025907 Bacteria 664
210 Ga0207705_10001219 3300025909 Bacteria 20805
211 Ga0207654_10001636 3300025911 Bacteria 11707
212 Ga0207654_10171403 3300025911 Bacteria 1409
213 Ga0207695_10013219 3300025913 Bacteria 9851
214 Ga0207671_10005662 3300025914 Bacteria 11430
215 Ga0207671_10059958 3300025914 Bacteria 2822
216 Ga0207671_10172476 3300025914 Bacteria 1680
217 Ga0207663_10009441 3300025916 Bacteria 5151
218 Ga0207657_10010001 3300025919 Bacteria 9491
219 Ga0207649_10003922 3300025920 Bacteria 8116
220 Ga0207649_10895840 3300025920 Bacteria 695
221 Ga0207646_10162600 3300025922 Bacteria 2015
222 Ga0207681_10012522 3300025923 Bacteria 5234
223 Ga0207694_10008848 3300025924 Bacteria 7594
224 Ga0207694_11128722 3300025924 Bacteria 663
225 Ga0207650_10339483 3300025925 Bacteria 1233
226 Ga0207659_10080988 3300025926 Bacteria 2400
227 Ga0207659_10683967 3300025926 Bacteria 878
228 Ga0207687_10032248 3300025927 Bacteria 3547
229 Ga0207687_10199672 3300025927 Bacteria 1562
230 Ga0207687_10223033 3300025927 Bacteria 1485
231 Ga0207644_10101469 3300025931 Bacteria 2162
232 Ga0207690_10016577 3300025932 Bacteria 4486
233 Ga0207690_10122516 3300025932 Bacteria 1891
234 Ga0207706_10117408 3300025933 Bacteria 2340
235 Ga0207706_10186655 3300025933 Bacteria 1821
236 Ga0207706_10260539 3300025933 Bacteria 1514
237 Ga0207709_10000145 3300025935 Bacteria 98629
238 Ga0207669_10000118 3300025937 Bacteria 39673
239 Ga0207669_10000784 3300025937 Bacteria 13595
240 Ga0207669_10065466 3300025937 Bacteria 2255
241 Ga0207691_10003479 3300025940 Bacteria 15330
242 Ga0207691_10352583 3300025940 Bacteria 1259
243 Ga0207711_10020723 3300025941 Bacteria 5486
244 Ga0207711_11283650 3300025941 Bacteria 674
245 Ga0207679_10083807 3300025945 Bacteria 2445
246 Ga0207679_10437183 3300025945 Bacteria 1158
247 Ga0207667_10000002 3300025949 Bacteria 895662
248 Ga0207667_10591362 3300025949 Bacteria 1120
249 Ga0207651_10007510 3300025960 Bacteria 5811
250 Ga0207651_10155091 3300025960 Bacteria 1788
251 Ga0207651_10275454 3300025960 Bacteria 1388
252 Ga0207712_10051407 3300025961 Bacteria 2882
253 Ga0207712_10544830 3300025961 Bacteria 997
254 Ga0207640_10002033 3300025981 Bacteria 10932
255 Ga0207640_10004441 3300025981 Bacteria 7608
256 Ga0207658_10423454 3300025986 Bacteria 1174
257 Ga0207703_10174553 3300026035 Bacteria 1893
258 Ga0207703_10193348 3300026035 Bacteria 1804
259 Ga0207703_10225730 3300026035 Bacteria 1677
260 Ga0207703_10514355 3300026035 Bacteria 1125
261 Ga0207639_10004520 3300026041 Bacteria 9380
262 Ga0207678_10006272 3300026067 Bacteria 10561
263 Ga0207678_10295100 3300026067 Bacteria 1392
264 Ga0207708_10042079 3300026075 Bacteria 3483
265 Ga0207702_10006858 3300026078 Bacteria 9768
266 Ga0207702_10036825 3300026078 Bacteria 4093
267 Ga0207641_10029948 3300026088 Bacteria 4503
268 Ga0207641_10103558 3300026088 Bacteria 2511
269 Ga0207648_10019898 3300026089 Bacteria 6058
270 Ga0207648_10245386 3300026089 Bacteria 1596
271 Ga0207674_10065996 3300026116 Bacteria 3646
272 Ga0207674_10981409 3300026116 Bacteria 814
273 Ga0207675_100000032 3300026118 Bacteria 108677
274 Ga0207675_100041923 3300026118 Bacteria 4274
275 Ga0207675_102006141 3300026118 Bacteria 596
276 Ga0207683_10000881 3300026121 Bacteria 27549
277 Ga0207698_10002649 3300026142 Bacteria 10641
278 Ga0207698_10035858 3300026142 Bacteria 3633
279 Ga0268266_10000015 3300028379 Bacteria 630629
280 Ga0268266_10021691 3300028379 Bacteria 5473
281 Ga0268266_10399147 3300028379 Bacteria 1300
282 Ga0268265_10093993 3300028380 Bacteria 2404
283 Ga0268265_10126892 3300028380 Bacteria 2113
284 Ga0268264_10038204 3300028381 Bacteria 3961
285 Ga0268264_10099816 3300028381 Bacteria 2520
286 Ga0268264_10288644 3300028381 Bacteria 1540
287 Ga0265338_10013206 3300028800 Bacteria 9347
288 Ga0237817_10031 3300030083 Bacteria 49190
289 Ga0237817_10037 3300030083 Bacteria 47435
290 Ga0265339_10125051 3300031249 Bacteria 1319
291 Ga0265316_10273803 3300031344 Bacteria 1235
292 Ga0307513_10008158 3300031456 Bacteria 13441
293 Ga0307509_10524162 3300031507 Bacteria 866
294 Ga0307510_10077558 3300033180 Bacteria 3258
295 Ga0307510_10239544 3300033180 Bacteria 1310
296 Ga0373938_0034059 3300034957 Bacteria 1105
297 Ga0373949_0000141 3300035090 Bacteria 27063
298 Ga0373953_0023291 3300035117 Bacteria 2343
299 Ga0373953_0141664 3300035117 Bacteria 1028
300 Ga0373956_0075828 3300035119 Bacteria 1538
301 Ga0373956_0431494 3300035119 Bacteria 629
302 Ga0373942_0252006 3300035207 Bacteria 600
303 Ga0373924_0039664 3300035410 Bacteria 1925
304 Ga0373933_0027776 3300035724 Bacteria 3262
305 Ga0373937_0031146 3300036401 Bacteria 4830
306 Ga0373937_0902654 3300036401 Bacteria 832
307 Ga0395905_0001140 3300037471 Bacteria 33247
308 Ga0395905_0095511 3300037471 Bacteria 2790
309 Ga0395905_0210745 3300037471 Bacteria 1820
310 Ga0395901_0653553 3300038443 Bacteria 1054
311 Ga0237819_00044 3300038705 Bacteria 43089
312 Ga0237819_00450 3300038705 Bacteria 14003
313 Ga0436365_0412369 3300039437 Bacteria 1785
314 Ga0451800_0094444 3300041459 Bacteria 721
315 Ga0451833_0083082 3300041491 Bacteria 899
316 Ga0439449_0075341 3300042007 Bacteria 1243
317 Ga0451577_0602604 3300042876 Bacteria 997
318 Ga0451577_0937728 3300042876 Unclassified 779
319 Ga0466972_0001182 3300044658 Bacteria 12531
320 Ga0453683_0154911 3300044673 Bacteria 1448
321 Ga0466961_0130291 3300044693 Bacteria 1576
322 Ga0466964_0116699 3300044706 Bacteria 1197
323 Ga0453684_0000007 3300044712 Bacteria 1301482
324 Ga0453684_0010210 3300044712 Bacteria 16101
325 Ga0453684_0077002 3300044712 Bacteria 4184
326 Ga0453684_0137726 3300044712 Bacteria 2920
327 Ga0453684_0165355 3300044712 Bacteria 2612
328 Ga0453684_0223719 3300044712 Bacteria 2178
329 Ga0453684_0368232 3300044712 Bacteria 1616
330 Ga0453684_0459775 3300044712 Bacteria 1415
331 Ga0453684_1939661 3300044712 Bacteria 595
332 Ga0466960_0033649 3300044901 Bacteria 2383
333 Ga0451576_0562283 3300045051 Bacteria 1198
334 Ga0451576_0636647 3300045051 Bacteria 1120
335 Ga0466967_0067505 3300045976 Bacteria 3190
336 Ga0495592_0436549 3300046454 Bacteria 823
337 Ga0495638_0146259 3300046460 Bacteria 1375
338 Ga0495641_0168475 3300046461 Unclassified 980
339 Ga0495650_0000302 3300046471 Bacteria 89516
340 Ga0495662_0516464 3300046476 Bacteria 585
341 Ga0495584_0022624 3300046491 Bacteria 3189
342 Ga0495584_0034164 3300046491 Bacteria 2573
343 Ga0495585_0021537 3300046492 Bacteria 3701
344 Ga0495585_0023239 3300046492 Bacteria 3558
345 Ga0495585_0066580 3300046492 Bacteria 1972
346 Ga0495607_0067623 3300046501 Bacteria 2007
347 Ga0495583_0001345 3300046506 Bacteria 25472
348 Ga0495583_0005024 3300046506 Bacteria 9156
349 Ga0495583_0007631 3300046506 Bacteria 6750
350 Ga0495606_0001599 3300046507 Bacteria 29536
351 Ga0495606_0107631 3300046507 Bacteria 1686
352 Ga0495616_0015569 3300046513 Bacteria 4227
353 Ga0495620_0184122 3300046515 Bacteria 807
354 Ga0495628_0187074 3300046516 Unclassified 1565
355 Ga0495631_0060236 3300046518 Unclassified 1647
356 Ga0495643_0000203 3300046522 Bacteria 92549
357 Ga0495643_0001323 3300046522 Bacteria 23436
358 Ga0495643_0002857 3300046522 Bacteria 13130
359 Ga0495643_0049889 3300046522 Bacteria 2255
360 Ga0495643_0158903 3300046522 Bacteria 1113
361 Ga0495648_0000961 3300046524 Bacteria 29733
362 Ga0495663_0003785 3300046525 Bacteria 4317
363 Ga0495663_0004208 3300046525 Bacteria 4062
364 Ga0495640_0389954 3300046533 Bacteria 856
365 Ga0495587_0051172 3300046536 Bacteria 2443
366 Ga0495587_0171116 3300046536 Bacteria 1234
367 Ga0495598_0085902 3300046537 Bacteria 1017
368 Ga0495621_0051231 3300046539 Bacteria 1477
369 Ga0495621_0137062 3300046539 Bacteria 955
370 Ga0495622_0164813 3300046557 Bacteria 998
371 Ga0495633_0000770 3300046558 Bacteria 28708
372 Ga0495633_0102164 3300046558 Bacteria 1331
373 Ga0495668_0000016 3300046616 Bacteria 438197
374 Ga0495668_0167860 3300046616 Bacteria 1202
375 Ga0495668_0238633 3300046616 Bacteria 995
376 Ga0495611_0005595 3300046648 Bacteria 5359
377 Ga0495611_0013550 3300046648 Bacteria 3473
378 Ga0495611_0309917 3300046648 Bacteria 727
379 Ga0495625_0005534 3300046660 Bacteria 11479
380 Ga0495625_0014265 3300046660 Bacteria 6352
381 Ga0495625_0063004 3300046660 Bacteria 2619
382 Ga0495625_0208588 3300046660 Bacteria 1285
383 Ga0495625_0298972 3300046660 Bacteria 1030
384 Ga0495625_0461874 3300046660 Bacteria 782
385 Ga0495599_0270561 3300046678 Bacteria 1031
386 Ga0495647_0051224 3300046681 Bacteria 1604
387 Ga0495658_0034225 3300046683 Bacteria 2786
388 Ga0495658_0434152 3300046683 Bacteria 838
389 Ga0495658_0522993 3300046683 Unclassified 759
390 Ga0495658_0790300 3300046683 Bacteria 608
391 Ga0495669_0000050 3300046684 Bacteria 80688
392 Ga0495669_0007538 3300046684 Bacteria 4563
393 Ga0495613_0196511 3300046689 Bacteria 1424
394 Ga0495670_0005533 3300046691 Bacteria 6200
395 Ga0495670_0138698 3300046691 Bacteria 1270
396 Ga0495649_0072989 3300046694 Bacteria 1839
397 Ga0495600_0001875 3300046809 Bacteria 11796
398 Ga0495660_0207565 3300046810 Bacteria 931
399 Ga0495636_0071386 3300047318 Bacteria 1483
400 Ga0495680_0226173 3300047322 Unclassified 1334
401 Ga0495683_0000816 3300047323 Bacteria 22176
402 Ga0495683_0021963 3300047323 Bacteria 3285
403 Ga0495687_001300 3300047443 Bacteria 23447
404 Ga0495687_001654 3300047443 Bacteria 20024
405 Ga0495677_0001776 3300047445 Bacteria 8624
406 Ga0495677_0142669 3300047445 Bacteria 920
407 Ga0495681_0003424 3300047470 Bacteria 11041
408 Ga0495681_0039674 3300047470 Bacteria 2297
409 Ga0495602_0760877 3300048088 Unclassified 653
410 Ga0496102_0005894 3300048905 Bacteria 10430
411 Ga0496103_0000131 3300048906 Bacteria 79787
412 Ga0496103_0102879 3300048906 Bacteria 1809
413 Ga0496104_0116940 3300048907 Bacteria 2559
414 Ga0496105_0001020 3300048908 Bacteria 19340
415 Ga0496106_0807571 3300048909 Bacteria 744
416 Ga0496107_0240709 3300048910 Bacteria 1346
417 Ga0496107_0780004 3300048910 Unclassified 700
418 Ga0496108_0406443 3300048911 Bacteria 1189
419 Ga0496110_0081036 3300048913 Bacteria 2893
420 Ga0496111_0009756 3300048914 Bacteria 6418
421 Ga0496112_0471832 3300048915 Bacteria 1192
422 Ga0496113_0014634 3300048916 Bacteria 5361
423 Ga0496114_0018506 3300048917 Bacteria 5633
424 Ga0496115_0000133 3300048918 Bacteria 67951
425 Ga0496116_0005419 3300048919 Bacteria 11859
426 Ga0496117_0002127 3300048920 Bacteria 25909
427 Ga0496118_0000092 3300048921 Bacteria 169106
428 Ga0496119_0005121 3300048922 Bacteria 12704
429 Ga0496120_0094557 3300048923 Bacteria 1590
430 Ga0496121_0013328 3300048924 Bacteria 8848
431 Ga0496122_0015746 3300048925 Bacteria 7208
432 Ga0496123_0002753 3300048926 Bacteria 21034
433 Ga0496124_0000081 3300048927 Bacteria 208413
434 Ga0496124_0002777 3300048927 Bacteria 22248
435 Ga0496125_0002309 3300048928 Bacteria 25170
436 Ga0496126_0000283 3300048929 Bacteria 107129
437 Ga0496126_0007418 3300048929 Bacteria 12031
438 Ga0495678_197449 3300049459 Bacteria 622
439 nmdc:mga0k408_58101_c1 3300050493 Bacteria 2246
440 nmdc:mga09592_320836_c1 3300050508 Bacteria 1342
441 nmdc:mga0qj67_1006294_c1 3300050509 Bacteria 654
442 nmdc:mga06r32_313956_c1 3300050510 Bacteria 1553
443 nmdc:mga0rr50_3273_c1 3300050513 Bacteria 9292
444 nmdc:mga0rr50_804263_c1 3300050513 Bacteria 802
445 nmdc:mga08x19_232031_c1 3300050514 Bacteria 1270
446 nmdc:mga0sz30_247356_c1 3300050516 Bacteria 794
447 Ga0500610_0000471 3300053079 Bacteria 12420
448 Ga0495619_0376826 3300053085 Bacteria 981
449 Ga0500556_0000095 3300053104 Bacteria 82300
450 Ga0500593_001106 3300053117 Bacteria 9714
451 Ga0500595_001409 3300053119 Bacteria 12904
452 Ga0500595_003953 3300053119 Bacteria 6774
453 Ga0500559_0023316 3300053136 Bacteria 2627
454 Ga0500619_001400 3300053154 Bacteria 4254
455 Ga0500636_0004585 3300053177 Bacteria 7839
456 Ga0500645_000221 3300053730 Bacteria 43327
457 Ga0500596_001215 3300053735 Bacteria 5209
458 Ga0500601_051726 3300053737 Bacteria 512
459 Ga0500661_068745 3300055283 Bacteria 646
460 2553395547 2551306519 Bacteria 5465154
461 2644422139 2643221676 Bacteria 8119172
462 2644704633 2643221729 Bacteria 6621700
463 2644709327 2643221730 Bacteria 6523787
464 2685150124 2684622632 Bacteria 5380049
465 2698323138 2695420987 Bacteria 6152737
466 2705994098 2703719227 Bacteria 5631989
467 2721505426 2718218445 Bacteria 5113413
468 2739157937 2738541358 Bacteria 5932299
469 2739210617 2738543006 Bacteria 5904091
470 2739268006 2738543017 Bacteria 4271950
471 2777839420 2775507192 Bacteria 4622234
472 2819578793 2818991443 Bacteria 6598732
473 2857587100 2857586860 Bacteria 4354574
474 2918508082 2918501144 Bacteria 8668083
475 2929235331 2929233124 Bacteria 5948380
476 2938919508 2938917290 Bacteria 5914775
477 2947428879 2947426588 Bacteria 5357194
478 2965763372 2965761152 Bacteria 5806513
479 2979085827 2979083700 Bacteria 5894929
480 8022625673 8022621104 Bacteria 5241040
481 8022798570 8022792930 Bacteria 5693794
482 8023444110 8023438354 Bacteria 5779374
483 8023449707 8023444577 Bacteria 5661597
484 8057584918 8057582654 Bacteria 5218944
485 Ga0105246_10231544
486 JGI24741J21665_1000273
487 JGI24747J21853_1019216
488 JGI24740J21852_10011128
489 JGI24737J22298_10000698
490 JGI24737J22298_10004668
491 JGI24744J21845_10052342
492 JGI25159J45721_1001328
493 JGI25159J45721_1005749
494 JGI25159J45721_1019126
495 JGI25159J45721_1051519
496 JGI25151J46595_10000173
497 JGI25151J46595_10002843
498 JGI25151J46595_10005549
499 JGI25151J46595_10006202
500 JGI25151J46595_10011124
501 JGI25151J46595_10044033
502 JGI25151J46595_10055319
503 JGI25151J46595_10110299
504 JGI25151J46595_10158369
505 JGI25153J46596_10000021
506 JGI25153J46596_10006222
507 rootH2_10061189
508 rootH1_10279068
509 Ga0055538_1000729
510 Ga0055532_1000490
511 Ga0055525_1000012
512 Ga0055542_1000094
513 Ga0055529_1000045
514 Ga0055536_1003107
515 Ga0055536_1007731
516 Ga0055536_1047830
517 Ga0065715_10238104
518 Ga0065707_10010580
519 Ga0070658_10018031
520 Ga0070676_10337077
521 Ga0070670_100257536
522 Ga0070682_100254033
523 Ga0070660_100139110
524 Ga0070660_100863027
525 Ga0070660_100890961
526 Ga0070660_100994977
527 Ga0070689_100066521
528 Ga0070661_100014248
529 Ga0070669_100867579
530 Ga0070675_100111498
531 Ga0070675_100655644
532 Ga0070674_100003272
533 Ga0070674_100014453
534 Ga0070674_100143583
535 Ga0070673_100009151
536 Ga0070659_100161682
537 Ga0070659_100459889
538 Ga0070659_100589472
539 Ga0070667_100281088
540 Ga0070667_100991504
541 Ga0070701_10079503
542 Ga0070700_100709600
543 Ga0070694_100328030
544 Ga0070663_100396545
545 Ga0070663_100509571
546 Ga0070678_100000149
547 Ga0070678_100771642
548 Ga0070678_100833829
549 Ga0068867_100038847
550 Ga0068867_100267614
551 Ga0070698_100005242
552 Ga0070679_101405511
553 Ga0070672_100166727
554 Ga0070672_100951174
555 Ga0070686_100285611
556 Ga0070695_100099436
557 Ga0070693_100003881
558 Ga0070665_100000021
559 Ga0070665_100594023
560 Ga0068855_100298709
561 Ga0070664_100501138
562 Ga0068854_100006661
563 Ga0068854_100126720
564 Ga0068856_100121898
565 Ga0070702_100277755
566 Ga0068852_100002971
567 Ga0068852_100050318
568 Ga0068859_100016161
569 Ga0068859_100786486
570 Ga0068861_100000004
571 Ga0068861_100060663
572 Ga0068861_100459384
573 Ga0068851_10018246
574 Ga0068863_100012044
575 Ga0068863_100047629
576 Ga0068858_100091429
577 Ga0068858_100424053
578 Ga0068860_100056613
579 Ga0068860_100143279
580 Ga0068860_100311880
581 Ga0068862_100082451
582 Ga0068862_100273204
583 Ga0081455_10000431
584 Ga0070715_10570172
585 Ga0075367_10398856
586 Ga0075369_10103026
587 Ga0075366_10084487
588 Ga0097621_100803610
589 Ga0097621_100934230
590 Ga0068871_100009681
591 Ga0075430_101136538
592 Ga0075431_100570431
593 Ga0075429_100195855
594 Ga0075436_100234220
595 Ga0097620_100016161
596 Ga0097620_100786551
597 Ga0075435_100003365
598 Ga0075435_100912115
599 Ga0105251_10032877
600 Ga0105251_10191871
601 Ga0105244_10019025
602 Ga0105244_10184530
603 Ga0105250_10003183
604 Ga0105250_10018029
605 Ga0105250_10025112
606 Ga0105240_10418178
607 Ga0105245_10090931
608 Ga0105245_10416903
609 Ga0105245_11310822
610 Ga0105247_10210204
611 Ga0105243_10000512
612 Ga0105243_10129370
613 Ga0105243_11778483
614 Ga0105241_10180210
615 Ga0105241_10393422
616 Ga0105241_11030255
617 Ga0105242_10078198
618 Ga0105248_10002150
619 Ga0105248_10010555
620 Ga0105248_10013044
621 Ga0105248_10815943
622 Ga0105237_10087434
623 Ga0105237_10182631
624 Ga0105237_10259990
625 Ga0105238_11268544
626 Ga0105249_10199328
627 Ga0105249_10373239
628 Ga0105249_11588358
629 Ga0105239_10119575
630 Ga0105246_10618466
631 Ga0157371_10000032
632 Ga0157369_10359299
633 Ga0157378_11414409
634 Ga0163162_10491175
635 Ga0163162_10729818
636 Ga0163162_12982025
637 Ga0157372_10410444
638 Ga0157379_10385925
639 Ga0163161_10207610
640 Ga0214544_1011478
641 Ga0214542_1001823
642 Ga0214545_1001477
643 Ga0214543_1004144
644 Ga0213876_10156284
645 Ga0209784_100054
646 Ga0209147_100057
647 Ga0209147_100185
648 Ga0209563_100030
649 Ga0209646_1004008
650 Ga0209148_1000011
651 Ga0209455_1000006
652 Ga0209455_1009479
653 Ga0209130_1000633
654 Ga0209130_1002051
655 Ga0209130_1007551
656 Ga0209130_1016609
657 Ga0209130_1022916
658 Ga0209676_1000494
659 Ga0209676_1000649
660 Ga0209676_1006704
661 Ga0209676_1020397
662 Ga0209676_1023446
663 Ga0209676_1048516
664 Ga0209025_1000107
665 Ga0209025_1000266
666 Ga0209025_1000355
667 Ga0209025_1001564
668 Ga0209025_1002190
669 Ga0209025_1002944
670 Ga0209025_1003509
671 Ga0209025_1004192
672 Ga0209025_1004850
673 Ga0209025_1005049
674 Ga0209025_1006327
675 Ga0209025_1080211
676 Ga0209025_1103042
677 Ga0209758_1000023
678 Ga0209758_1000032
679 Ga0207656_10000615
680 Ga0207696_1005843
681 Ga0207696_1015056
682 Ga0207696_1049915
683 Ga0207655_1022342
684 Ga0207713_1032264
685 Ga0207713_1101937
686 Ga0207710_10248201
687 Ga0207680_10048178
688 Ga0207647_10011819
689 Ga0207647_10036845
690 Ga0207685_10210861
691 Ga0207645_10035604
692 Ga0207645_10079482
693 Ga0207645_10750247
694 Ga0207705_10001219
695 Ga0207654_10001636
696 Ga0207654_10171403
697 Ga0207695_10013219
698 Ga0207671_10005662
699 Ga0207671_10059958
700 Ga0207671_10172476
701 Ga0207663_10009441
702 Ga0207657_10010001
703 Ga0207649_10003922
704 Ga0207649_10895840
705 Ga0207646_10162600
706 Ga0207681_10012522
707 Ga0207694_10008848
708 Ga0207694_11128722
709 Ga0207650_10339483
710 Ga0207659_10080988
711 Ga0207659_10683967
712 Ga0207687_10032248
713 Ga0207687_10199672
714 Ga0207687_10223033
715 Ga0207644_10101469
716 Ga0207690_10016577
717 Ga0207690_10122516
718 Ga0207706_10117408
719 Ga0207706_10186655
720 Ga0207706_10260539
721 Ga0207709_10000145
722 Ga0207669_10000118
723 Ga0207669_10000784
724 Ga0207669_10065466
725 Ga0207691_10003479
726 Ga0207691_10352583
727 Ga0207711_10020723
728 Ga0207711_11283650
729 Ga0207679_10083807
730 Ga0207679_10437183
731 Ga0207667_10000002
732 Ga0207667_10591362
733 Ga0207651_10007510
734 Ga0207651_10155091
735 Ga0207651_10275454
736 Ga0207712_10051407
737 Ga0207712_10544830
738 Ga0207640_10002033
739 Ga0207640_10004441
740 Ga0207658_10423454
741 Ga0207703_10174553
742 Ga0207703_10193348
743 Ga0207703_10225730
744 Ga0207703_10514355
745 Ga0207639_10004520
746 Ga0207678_10006272
747 Ga0207678_10295100
748 Ga0207708_10042079
749 Ga0207702_10006858
750 Ga0207702_10036825
751 Ga0207641_10029948
752 Ga0207641_10103558
753 Ga0207648_10019898
754 Ga0207648_10245386
755 Ga0207674_10065996
756 Ga0207674_10981409
757 Ga0207675_100000032
758 Ga0207675_100041923
759 Ga0207675_102006141
760 Ga0207683_10000881
761 Ga0207698_10002649
762 Ga0207698_10035858
763 Ga0268266_10000015
764 Ga0268266_10021691
765 Ga0268266_10399147
766 Ga0268265_10093993
767 Ga0268265_10126892
768 Ga0268264_10038204
769 Ga0268264_10099816
770 Ga0268264_10288644
771 Ga0265338_10013206
772 Ga0237817_10031
773 Ga0237817_10037
774 Ga0265339_10125051
775 Ga0265316_10273803
776 Ga0307513_10008158
777 Ga0307509_10524162
778 Ga0307510_10077558
779 Ga0307510_10239544
780 Ga0373938_0034059
781 Ga0373949_0000141
782 Ga0373953_0023291
783 Ga0373953_0141664
784 Ga0373956_0075828
785 Ga0373956_0431494
786 Ga0373942_0252006
787 Ga0373924_0039664
788 Ga0373933_0027776
789 Ga0373937_0031146
790 Ga0373937_0902654
791 Ga0395905_0001140
792 Ga0395905_0095511
793 Ga0395905_0210745
794 Ga0395901_0653553
795 Ga0237819_00044
796 Ga0237819_00450
797 Ga0436365_0412369
798 Ga0451800_0094444
799 Ga0451833_0083082
800 Ga0439449_0075341
801 Ga0451577_0602604
802 Ga0451577_0937728
803 Ga0466972_0001182
804 Ga0453683_0154911
805 Ga0466961_0130291
806 Ga0466964_0116699
807 Ga0453684_0000007
808 Ga0453684_0010210
809 Ga0453684_0077002
810 Ga0453684_0137726
811 Ga0453684_0165355
812 Ga0453684_0223719
813 Ga0453684_0368232
814 Ga0453684_0459775
815 Ga0453684_1939661
816 Ga0466960_0033649
817 Ga0451576_0562283
818 Ga0451576_0636647
819 Ga0466967_0067505
820 Ga0495592_0436549
821 Ga0495638_0146259
822 Ga0495641_0168475
823 Ga0495650_0000302
824 Ga0495662_0516464
825 Ga0495584_0022624
826 Ga0495584_0034164
827 Ga0495585_0021537
828 Ga0495585_0023239
829 Ga0495585_0066580
830 Ga0495607_0067623
831 Ga0495583_0001345
832 Ga0495583_0005024
833 Ga0495583_0007631
834 Ga0495606_0001599
835 Ga0495606_0107631
836 Ga0495616_0015569
837 Ga0495620_0184122
838 Ga0495628_0187074
839 Ga0495631_0060236
840 Ga0495643_0000203
841 Ga0495643_0001323
842 Ga0495643_0002857
843 Ga0495643_0049889
844 Ga0495643_0158903
845 Ga0495648_0000961
846 Ga0495663_0003785
847 Ga0495663_0004208
848 Ga0495640_0389954
849 Ga0495587_0051172
850 Ga0495587_0171116
851 Ga0495598_0085902
852 Ga0495621_0051231
853 Ga0495621_0137062
854 Ga0495622_0164813
855 Ga0495633_0000770
856 Ga0495633_0102164
857 Ga0495668_0000016
858 Ga0495668_0167860
859 Ga0495668_0238633
860 Ga0495611_0005595
861 Ga0495611_0013550
862 Ga0495611_0309917
863 Ga0495625_0005534
864 Ga0495625_0014265
865 Ga0495625_0063004
866 Ga0495625_0208588
867 Ga0495625_0298972
868 Ga0495625_0461874
869 Ga0495599_0270561
870 Ga0495647_0051224
871 Ga0495658_0034225
872 Ga0495658_0434152
873 Ga0495658_0522993
874 Ga0495658_0790300
875 Ga0495669_0000050
876 Ga0495669_0007538
877 Ga0495613_0196511
878 Ga0495670_0005533
879 Ga0495670_0138698
880 Ga0495649_0072989
881 Ga0495600_0001875
882 Ga0495660_0207565
883 Ga0495636_0071386
884 Ga0495680_0226173
885 Ga0495683_0000816
886 Ga0495683_0021963
887 Ga0495687_001300
888 Ga0495687_001654
889 Ga0495677_0001776
890 Ga0495677_0142669
891 Ga0495681_0003424
892 Ga0495681_0039674
893 Ga0495602_0760877
894 Ga0496102_0005894
895 Ga0496103_0000131
896 Ga0496103_0102879
897 Ga0496104_0116940
898 Ga0496105_0001020
899 Ga0496106_0807571
900 Ga0496107_0240709
901 Ga0496107_0780004
902 Ga0496108_0406443
903 Ga0496110_0081036
904 Ga0496111_0009756
905 Ga0496112_0471832
906 Ga0496113_0014634
907 Ga0496114_0018506
908 Ga0496115_0000133
909 Ga0496116_0005419
910 Ga0496117_0002127
911 Ga0496118_0000092
912 Ga0496119_0005121
913 Ga0496120_0094557
914 Ga0496121_0013328
915 Ga0496122_0015746
916 Ga0496123_0002753
917 Ga0496124_0000081
918 Ga0496124_0002777
919 Ga0496125_0002309
920 Ga0496126_0000283
921 Ga0496126_0007418
922 Ga0495678_197449
923 nmdc:mga0k408_58101_c1
924 nmdc:mga09592_320836_c1
925 nmdc:mga0qj67_1006294_c1
926 nmdc:mga06r32_313956_c1
927 nmdc:mga0rr50_3273_c1
928 nmdc:mga0rr50_804263_c1
929 nmdc:mga08x19_232031_c1
930 nmdc:mga0sz30_247356_c1
931 Ga0500610_0000471
932 Ga0495619_0376826
933 Ga0500556_0000095
934 Ga0500593_001106
935 Ga0500595_001409
936 Ga0500595_003953
937 Ga0500559_0023316
938 Ga0500619_001400
939 Ga0500636_0004585
940 Ga0500645_000221
941 Ga0500596_001215
942 Ga0500601_051726
943 Ga0500661_068745
944 2553395547
945 2644422139
946 2644704633
947 2644709327
948 2685150124
949 2698323138
950 2705994098
951 2721505426
952 2739157937
953 2739210617
954 2739268006
955 2777839420
956 2819578793
957 2857587100
958 2918508082
959 2929235331
960 2938919508
961 2947428879
962 2965763372
963 2979085827
964 8022625673
965 8022798570
966 8023444110
967 8023449707
968 8057584918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

29

141

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bu1-assembly1.cif.gz_A crystal structure of trmo from pseudomonas aeruginosa 0.8661 1 139
7bu1-assembly1.cif.gz_B crystal structure of trmo from pseudomonas aeruginosa 0.8648 1 139
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8589 3 137
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.853 3 137
7btu-assembly1.cif.gz_A crystal structure of trmo from p. areuginosa 0.8459 1 143
ID Description Score Start End Superfamily
af_Q58978_4_126_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8567 5 135 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8559 4 137 2.40.30.70
1xqbB01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8527 1 141 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.85 4 137 2.40.30.70
af_P28634_1_140_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8485 1 129 2.40.30.70
ID Description Score Start End GO Terms
AF-C7Q1X8-F1-model_v4 TsaA-like domain-containing protein 0.9883 2 152
AF-A0A810LN61-F1-model_v4 deleted 0.9883 1 152
AF-A0A6I1ZDX3-F1-model_v4 TsaA-like domain-containing protein 0.9879 1 152
AF-A0A1M3ADH7-F1-model_v4 deleted 0.9878 1 152
AF-A0A2N3W5S7-F1-model_v4 tRNA (Thr-GGU) A37 N-methylase 0.987 1 152 GO:0008168
GO:0032259

Map