F452945

General Info

Members Datasets Scaffolds Average Seq Length
484 279 968 142

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10042070|Ga0157379_100420703
Length 167
Sequence MGGREGEWAGTAPVSASLKQAIGEAMIRRVDDRISVSPQIFPGDVGELAEAGFTMVINNRPDGEEPGQPEGASIGEAARTAGMDYVAIPVTHAGFSANQVEAMAAALARAPGPVFAYCRSGTRSCNLWALAQASTGVAPDELIVKGADAGYDLSGLRPLLETLSGKA

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
162 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
163 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
164 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
167 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
168 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
169 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
177 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
244 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
255 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
262 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
263 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
264 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
265 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
266 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
267 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
268 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
269 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
270 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
271 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
272 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
273 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
274 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
275 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
276 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
277 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
278 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
279 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 0
Isolates 3.51

Biome Distribution

Category Percentage (%)
Aerial Root 1.03
Bulb 0
Endosphere 20.45
Nodule 0
Rhizoplane 3.93
Rhizosphere 64.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10042070 3300014968 Bacteria 4078
2 2214764952 2209111006 Bacteria 821
3 ARcpr5oldR_c001975 3300000041 Bacteria 1961
4 ARcpr5yngRDRAFT_c002293 3300000043 Bacteria 1998
5 JGI24741J21665_1001037 3300001915 Bacteria 8347
6 JGI24747J21853_1006358 3300001978 Bacteria 1116
7 JGI24740J21852_10035356 3300001979 Bacteria 1563
8 JGI24740J21852_10041971 3300001979 Bacteria 1374
9 JGI24739J22299_10019515 3300001989 Bacteria 2426
10 JGI24737J22298_10018204 3300001990 Bacteria 2256
11 JGI24742J22300_10005645 3300002244 Bacteria 2057
12 JGI25150J39212_1000367 3300002774 Bacteria 21803
13 JGI25151J46595_10008355 3300003187 Bacteria 4985
14 JGI25165J46597_1000010 3300003214 Bacteria 442113
15 JGI25153J46596_10000034 3300003215 Bacteria 192215
16 JGI25153J46596_10000125 3300003215 Bacteria 86065
17 JGI25153J46596_10001909 3300003215 Bacteria 12362
18 rootH1_10055037 3300003316 Bacteria 2236
19 rootH2_10034531 3300003320 Bacteria 1430
20 rootH2_10226221 3300003320 Bacteria 1195
21 Ga0055525_1000139 3300003759 Bacteria 102623
22 Ga0055542_1000012 3300003762 Bacteria 391808
23 Ga0055529_1000004 3300003763 Bacteria 433331
24 Ga0055526_1001906 3300003771 Bacteria 14450
25 Ga0055537_1000882 3300003773 Bacteria 14287
26 Ga0055537_1040344 3300003773 Bacteria 561
27 Ga0055524_1000210 3300003775 Bacteria 62927
28 Ga0055536_1010766 3300003781 Bacteria 3584
29 Ga0055530_10000117 3300003791 Bacteria 69120
30 Ga0055530_10019040 3300003791 Bacteria 2092
31 Ga0055540_1000868 3300003792 Bacteria 20036
32 Ga0055531_10000180 3300003794 Bacteria 71821
33 Ga0055531_10003447 3300003794 Bacteria 10076
34 Ga0065165_1002232 3300005262 Bacteria 17225
35 Ga0065165_1017247 3300005262 Bacteria 2668
36 Ga0065165_1031606 3300005262 Bacteria 1671
37 Ga0065165_1043112 3300005262 Bacteria 1327
38 Ga0065165_1068411 3300005262 Bacteria 950
39 Ga0070658_10003871 3300005327 Bacteria 12276
40 Ga0070658_10730939 3300005327 Bacteria 860
41 Ga0070676_11186020 3300005328 Bacteria 580
42 Ga0070683_100244443 3300005329 Bacteria 1707
43 Ga0070670_100211613 3300005331 Bacteria 1686
44 Ga0068869_100454667 3300005334 Bacteria 1062
45 Ga0068868_100327284 3300005338 Bacteria 1307
46 Ga0070660_100038665 3300005339 Bacteria 3623
47 Ga0070660_100087301 3300005339 Bacteria 2455
48 Ga0070661_100003965 3300005344 Bacteria 10183
49 Ga0070661_100428030 3300005344 Bacteria 1050
50 Ga0070661_100531244 3300005344 Bacteria 944
51 Ga0070661_101007108 3300005344 Bacteria 691
52 Ga0070668_101686427 3300005347 Bacteria 582
53 Ga0070671_101637773 3300005355 Bacteria 571
54 Ga0070674_100000483 3300005356 Bacteria 20099
55 Ga0070674_100086878 3300005356 Bacteria 2247
56 Ga0070659_100050935 3300005366 Bacteria 3255
57 Ga0070659_100063615 3300005366 Bacteria 2919
58 Ga0070659_100117442 3300005366 Bacteria 2151
59 Ga0070667_100238940 3300005367 Bacteria 1621
60 Ga0070663_100049312 3300005455 Bacteria 2989
61 Ga0070678_100004211 3300005456 Bacteria 8124
62 Ga0070678_100108844 3300005456 Bacteria 2164
63 Ga0070678_100273225 3300005456 Bacteria 1426
64 Ga0070678_101352011 3300005456 Bacteria 664
65 Ga0070662_100115170 3300005457 Bacteria 2053
66 Ga0068867_100115551 3300005459 Bacteria 2067
67 Ga0068867_100132478 3300005459 Bacteria 1939
68 Ga0070679_101992915 3300005530 Bacteria 530
69 Ga0068853_100767331 3300005539 Bacteria 922
70 Ga0070672_100156798 3300005543 Bacteria 1886
71 Ga0070665_100000043 3300005548 Bacteria 279774
72 Ga0070665_100311406 3300005548 Bacteria 1578
73 Ga0068855_100325359 3300005563 Bacteria 1698
74 Ga0068855_100436673 3300005563 Bacteria 1430
75 Ga0068855_102128447 3300005563 Bacteria 564
76 Ga0070664_100901876 3300005564 Bacteria 829
77 Ga0068857_100048238 3300005577 Bacteria 3781
78 Ga0068857_100100095 3300005577 Bacteria 2600
79 Ga0068854_100096803 3300005578 Bacteria 2205
80 Ga0068854_100139995 3300005578 Bacteria 1856
81 Ga0068854_100750605 3300005578 Bacteria 846
82 Ga0068854_102049875 3300005578 Bacteria 528
83 Ga0068852_100319506 3300005616 Bacteria 1507
84 Ga0068852_100489233 3300005616 Bacteria 1224
85 Ga0068859_100000682 3300005617 Bacteria 34086
86 Ga0068859_101452576 3300005617 Bacteria 757
87 Ga0068864_100000218 3300005618 Bacteria 51909
88 Ga0068861_100001233 3300005719 Bacteria 15929
89 Ga0068861_100968811 3300005719 Bacteria 810
90 Ga0068851_10021055 3300005834 Bacteria 3163
91 Ga0068851_10022913 3300005834 Bacteria 3048
92 Ga0068858_100000274 3300005842 Bacteria 55319
93 Ga0068858_100000352 3300005842 Bacteria 48455
94 Ga0097621_100121999 3300006237 Bacteria 2211
95 Ga0075370_10122412 3300006353 Bacteria 1515
96 Ga0068871_100043237 3300006358 Bacteria 3619
97 Ga0068865_100082347 3300006881 Bacteria 2313
98 Ga0097620_100000682 3300006931 Bacteria 34086
99 Ga0097620_101452660 3300006931 Bacteria 757
100 Ga0105240_10159458 3300009093 Bacteria 2681
101 Ga0105245_10001591 3300009098 Bacteria 20657
102 Ga0105247_10746383 3300009101 Bacteria 741
103 Ga0105243_10001132 3300009148 Bacteria 24182
104 Ga0105243_10035358 3300009148 Bacteria 3872
105 Ga0105243_10205024 3300009148 Bacteria 1732
106 Ga0105243_10546331 3300009148 Bacteria 1106
107 Ga0105241_10025406 3300009174 Bacteria 4401
108 Ga0105242_10842927 3300009176 Bacteria 911
109 Ga0105248_10000824 3300009177 Bacteria 34827
110 Ga0105248_10007725 3300009177 Bacteria 11809
111 Ga0105248_10524296 3300009177 Bacteria 1336
112 Ga0105237_10030488 3300009545 Bacteria 5477
113 Ga0105237_10112806 3300009545 Bacteria 2711
114 Ga0105237_10181683 3300009545 Bacteria 2104
115 Ga0105238_10021033 3300009551 Bacteria 6648
116 Ga0105238_10101907 3300009551 Bacteria 2853
117 Ga0105238_11026046 3300009551 Bacteria 846
118 Ga0105239_10156374 3300010375 Bacteria 2546
119 Ga0105239_10166967 3300010375 Bacteria 2461
120 Ga0157373_10857052 3300013100 Bacteria 672
121 Ga0157373_11482274 3300013100 Bacteria 517
122 Ga0157371_10000452 3300013102 Bacteria 50337
123 Ga0157371_10106670 3300013102 Bacteria 1988
124 Ga0157370_10201818 3300013104 Bacteria 1844
125 Ga0157370_10620030 3300013104 Bacteria 990
126 Ga0157369_10199690 3300013105 Bacteria 2099
127 Ga0157369_10294973 3300013105 Bacteria 1687
128 Ga0157369_11110291 3300013105 Bacteria 808
129 Ga0157369_11551939 3300013105 Bacteria 673
130 Ga0157378_10047209 3300013297 Bacteria 3828
131 Ga0157378_10094168 3300013297 Bacteria 2727
132 Ga0157378_11856412 3300013297 Bacteria 651
133 Ga0163162_10094977 3300013306 Bacteria 3068
134 Ga0163162_10240400 3300013306 Bacteria 1942
135 Ga0163162_10302405 3300013306 Bacteria 1732
136 Ga0157372_10121806 3300013307 Bacteria 2997
137 Ga0157372_10361685 3300013307 Bacteria 1691
138 Ga0157372_10866186 3300013307 Bacteria 1048
139 Ga0163163_13104451 3300014325 Bacteria 518
140 Ga0157380_10656433 3300014326 Bacteria 1047
141 Ga0157377_11060791 3300014745 Bacteria 618
142 Ga0183363_1003 3300015690 Bacteria 421263
143 Ga0163161_10132775 3300017792 Bacteria 1879
144 Ga0163161_11286317 3300017792 Bacteria 635
145 Ga0209674_105609 3300025226 Bacteria 1822
146 Ga0209563_100070 3300025230 Bacteria 249779
147 Ga0209437_106401 3300025233 Bacteria 1962
148 Ga0207425_1000005 3300025245 Bacteria 900502
149 Ga0207425_1005496 3300025245 Bacteria 3603
150 Ga0209026_1040758 3300025250 Bacteria 673
151 Ga0209677_106606 3300025253 Bacteria 2704
152 Ga0209148_1000008 3300025254 Bacteria 1504371
153 Ga0209233_1000044 3300025261 Bacteria 489783
154 Ga0209233_1010300 3300025261 Bacteria 2808
155 Ga0209565_1000029 3300025263 Bacteria 340335
156 Ga0209565_1000052 3300025263 Bacteria 212056
157 Ga0209565_1019148 3300025263 Bacteria 1467
158 Ga0209455_1000002 3300025272 Bacteria 1505459
159 Ga0209455_1005248 3300025272 Bacteria 4049
160 Ga0209673_1000754 3300025273 Bacteria 44111
161 Ga0209675_1016418 3300025291 Bacteria 2157
162 Ga0209676_1021738 3300025292 Bacteria 2144
163 Ga0209025_1001791 3300025294 Bacteria 25501
164 Ga0209564_1000783 3300025295 Bacteria 44071
165 Ga0209564_1015450 3300025295 Bacteria 3102
166 Ga0209564_1041407 3300025295 Bacteria 1236
167 Ga0209758_1000002 3300025297 Bacteria 1400310
168 Ga0209758_1000007 3300025297 Bacteria 1270410
169 Ga0209758_1001653 3300025297 Bacteria 25273
170 Ga0209758_1027348 3300025297 Bacteria 2439
171 Ga0209050_1000001 3300025298 Bacteria 3563507
172 Ga0209050_1000131 3300025298 Bacteria 186028
173 Ga0209050_1001214 3300025298 Bacteria 30169
174 Ga0209050_1007441 3300025298 Bacteria 6136
175 Ga0209050_1023685 3300025298 Bacteria 2151
176 Ga0209050_1027964 3300025298 Bacteria 1842
177 Ga0209256_1000008 3300025299 Bacteria 975723
178 Ga0207426_1057715 3300025302 Bacteria 1129
179 Ga0209051_1000297 3300025303 Bacteria 79062
180 Ga0209257_1000028 3300025304 Bacteria 699493
181 Ga0209257_1000801 3300025304 Bacteria 45834
182 Ga0209257_1008441 3300025304 Bacteria 5855
183 Ga0209257_1018820 3300025304 Bacteria 2634
184 Ga0209257_1018821 3300025304 Bacteria 2634
185 Ga0207656_10003039 3300025321 Bacteria 5734
186 Ga0207647_10027042 3300025904 Bacteria 3744
187 Ga0207647_10209511 3300025904 Bacteria 1126
188 Ga0207645_10666246 3300025907 Bacteria 707
189 Ga0207705_10000512 3300025909 Bacteria 33029
190 Ga0207654_10001799 3300025911 Bacteria 11138
191 Ga0207695_10050658 3300025913 Bacteria 4366
192 Ga0207695_10060432 3300025913 Bacteria 3923
193 Ga0207671_10014397 3300025914 Bacteria 6253
194 Ga0207671_10031513 3300025914 Bacteria 3951
195 Ga0207657_10155420 3300025919 Bacteria 1860
196 Ga0207657_10247438 3300025919 Bacteria 1422
197 Ga0207649_10000581 3300025920 Bacteria 25005
198 Ga0207652_10472069 3300025921 Bacteria 1130
199 Ga0207681_10050109 3300025923 Bacteria 2825
200 Ga0207694_10101828 3300025924 Bacteria 2276
201 Ga0207694_10713603 3300025924 Bacteria 846
202 Ga0207694_10763156 3300025924 Bacteria 816
203 Ga0207659_11245659 3300025926 Bacteria 639
204 Ga0207687_10010108 3300025927 Bacteria 6169
205 Ga0207644_10558906 3300025931 Bacteria 948
206 Ga0207690_10000666 3300025932 Bacteria 21974
207 Ga0207690_10029320 3300025932 Bacteria 3497
208 Ga0207690_10105812 3300025932 Bacteria 2018
209 Ga0207706_10047066 3300025933 Bacteria 3817
210 Ga0207709_10000005 3300025935 Bacteria 806813
211 Ga0207709_10105650 3300025935 Bacteria 1871
212 Ga0207709_10196209 3300025935 Bacteria 1438
213 Ga0207709_10389566 3300025935 Bacteria 1062
214 Ga0207669_10000607 3300025937 Bacteria 15563
215 Ga0207669_10878970 3300025937 Bacteria 747
216 Ga0207704_10137580 3300025938 Bacteria 1703
217 Ga0207711_10013055 3300025941 Bacteria 6900
218 Ga0207711_10328448 3300025941 Bacteria 1414
219 Ga0207711_11334279 3300025941 Bacteria 660
220 Ga0207689_10529023 3300025942 Bacteria 989
221 Ga0207661_10134147 3300025944 Bacteria 2125
222 Ga0207679_10260740 3300025945 Bacteria 1478
223 Ga0207667_10000001 3300025949 Bacteria 1178522
224 Ga0207667_10090135 3300025949 Bacteria 3169
225 Ga0207651_11242778 3300025960 Bacteria 669
226 Ga0207668_10493352 3300025972 Bacteria 1052
227 Ga0207640_10003976 3300025981 Bacteria 7980
228 Ga0207640_10023159 3300025981 Bacteria 3729
229 Ga0207640_10028908 3300025981 Bacteria 3396
230 Ga0207640_10065785 3300025981 Bacteria 2420
231 Ga0207640_10352925 3300025981 Bacteria 1182
232 Ga0207658_10139584 3300025986 Bacteria 1959
233 Ga0207677_11743015 3300026023 Bacteria 578
234 Ga0207703_10001826 3300026035 Bacteria 18987
235 Ga0207639_10007166 3300026041 Bacteria 7596
236 Ga0207639_10702290 3300026041 Bacteria 938
237 Ga0207678_10014108 3300026067 Bacteria 7027
238 Ga0207678_10162048 3300026067 Bacteria 1910
239 Ga0207702_10009429 3300026078 Bacteria 8199
240 Ga0207648_10087828 3300026089 Bacteria 2714
241 Ga0207648_10131163 3300026089 Bacteria 2206
242 Ga0207676_10000169 3300026095 Bacteria 57208
243 Ga0207676_10845413 3300026095 Bacteria 895
244 Ga0207674_10007790 3300026116 Bacteria 12459
245 Ga0207674_10195341 3300026116 Bacteria 1973
246 Ga0207674_11713350 3300026116 Bacteria 596
247 Ga0207675_100000077 3300026118 Bacteria 75568
248 Ga0207675_101063197 3300026118 Bacteria 829
249 Ga0207683_10002829 3300026121 Bacteria 15160
250 Ga0207683_10417523 3300026121 Bacteria 1235
251 Ga0207698_10046963 3300026142 Bacteria 3266
252 Ga0268266_10000002 3300028379 Bacteria 3059047
253 Ga0307517_10020599 3300028786 Bacteria 8391
254 Ga0307517_10064728 3300028786 Bacteria 3394
255 Ga0307517_10093351 3300028786 Bacteria 2440
256 Ga0307513_10011763 3300031456 Bacteria 10849
257 Ga0307513_10012633 3300031456 Bacteria 10408
258 Ga0307513_10097112 3300031456 Bacteria 2982
259 Ga0307508_10000011 3300031616 Bacteria 248001
260 Ga0307413_10036577 3300031824 Bacteria 2828
261 Ga0307413_11347478 3300031824 Bacteria 626
262 Ga0307412_10000523 3300031911 Bacteria 22843
263 Ga0307412_10268733 3300031911 Bacteria 1333
264 Ga0307409_101523831 3300031995 Bacteria 696
265 Ga0307510_10000535 3300033180 Bacteria 37905
266 Ga0307510_10322422 3300033180 Bacteria 1001
267 Ga0395905_0433764 3300037471 Bacteria 1211
268 Ga0395905_0603114 3300037471 Bacteria 1000
269 Ga0436365_1179012 3300039437 Bacteria 1037
270 Ga0439436_0004924 3300041404 Bacteria 4097
271 Ga0439436_0021710 3300041404 Bacteria 1905
272 Ga0439461_0000494 3300041410 Bacteria 5687
273 Ga0439461_0009648 3300041410 Bacteria 1754
274 Ga0439466_0174820 3300041411 Bacteria 655
275 Ga0439465_0003876 3300041413 Bacteria 4880
276 Ga0439465_0007136 3300041413 Bacteria 3550
277 Ga0451787_688902 3300041441 Bacteria 756
278 Ga0451793_1479815 3300041452 Bacteria 635
279 Ga0451793_1907358 3300041452 Bacteria 749
280 Ga0451833_0200970 3300041491 Bacteria 825
281 Ga0451855_1658094 3300041511 Bacteria 827
282 Ga0451853_1252397 3300041512 Bacteria 827
283 Ga0451853_1898434 3300041512 Bacteria 555
284 Ga0439431_0007681 3300041997 Bacteria 2407
285 Ga0439431_0059390 3300041997 Bacteria 1003
286 Ga0439431_0179081 3300041997 Bacteria 611
287 Ga0439442_000994 3300042002 Bacteria 5727
288 Ga0439445_0001563 3300042004 Bacteria 4983
289 Ga0439445_0069498 3300042004 Bacteria 972
290 Ga0439432_000286 3300042006 Bacteria 18148
291 Ga0439449_0023480 3300042007 Bacteria 2306
292 Ga0439452_008215 3300042010 Bacteria 3154
293 Ga0439462_0000295 3300042015 Bacteria 9215
294 Ga0439462_0006929 3300042015 Bacteria 2829
295 Ga0439446_0025535 3300042156 Bacteria 1688
296 Ga0439446_0058046 3300042156 Bacteria 1166
297 Ga0439434_0019262 3300042435 Bacteria 2046
298 Ga0439434_0022966 3300042435 Bacteria 1876
299 Ga0451576_0427441 3300045051 Bacteria 1390
300 Ga0495617_255617 3300046452 Bacteria 539
301 Ga0495627_015112 3300046453 Bacteria 2672
302 Ga0495590_0108462 3300046457 Bacteria 990
303 Ga0495638_0000741 3300046460 Bacteria 35061
304 Ga0495638_0062533 3300046460 Bacteria 2298
305 Ga0495638_0179226 3300046460 Bacteria 1210
306 Ga0495638_0216801 3300046460 Bacteria 1072
307 Ga0495638_0339179 3300046460 Bacteria 797
308 Ga0495650_0000364 3300046471 Bacteria 79811
309 Ga0495650_0096857 3300046471 Bacteria 1113
310 Ga0495584_0104337 3300046491 Bacteria 1433
311 Ga0495585_0002083 3300046492 Bacteria 14646
312 Ga0495585_0089949 3300046492 Bacteria 1654
313 Ga0495585_0110405 3300046492 Bacteria 1463
314 Ga0495585_0309928 3300046492 Bacteria 774
315 Ga0495596_0010949 3300046500 Bacteria 3929
316 Ga0495607_0004446 3300046501 Bacteria 10302
317 Ga0495607_0069546 3300046501 Bacteria 1970
318 Ga0495583_0000311 3300046506 Bacteria 76925
319 Ga0495583_0002358 3300046506 Bacteria 16323
320 Ga0495583_0004958 3300046506 Bacteria 9239
321 Ga0495583_0019657 3300046506 Bacteria 3519
322 Ga0495583_0032927 3300046506 Bacteria 2497
323 Ga0495583_0085345 3300046506 Bacteria 1367
324 Ga0495606_0007432 3300046507 Bacteria 9812
325 Ga0495606_0130650 3300046507 Bacteria 1493
326 Ga0495606_0359260 3300046507 Bacteria 770
327 Ga0495631_0046391 3300046518 Bacteria 1910
328 Ga0495631_0125300 3300046518 Bacteria 1104
329 Ga0495632_0064791 3300046519 Bacteria 1766
330 Ga0495637_0239056 3300046520 Bacteria 656
331 Ga0495637_0278492 3300046520 Bacteria 597
332 Ga0495643_0002504 3300046522 Bacteria 14435
333 Ga0495643_0006895 3300046522 Bacteria 7397
334 Ga0495643_0021584 3300046522 Bacteria 3692
335 Ga0495643_0030846 3300046522 Bacteria 2989
336 Ga0495648_0002467 3300046524 Bacteria 17023
337 Ga0495648_0022564 3300046524 Bacteria 4329
338 Ga0495648_0081074 3300046524 Bacteria 1847
339 Ga0495648_0136988 3300046524 Bacteria 1293
340 Ga0495663_0007585 3300046525 Bacteria 3002
341 Ga0495642_0010068 3300046528 Bacteria 3620
342 Ga0495587_0091468 3300046536 Bacteria 1757
343 Ga0495597_0021751 3300046542 Bacteria 2981
344 Ga0495597_0085495 3300046542 Bacteria 1344
345 Ga0495633_0000538 3300046558 Bacteria 37829
346 Ga0495633_0214185 3300046558 Bacteria 882
347 Ga0495668_0000468 3300046616 Bacteria 51229
348 Ga0495668_0052903 3300046616 Bacteria 2246
349 Ga0495668_0117262 3300046616 Bacteria 1456
350 Ga0495611_0078787 3300046648 Bacteria 1513
351 Ga0495611_0127920 3300046648 Bacteria 1185
352 Ga0495611_0140317 3300046648 Bacteria 1128
353 Ga0495625_0000094 3300046660 Bacteria 144517
354 Ga0495625_0002092 3300046660 Bacteria 22304
355 Ga0495625_0004408 3300046660 Bacteria 13336
356 Ga0495625_0013920 3300046660 Bacteria 6441
357 Ga0495625_0058142 3300046660 Bacteria 2748
358 Ga0495625_0069936 3300046660 Bacteria 2465
359 Ga0495625_0087752 3300046660 Bacteria 2156
360 Ga0495625_0103986 3300046660 Bacteria 1947
361 Ga0495625_0382443 3300046660 Bacteria 883
362 Ga0495625_0391707 3300046660 Bacteria 870
363 Ga0495625_0505788 3300046660 Bacteria 738
364 Ga0495625_0568627 3300046660 Bacteria 684
365 Ga0495659_0134409 3300046664 Bacteria 983
366 Ga0495661_0366057 3300046665 Bacteria 707
367 Ga0495669_0000118 3300046684 Bacteria 51189
368 Ga0495670_0000016 3300046691 Bacteria 128045
369 Ga0495670_0094286 3300046691 Bacteria 1535
370 Ga0495670_0194123 3300046691 Bacteria 1074
371 Ga0495670_0257935 3300046691 Bacteria 930
372 Ga0495670_0466979 3300046691 Bacteria 684
373 Ga0495649_0281752 3300046694 Bacteria 849
374 Ga0495600_0095013 3300046809 Bacteria 1943
375 Ga0495660_0036323 3300046810 Bacteria 2749
376 Ga0495660_0251114 3300046810 Bacteria 820
377 Ga0495683_0002062 3300047323 Bacteria 12448
378 Ga0495683_0073643 3300047323 Bacteria 1675
379 Ga0495687_000436 3300047443 Bacteria 51636
380 Ga0495687_000499 3300047443 Bacteria 47300
381 Ga0495677_0008604 3300047445 Bacteria 3788
382 Ga0495677_0086351 3300047445 Bacteria 1179
383 Ga0495673_0090418 3300047469 Bacteria 1252
384 Ga0495681_0020245 3300047470 Bacteria 3613
385 Ga0495681_0067416 3300047470 Bacteria 1631
386 Ga0495681_0070647 3300047470 Bacteria 1582
387 Ga0495686_0000770 3300047472 Bacteria 42285
388 Ga0495686_0141818 3300047472 Bacteria 1417
389 Ga0495686_0194132 3300047472 Bacteria 1168
390 Ga0495615_0262377 3300048090 Bacteria 550
391 Ga0496100_0431225 3300048903 Bacteria 1008
392 Ga0496102_0000022 3300048905 Bacteria 246314
393 Ga0496102_0225611 3300048905 Bacteria 1766
394 Ga0496103_0000075 3300048906 Bacteria 114569
395 Ga0496104_0008397 3300048907 Bacteria 9180
396 Ga0496105_0007696 3300048908 Bacteria 8356
397 Ga0496106_0666866 3300048909 Bacteria 830
398 Ga0496107_0185331 3300048910 Bacteria 1546
399 Ga0496108_1192481 3300048911 Bacteria 644
400 Ga0496110_0004080 3300048913 Bacteria 11274
401 Ga0496111_0012054 3300048914 Bacteria 5845
402 Ga0496114_0015131 3300048917 Bacteria 6203
403 Ga0496115_0000384 3300048918 Bacteria 36457
404 Ga0496115_0002587 3300048918 Bacteria 12980
405 Ga0496116_0004132 3300048919 Bacteria 13988
406 Ga0496116_0109146 3300048919 Bacteria 1631
407 Ga0496117_0000439 3300048920 Bacteria 69213
408 Ga0496118_0000039 3300048921 Bacteria 305458
409 Ga0496119_0032028 3300048922 Bacteria 3511
410 Ga0496120_0026163 3300048923 Bacteria 3608
411 Ga0496121_0000123 3300048924 Bacteria 172448
412 Ga0496121_0000269 3300048924 Bacteria 108869
413 Ga0496121_0005688 3300048924 Bacteria 15848
414 Ga0496121_0669626 3300048924 Bacteria 629
415 Ga0496122_0026436 3300048925 Bacteria 5004
416 Ga0496122_0034059 3300048925 Bacteria 4176
417 Ga0496122_0434458 3300048925 Bacteria 656
418 Ga0496123_0042135 3300048926 Bacteria 3155
419 Ga0496123_0211888 3300048926 Bacteria 984
420 Ga0496123_0431213 3300048926 Bacteria 592
421 Ga0496124_0000076 3300048927 Bacteria 215767
422 Ga0496124_0002034 3300048927 Bacteria 27476
423 Ga0496124_0005038 3300048927 Bacteria 15097
424 Ga0496124_0559212 3300048927 Bacteria 753
425 Ga0496125_0021645 3300048928 Bacteria 5991
426 Ga0496125_0102259 3300048928 Bacteria 2106
427 Ga0496125_0735880 3300048928 Bacteria 519
428 Ga0496126_0001584 3300048929 Bacteria 34722
429 Ga0501033_0196851 3300049570 Bacteria 1441
430 Ga0501047_0946779 3300049581 Bacteria 674
431 Ga0501263_044485 3300049760 Bacteria 660
432 Ga0501044_0159686 3300049823 Bacteria 2232
433 nmdc:mga0k408_96648_c1 3300050493 Bacteria 1739
434 nmdc:mga07m45_634572_c1 3300050496 Bacteria 616
435 Ga0500610_0000255 3300053079 Bacteria 16041
436 Ga0500610_0440273 3300053079 Bacteria 514
437 Ga0500643_002602 3300053087 Bacteria 9155
438 Ga0500643_008252 3300053087 Bacteria 4109
439 Ga0500566_0017677 3300053094 Bacteria 4188
440 Ga0500641_0003136 3300053096 Bacteria 5852
441 Ga0500641_0069152 3300053096 Bacteria 1483
442 Ga0500562_007045 3300053108 Bacteria 2838
443 Ga0500562_039021 3300053108 Bacteria 1262
444 Ga0500595_001071 3300053119 Bacteria 15187
445 Ga0500595_007007 3300053119 Bacteria 4721
446 Ga0500595_027923 3300053119 Bacteria 1928
447 Ga0500642_0015946 3300053130 Bacteria 2841
448 Ga0500652_062903 3300053131 Bacteria 1531
449 Ga0500652_295239 3300053131 Bacteria 629
450 Ga0500658_0001088 3300053134 Bacteria 11124
451 Ga0500658_0009230 3300053134 Bacteria 3637
452 Ga0500559_0002452 3300053136 Bacteria 9597
453 Ga0500559_0066627 3300053136 Bacteria 1615
454 Ga0500559_0216852 3300053136 Bacteria 903
455 Ga0500568_0017469 3300053139 Bacteria 3167
456 Ga0500568_0025662 3300053139 Bacteria 2483
457 Ga0500588_0261558 3300053146 Bacteria 651
458 Ga0500604_0062250 3300053151 Bacteria 1174
459 Ga0500604_0187004 3300053151 Bacteria 711
460 Ga0500616_0032282 3300053153 Bacteria 2863
461 Ga0500619_113790 3300053154 Bacteria 921
462 Ga0500622_0226961 3300053156 Bacteria 834
463 Ga0500636_0004237 3300053177 Bacteria 8126
464 Ga0500645_000003 3300053730 Bacteria 305887
465 Ga0500645_000924 3300053730 Bacteria 16899
466 Ga0500596_000783 3300053735 Bacteria 6263
467 Ga0500661_033171 3300055283 Bacteria 911
468 2600202388 2599185354 Bacteria 4398675
469 2600227025 2599185359 Bacteria 4772316
470 2644127583 2643221622 Bacteria 4212502
471 2753766004 2751185897 Bacteria 5322941
472 2819715524 2818991466 Bacteria 4748179
473 2879163225 2879163058 Bacteria 4223965
474 2885432664 2885429604 Bacteria 3642894
475 2928031062 2928027323 Bacteria 4382488
476 2928529542 2928526807 Bacteria 4760224
477 2928970971 2928968154 Bacteria 4633371
478 2946790300 2946787523 Bacteria 4366789
479 2984556942 2984555340 Bacteria 4247089
480 2984568751 2984564862 Bacteria 4339992
481 2990267929 2990265787 Bacteria 3943888
482 2993359742 2993356040 Bacteria 4247105
483 2993697053 2993693658 Bacteria 4040749
484 8057105516 8057101203 Bacteria 5034064
485 Ga0157379_10042070
486 2214764952
487 ARcpr5oldR_c001975
488 ARcpr5yngRDRAFT_c002293
489 JGI24741J21665_1001037
490 JGI24747J21853_1006358
491 JGI24740J21852_10035356
492 JGI24740J21852_10041971
493 JGI24739J22299_10019515
494 JGI24737J22298_10018204
495 JGI24742J22300_10005645
496 JGI25150J39212_1000367
497 JGI25151J46595_10008355
498 JGI25165J46597_1000010
499 JGI25153J46596_10000034
500 JGI25153J46596_10000125
501 JGI25153J46596_10001909
502 rootH1_10055037
503 rootH2_10034531
504 rootH2_10226221
505 Ga0055525_1000139
506 Ga0055542_1000012
507 Ga0055529_1000004
508 Ga0055526_1001906
509 Ga0055537_1000882
510 Ga0055537_1040344
511 Ga0055524_1000210
512 Ga0055536_1010766
513 Ga0055530_10000117
514 Ga0055530_10019040
515 Ga0055540_1000868
516 Ga0055531_10000180
517 Ga0055531_10003447
518 Ga0065165_1002232
519 Ga0065165_1017247
520 Ga0065165_1031606
521 Ga0065165_1043112
522 Ga0065165_1068411
523 Ga0070658_10003871
524 Ga0070658_10730939
525 Ga0070676_11186020
526 Ga0070683_100244443
527 Ga0070670_100211613
528 Ga0068869_100454667
529 Ga0068868_100327284
530 Ga0070660_100038665
531 Ga0070660_100087301
532 Ga0070661_100003965
533 Ga0070661_100428030
534 Ga0070661_100531244
535 Ga0070661_101007108
536 Ga0070668_101686427
537 Ga0070671_101637773
538 Ga0070674_100000483
539 Ga0070674_100086878
540 Ga0070659_100050935
541 Ga0070659_100063615
542 Ga0070659_100117442
543 Ga0070667_100238940
544 Ga0070663_100049312
545 Ga0070678_100004211
546 Ga0070678_100108844
547 Ga0070678_100273225
548 Ga0070678_101352011
549 Ga0070662_100115170
550 Ga0068867_100115551
551 Ga0068867_100132478
552 Ga0070679_101992915
553 Ga0068853_100767331
554 Ga0070672_100156798
555 Ga0070665_100000043
556 Ga0070665_100311406
557 Ga0068855_100325359
558 Ga0068855_100436673
559 Ga0068855_102128447
560 Ga0070664_100901876
561 Ga0068857_100048238
562 Ga0068857_100100095
563 Ga0068854_100096803
564 Ga0068854_100139995
565 Ga0068854_100750605
566 Ga0068854_102049875
567 Ga0068852_100319506
568 Ga0068852_100489233
569 Ga0068859_100000682
570 Ga0068859_101452576
571 Ga0068864_100000218
572 Ga0068861_100001233
573 Ga0068861_100968811
574 Ga0068851_10021055
575 Ga0068851_10022913
576 Ga0068858_100000274
577 Ga0068858_100000352
578 Ga0097621_100121999
579 Ga0075370_10122412
580 Ga0068871_100043237
581 Ga0068865_100082347
582 Ga0097620_100000682
583 Ga0097620_101452660
584 Ga0105240_10159458
585 Ga0105245_10001591
586 Ga0105247_10746383
587 Ga0105243_10001132
588 Ga0105243_10035358
589 Ga0105243_10205024
590 Ga0105243_10546331
591 Ga0105241_10025406
592 Ga0105242_10842927
593 Ga0105248_10000824
594 Ga0105248_10007725
595 Ga0105248_10524296
596 Ga0105237_10030488
597 Ga0105237_10112806
598 Ga0105237_10181683
599 Ga0105238_10021033
600 Ga0105238_10101907
601 Ga0105238_11026046
602 Ga0105239_10156374
603 Ga0105239_10166967
604 Ga0157373_10857052
605 Ga0157373_11482274
606 Ga0157371_10000452
607 Ga0157371_10106670
608 Ga0157370_10201818
609 Ga0157370_10620030
610 Ga0157369_10199690
611 Ga0157369_10294973
612 Ga0157369_11110291
613 Ga0157369_11551939
614 Ga0157378_10047209
615 Ga0157378_10094168
616 Ga0157378_11856412
617 Ga0163162_10094977
618 Ga0163162_10240400
619 Ga0163162_10302405
620 Ga0157372_10121806
621 Ga0157372_10361685
622 Ga0157372_10866186
623 Ga0163163_13104451
624 Ga0157380_10656433
625 Ga0157377_11060791
626 Ga0183363_1003
627 Ga0163161_10132775
628 Ga0163161_11286317
629 Ga0209674_105609
630 Ga0209563_100070
631 Ga0209437_106401
632 Ga0207425_1000005
633 Ga0207425_1005496
634 Ga0209026_1040758
635 Ga0209677_106606
636 Ga0209148_1000008
637 Ga0209233_1000044
638 Ga0209233_1010300
639 Ga0209565_1000029
640 Ga0209565_1000052
641 Ga0209565_1019148
642 Ga0209455_1000002
643 Ga0209455_1005248
644 Ga0209673_1000754
645 Ga0209675_1016418
646 Ga0209676_1021738
647 Ga0209025_1001791
648 Ga0209564_1000783
649 Ga0209564_1015450
650 Ga0209564_1041407
651 Ga0209758_1000002
652 Ga0209758_1000007
653 Ga0209758_1001653
654 Ga0209758_1027348
655 Ga0209050_1000001
656 Ga0209050_1000131
657 Ga0209050_1001214
658 Ga0209050_1007441
659 Ga0209050_1023685
660 Ga0209050_1027964
661 Ga0209256_1000008
662 Ga0207426_1057715
663 Ga0209051_1000297
664 Ga0209257_1000028
665 Ga0209257_1000801
666 Ga0209257_1008441
667 Ga0209257_1018820
668 Ga0209257_1018821
669 Ga0207656_10003039
670 Ga0207647_10027042
671 Ga0207647_10209511
672 Ga0207645_10666246
673 Ga0207705_10000512
674 Ga0207654_10001799
675 Ga0207695_10050658
676 Ga0207695_10060432
677 Ga0207671_10014397
678 Ga0207671_10031513
679 Ga0207657_10155420
680 Ga0207657_10247438
681 Ga0207649_10000581
682 Ga0207652_10472069
683 Ga0207681_10050109
684 Ga0207694_10101828
685 Ga0207694_10713603
686 Ga0207694_10763156
687 Ga0207659_11245659
688 Ga0207687_10010108
689 Ga0207644_10558906
690 Ga0207690_10000666
691 Ga0207690_10029320
692 Ga0207690_10105812
693 Ga0207706_10047066
694 Ga0207709_10000005
695 Ga0207709_10105650
696 Ga0207709_10196209
697 Ga0207709_10389566
698 Ga0207669_10000607
699 Ga0207669_10878970
700 Ga0207704_10137580
701 Ga0207711_10013055
702 Ga0207711_10328448
703 Ga0207711_11334279
704 Ga0207689_10529023
705 Ga0207661_10134147
706 Ga0207679_10260740
707 Ga0207667_10000001
708 Ga0207667_10090135
709 Ga0207651_11242778
710 Ga0207668_10493352
711 Ga0207640_10003976
712 Ga0207640_10023159
713 Ga0207640_10028908
714 Ga0207640_10065785
715 Ga0207640_10352925
716 Ga0207658_10139584
717 Ga0207677_11743015
718 Ga0207703_10001826
719 Ga0207639_10007166
720 Ga0207639_10702290
721 Ga0207678_10014108
722 Ga0207678_10162048
723 Ga0207702_10009429
724 Ga0207648_10087828
725 Ga0207648_10131163
726 Ga0207676_10000169
727 Ga0207676_10845413
728 Ga0207674_10007790
729 Ga0207674_10195341
730 Ga0207674_11713350
731 Ga0207675_100000077
732 Ga0207675_101063197
733 Ga0207683_10002829
734 Ga0207683_10417523
735 Ga0207698_10046963
736 Ga0268266_10000002
737 Ga0307517_10020599
738 Ga0307517_10064728
739 Ga0307517_10093351
740 Ga0307513_10011763
741 Ga0307513_10012633
742 Ga0307513_10097112
743 Ga0307508_10000011
744 Ga0307413_10036577
745 Ga0307413_11347478
746 Ga0307412_10000523
747 Ga0307412_10268733
748 Ga0307409_101523831
749 Ga0307510_10000535
750 Ga0307510_10322422
751 Ga0395905_0433764
752 Ga0395905_0603114
753 Ga0436365_1179012
754 Ga0439436_0004924
755 Ga0439436_0021710
756 Ga0439461_0000494
757 Ga0439461_0009648
758 Ga0439466_0174820
759 Ga0439465_0003876
760 Ga0439465_0007136
761 Ga0451787_688902
762 Ga0451793_1479815
763 Ga0451793_1907358
764 Ga0451833_0200970
765 Ga0451855_1658094
766 Ga0451853_1252397
767 Ga0451853_1898434
768 Ga0439431_0007681
769 Ga0439431_0059390
770 Ga0439431_0179081
771 Ga0439442_000994
772 Ga0439445_0001563
773 Ga0439445_0069498
774 Ga0439432_000286
775 Ga0439449_0023480
776 Ga0439452_008215
777 Ga0439462_0000295
778 Ga0439462_0006929
779 Ga0439446_0025535
780 Ga0439446_0058046
781 Ga0439434_0019262
782 Ga0439434_0022966
783 Ga0451576_0427441
784 Ga0495617_255617
785 Ga0495627_015112
786 Ga0495590_0108462
787 Ga0495638_0000741
788 Ga0495638_0062533
789 Ga0495638_0179226
790 Ga0495638_0216801
791 Ga0495638_0339179
792 Ga0495650_0000364
793 Ga0495650_0096857
794 Ga0495584_0104337
795 Ga0495585_0002083
796 Ga0495585_0089949
797 Ga0495585_0110405
798 Ga0495585_0309928
799 Ga0495596_0010949
800 Ga0495607_0004446
801 Ga0495607_0069546
802 Ga0495583_0000311
803 Ga0495583_0002358
804 Ga0495583_0004958
805 Ga0495583_0019657
806 Ga0495583_0032927
807 Ga0495583_0085345
808 Ga0495606_0007432
809 Ga0495606_0130650
810 Ga0495606_0359260
811 Ga0495631_0046391
812 Ga0495631_0125300
813 Ga0495632_0064791
814 Ga0495637_0239056
815 Ga0495637_0278492
816 Ga0495643_0002504
817 Ga0495643_0006895
818 Ga0495643_0021584
819 Ga0495643_0030846
820 Ga0495648_0002467
821 Ga0495648_0022564
822 Ga0495648_0081074
823 Ga0495648_0136988
824 Ga0495663_0007585
825 Ga0495642_0010068
826 Ga0495587_0091468
827 Ga0495597_0021751
828 Ga0495597_0085495
829 Ga0495633_0000538
830 Ga0495633_0214185
831 Ga0495668_0000468
832 Ga0495668_0052903
833 Ga0495668_0117262
834 Ga0495611_0078787
835 Ga0495611_0127920
836 Ga0495611_0140317
837 Ga0495625_0000094
838 Ga0495625_0002092
839 Ga0495625_0004408
840 Ga0495625_0013920
841 Ga0495625_0058142
842 Ga0495625_0069936
843 Ga0495625_0087752
844 Ga0495625_0103986
845 Ga0495625_0382443
846 Ga0495625_0391707
847 Ga0495625_0505788
848 Ga0495625_0568627
849 Ga0495659_0134409
850 Ga0495661_0366057
851 Ga0495669_0000118
852 Ga0495670_0000016
853 Ga0495670_0094286
854 Ga0495670_0194123
855 Ga0495670_0257935
856 Ga0495670_0466979
857 Ga0495649_0281752
858 Ga0495600_0095013
859 Ga0495660_0036323
860 Ga0495660_0251114
861 Ga0495683_0002062
862 Ga0495683_0073643
863 Ga0495687_000436
864 Ga0495687_000499
865 Ga0495677_0008604
866 Ga0495677_0086351
867 Ga0495673_0090418
868 Ga0495681_0020245
869 Ga0495681_0067416
870 Ga0495681_0070647
871 Ga0495686_0000770
872 Ga0495686_0141818
873 Ga0495686_0194132
874 Ga0495615_0262377
875 Ga0496100_0431225
876 Ga0496102_0000022
877 Ga0496102_0225611
878 Ga0496103_0000075
879 Ga0496104_0008397
880 Ga0496105_0007696
881 Ga0496106_0666866
882 Ga0496107_0185331
883 Ga0496108_1192481
884 Ga0496110_0004080
885 Ga0496111_0012054
886 Ga0496114_0015131
887 Ga0496115_0000384
888 Ga0496115_0002587
889 Ga0496116_0004132
890 Ga0496116_0109146
891 Ga0496117_0000439
892 Ga0496118_0000039
893 Ga0496119_0032028
894 Ga0496120_0026163
895 Ga0496121_0000123
896 Ga0496121_0000269
897 Ga0496121_0005688
898 Ga0496121_0669626
899 Ga0496122_0026436
900 Ga0496122_0034059
901 Ga0496122_0434458
902 Ga0496123_0042135
903 Ga0496123_0211888
904 Ga0496123_0431213
905 Ga0496124_0000076
906 Ga0496124_0002034
907 Ga0496124_0005038
908 Ga0496124_0559212
909 Ga0496125_0021645
910 Ga0496125_0102259
911 Ga0496125_0735880
912 Ga0496126_0001584
913 Ga0501033_0196851
914 Ga0501047_0946779
915 Ga0501263_044485
916 Ga0501044_0159686
917 nmdc:mga0k408_96648_c1
918 nmdc:mga07m45_634572_c1
919 Ga0500610_0000255
920 Ga0500610_0440273
921 Ga0500643_002602
922 Ga0500643_008252
923 Ga0500566_0017677
924 Ga0500641_0003136
925 Ga0500641_0069152
926 Ga0500562_007045
927 Ga0500562_039021
928 Ga0500595_001071
929 Ga0500595_007007
930 Ga0500595_027923
931 Ga0500642_0015946
932 Ga0500652_062903
933 Ga0500652_295239
934 Ga0500658_0001088
935 Ga0500658_0009230
936 Ga0500559_0002452
937 Ga0500559_0066627
938 Ga0500559_0216852
939 Ga0500568_0017469
940 Ga0500568_0025662
941 Ga0500588_0261558
942 Ga0500604_0062250
943 Ga0500604_0187004
944 Ga0500616_0032282
945 Ga0500619_113790
946 Ga0500622_0226961
947 Ga0500636_0004237
948 Ga0500645_000003
949 Ga0500645_000924
950 Ga0500596_000783
951 Ga0500661_033171
952 2600202388
953 2600227025
954 2644127583
955 2753766004
956 2819715524
957 2879163225
958 2885432664
959 2928031062
960 2928529542
961 2928970971
962 2946790300
963 2984556942
964 2984568751
965 2990267929
966 2993359742
967 2993697053
968 8057105516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04273

BLH_phosphatase

Beta-lactamase hydrolase-like protein, phosphatase-like domain

26

135

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f46-assembly2.cif.gz_B crystal structure of a putative phosphatase (nma1982) from neisseria meningitidis z2491 at 1.41 a resolution 0.8502 2 138
2i6i-assembly1.cif.gz_A crystal structures of the archaeal sulfolobus ptp-fold phosphatase 0.8008 3 140
3f81-assembly1.cif.gz_A interaction of vhr with sa3 0.7843 2 141
4kyq-assembly1.cif.gz_A structure of a product bound plant phosphatase 0.783 1 135
2i6i-assembly1.cif.gz_A crystal structures of the archaeal sulfolobus ptp-fold phosphatase 0.7764 3 140
ID Description Score Start End Superfamily
2f46B00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8462 1 138 3.90.190.10
2f46B00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.825 1 138 3.90.190.10
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8107 7 141 3.90.190.10
af_Q9UAX0_81_234_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7914 11 139 3.90.190.10
af_A0A0R4IVA4_191_359_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7881 2 140 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A1V2ETE1-F1-model_v4 Beta-lactamase hydrolase-like protein (EC 3.-.-.-) 0.9936 2 139 GO:0016787
AF-A0A1S1H8K8-F1-model_v4 Beta-lactamase hydrolase-like protein (EC 3.-.-.-) 0.9916 1 134 GO:0016787
AF-A0A3D2LKG1-F1-model_v4 deleted 0.9889 1 106
AF-A0A520HMF0-F1-model_v4 TIGR01244 family phosphatase 0.9888 1 124 GO:0016787
AF-A0A4R0PIV2-F1-model_v4 TIGR01244 family phosphatase 0.9863 2 106 GO:0016787

Map