F452953

General Info

Members Datasets Scaffolds Average Seq Length
484 222 968 471

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10169939|Ga0207698_101699392
Length 513
Sequence VKHAAELGAHTFGFVWSQDVVSTLEALAGAGFRLFQVLASPPHVDPFACPPAQRRRIRDVVAGCGGRIASVDLAASYYERIEQLNPRLNVYLSLTKDRALEHAAEVDATAAKGDPLPPLAGIPVGIKDVLVMRGAPSTAGSKILQGYEPPYDATVVSKLEAAGAVLLGKLNCDEFAMGSSNENSAYGPVLNPVDTGRVPGMAVATLGTDTGGSIRQPASFCGVVGVLPTYGRVSRYGLIAFASSLDRVGPFAANVRDAATMLGVIAGHDPMDATSSPVPVPDYAAESDKPVEGLRIGVPAEYFGEGLDPEVRANIEHGIGILKSAGCMVKPISLPHTRYAIPTYYLVATAEASANLARFDGVRYGYRSPASDTLSAMYSHSRDEGFGAEVKRRILLGTYALSAGYYDAYYLKAQQVRRLLAEEFIRMFAEVDAIVTPTAPTPAFKLGEKTGDPLAMYLADIYTVTASLAGICGVTVPCGTTRTGLPVGMQVLAAHMNEGTAFRVARAVEAGQK

Samples

Sample ID Description Type Environment
1 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 3.93
Rhizosphere 93.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207698_10169939 3300026142 Bacteria 1918
2 rootH2_10033281 3300003320 Bacteria 7193
3 Ga0070658_10000101 3300005327 Bacteria 75550
4 Ga0070658_10016181 3300005327 Bacteria 5966
5 Ga0070658_10018010 3300005327 Bacteria 5649
6 Ga0070683_100006870 3300005329 Bacteria 9563
7 Ga0070683_100009696 3300005329 Bacteria 8243
8 Ga0070683_100048922 3300005329 Bacteria 3909
9 Ga0068869_100001206 3300005334 Bacteria 15200
10 Ga0070666_10015665 3300005335 Bacteria 4839
11 Ga0070680_100071499 3300005336 Bacteria 2851
12 Ga0070680_100096035 3300005336 Bacteria 2457
13 Ga0068868_100013750 3300005338 Bacteria 5946
14 Ga0068868_100029154 3300005338 Bacteria 4226
15 Ga0068868_100031339 3300005338 Bacteria 4083
16 Ga0070660_100004584 3300005339 Bacteria 9551
17 Ga0070660_100105792 3300005339 Bacteria 2234
18 Ga0070661_100008544 3300005344 Bacteria 7081
19 Ga0070661_100023533 3300005344 Bacteria 4416
20 Ga0070671_100000235 3300005355 Bacteria 37235
21 Ga0070671_100001212 3300005355 Bacteria 19302
22 Ga0070671_100016792 3300005355 Bacteria 5920
23 Ga0070659_100001286 3300005366 Bacteria 18206
24 Ga0070659_100024272 3300005366 Bacteria 4647
25 Ga0070667_100017390 3300005367 Bacteria 5959
26 Ga0070667_100095609 3300005367 Bacteria 2562
27 Ga0070708_100008934 3300005445 Bacteria 8070
28 Ga0070663_100006615 3300005455 Bacteria 6986
29 Ga0070681_10065990 3300005458 Bacteria 3588
30 Ga0070681_10160006 3300005458 Bacteria 2175
31 Ga0068867_100097470 3300005459 Bacteria 2240
32 Ga0070706_100001749 3300005467 Bacteria 22543
33 Ga0070707_100153770 3300005468 Bacteria 2240
34 Ga0070684_100008565 3300005535 Bacteria 8007
35 Ga0070684_100256572 3300005535 Bacteria 1599
36 Ga0070697_100001488 3300005536 Bacteria 17819
37 Ga0068853_100000176 3300005539 Bacteria 44619
38 Ga0068853_100000912 3300005539 Bacteria 20646
39 Ga0068853_100068197 3300005539 Bacteria 3092
40 Ga0068853_100077211 3300005539 Bacteria 2909
41 Ga0070665_100022144 3300005548 Bacteria 6392
42 Ga0070665_100118489 3300005548 Bacteria 2650
43 Ga0068855_100001117 3300005563 Bacteria 33353
44 Ga0068855_100002330 3300005563 Bacteria 23450
45 Ga0068855_100003821 3300005563 Bacteria 18410
46 Ga0068855_100006977 3300005563 Bacteria 13713
47 Ga0068855_100007326 3300005563 Bacteria 13369
48 Ga0068855_100017028 3300005563 Bacteria 8743
49 Ga0068855_100038607 3300005563 Bacteria 5673
50 Ga0068855_100160641 3300005563 Bacteria 2551
51 Ga0068857_100002783 3300005577 Bacteria 14382
52 Ga0068857_100006312 3300005577 Bacteria 10148
53 Ga0068857_100081371 3300005577 Bacteria 2892
54 Ga0068854_100000019 3300005578 Bacteria 134145
55 Ga0068854_100079099 3300005578 Bacteria 2424
56 Ga0068854_100134345 3300005578 Bacteria 1892
57 Ga0068856_100005068 3300005614 Bacteria 13039
58 Ga0068856_100125656 3300005614 Bacteria 2568
59 Ga0068852_100000041 3300005616 Bacteria 92967
60 Ga0068852_100000338 3300005616 Bacteria 31806
61 Ga0068852_100047619 3300005616 Bacteria 3658
62 Ga0068852_100122451 3300005616 Bacteria 2384
63 Ga0068852_100129548 3300005616 Bacteria 2321
64 Ga0068859_100007032 3300005617 Bacteria 11425
65 Ga0068859_100087006 3300005617 Bacteria 3172
66 Ga0068864_100004120 3300005618 Bacteria 11930
67 Ga0068864_100013848 3300005618 Bacteria 6683
68 Ga0068866_10032413 3300005718 Bacteria 2526
69 Ga0068861_100072563 3300005719 Bacteria 2671
70 Ga0068851_10002984 3300005834 Bacteria 7475
71 Ga0068863_100003622 3300005841 Bacteria 15251
72 Ga0068858_100014464 3300005842 Bacteria 7436
73 Ga0068858_100226340 3300005842 Bacteria 1772
74 Ga0068860_100006785 3300005843 Bacteria 11476
75 Ga0068860_100076201 3300005843 Bacteria 3190
76 Ga0081455_10010679 3300005937 Bacteria 9288
77 Ga0070717_10006261 3300006028 Bacteria 8740
78 Ga0070717_10073518 3300006028 Bacteria 2857
79 Ga0097621_100000431 3300006237 Bacteria 29219
80 Ga0097621_100003942 3300006237 Bacteria 10281
81 Ga0097621_100005247 3300006237 Bacteria 9116
82 Ga0068871_100007776 3300006358 Bacteria 7676
83 Ga0068871_100026598 3300006358 Bacteria 4517
84 Ga0075431_100020179 3300006847 Bacteria 6806
85 Ga0075433_10045883 3300006852 Bacteria 3799
86 Ga0075434_100009362 3300006871 Bacteria 9132
87 Ga0075434_100032972 3300006871 Bacteria 5109
88 Ga0075429_100037311 3300006880 Bacteria 4230
89 Ga0097620_100007033 3300006931 Bacteria 11425
90 Ga0097620_100087006 3300006931 Bacteria 3172
91 Ga0105240_10000001 3300009093 Bacteria 2887840
92 Ga0105240_10000251 3300009093 Bacteria 106709
93 Ga0105240_10002247 3300009093 Bacteria 31362
94 Ga0105240_10003247 3300009093 Bacteria 25446
95 Ga0105240_10004439 3300009093 Bacteria 21395
96 Ga0105240_10009662 3300009093 Bacteria 13635
97 Ga0105240_10012023 3300009093 Bacteria 12000
98 Ga0105240_10014820 3300009093 Bacteria 10625
99 Ga0105240_10028134 3300009093 Bacteria 7348
100 Ga0105240_10079375 3300009093 Bacteria 4038
101 Ga0105240_10094351 3300009093 Bacteria 3650
102 Ga0105240_10116044 3300009093 Bacteria 3231
103 Ga0105240_10319098 3300009093 Bacteria 1771
104 Ga0105245_10001223 3300009098 Bacteria 23189
105 Ga0105245_10022781 3300009098 Bacteria 5497
106 Ga0105243_10038287 3300009148 Bacteria 3734
107 Ga0105241_10000259 3300009174 Bacteria 39609
108 Ga0105241_10000458 3300009174 Bacteria 30746
109 Ga0105241_10002080 3300009174 Bacteria 15115
110 Ga0105241_10003509 3300009174 Bacteria 11668
111 Ga0105241_10026834 3300009174 Bacteria 4287
112 Ga0105241_10119799 3300009174 Bacteria 2118
113 Ga0105248_10000003 3300009177 Bacteria 1019601
114 Ga0105248_10000639 3300009177 Bacteria 39796
115 Ga0105248_10011582 3300009177 Bacteria 9713
116 Ga0105248_10013518 3300009177 Bacteria 8986
117 Ga0105248_10089222 3300009177 Bacteria 3470
118 Ga0105237_10012532 3300009545 Bacteria 8930
119 Ga0105237_10013833 3300009545 Bacteria 8448
120 Ga0105237_10076180 3300009545 Bacteria 3345
121 Ga0105238_10001587 3300009551 Bacteria 22750
122 Ga0105238_10003727 3300009551 Bacteria 15156
123 Ga0105238_10005042 3300009551 Bacteria 13057
124 Ga0105238_10011748 3300009551 Bacteria 8826
125 Ga0105238_10025365 3300009551 Bacteria 6043
126 Ga0105238_10027097 3300009551 Bacteria 5841
127 Ga0105238_10034266 3300009551 Bacteria 5166
128 Ga0105238_10046566 3300009551 Bacteria 4375
129 Ga0105249_10024390 3300009553 Bacteria 5435
130 Ga0105249_10154245 3300009553 Bacteria 2214
131 Ga0105239_10005701 3300010375 Bacteria 14541
132 Ga0105239_10019794 3300010375 Bacteria 7428
133 Ga0105239_10030708 3300010375 Bacteria 5910
134 Ga0105246_10011258 3300011119 Bacteria 5548
135 Ga0157370_10000003 3300013104 Bacteria 367417
136 Ga0157370_10008814 3300013104 Bacteria 10840
137 Ga0157370_10018054 3300013104 Bacteria 7100
138 Ga0157370_10019232 3300013104 Bacteria 6860
139 Ga0157370_10065273 3300013104 Bacteria 3444
140 Ga0157370_10117578 3300013104 Bacteria 2483
141 Ga0157370_10186695 3300013104 Bacteria 1925
142 Ga0157369_10000094 3300013105 Bacteria 122205
143 Ga0157369_10001914 3300013105 Bacteria 25108
144 Ga0157369_10004449 3300013105 Bacteria 16511
145 Ga0157369_10005464 3300013105 Bacteria 14768
146 Ga0157369_10006412 3300013105 Bacteria 13641
147 Ga0157369_10009603 3300013105 Bacteria 11064
148 Ga0157369_10013036 3300013105 Bacteria 9415
149 Ga0157369_10018945 3300013105 Bacteria 7710
150 Ga0157369_10020243 3300013105 Bacteria 7438
151 Ga0157369_10026019 3300013105 Bacteria 6493
152 Ga0157369_10076362 3300013105 Bacteria 3591
153 Ga0157369_10098336 3300013105 Bacteria 3121
154 Ga0157369_10111837 3300013105 Bacteria 2903
155 Ga0157374_10001112 3300013296 Bacteria 23158
156 Ga0157374_10001439 3300013296 Bacteria 20113
157 Ga0157374_10014101 3300013296 Bacteria 6987
158 Ga0157374_10021624 3300013296 Bacteria 5728
159 Ga0157374_10067036 3300013296 Bacteria 3373
160 Ga0157374_10128877 3300013296 Bacteria 2447
161 Ga0157378_10001618 3300013297 Bacteria 20368
162 Ga0157378_10037375 3300013297 Bacteria 4300
163 Ga0157378_10096447 3300013297 Bacteria 2695
164 Ga0163162_10003588 3300013306 Bacteria 14852
165 Ga0163162_10008603 3300013306 Bacteria 9948
166 Ga0163162_10026765 3300013306 Bacteria 5702
167 Ga0163162_10079070 3300013306 Bacteria 3355
168 Ga0157372_10000074 3300013307 Bacteria 106584
169 Ga0157372_10003222 3300013307 Bacteria 17619
170 Ga0157372_10009997 3300013307 Bacteria 10091
171 Ga0157372_10012297 3300013307 Bacteria 9120
172 Ga0157372_10016588 3300013307 Bacteria 7903
173 Ga0157372_10041524 3300013307 Bacteria 5087
174 Ga0157372_10064349 3300013307 Bacteria 4115
175 Ga0157372_10114110 3300013307 Bacteria 3097
176 Ga0157372_10117059 3300013307 Bacteria 3056
177 Ga0157372_10341229 3300013307 Bacteria 1745
178 Ga0157375_10007374 3300013308 Bacteria 9627
179 Ga0157375_10088503 3300013308 Bacteria 3151
180 Ga0157375_10203218 3300013308 Bacteria 2137
181 Ga0163163_10002120 3300014325 Bacteria 16743
182 Ga0163163_10006725 3300014325 Bacteria 10078
183 Ga0163163_10008582 3300014325 Bacteria 9083
184 Ga0163163_10121686 3300014325 Bacteria 2644
185 Ga0157380_10012980 3300014326 Bacteria 6056
186 Ga0157379_10003213 3300014968 Bacteria 13849
187 Ga0157379_10032341 3300014968 Bacteria 4664
188 Ga0157379_10140398 3300014968 Bacteria 2178
189 Ga0157379_10178022 3300014968 Bacteria 1921
190 Ga0157376_10107844 3300014969 Bacteria 2445
191 Ga0157376_10274379 3300014969 Bacteria 1585
192 Ga0213872_10000315 3300021361 Bacteria 41197
193 Ga0209233_1004548 3300025261 Bacteria 4701
194 Ga0207656_10027950 3300025321 Bacteria 2311
195 Ga0207710_10003278 3300025900 Bacteria 7233
196 Ga0207647_10000811 3300025904 Bacteria 24230
197 Ga0207647_10021282 3300025904 Bacteria 4332
198 Ga0207705_10000109 3300025909 Bacteria 93256
199 Ga0207705_10015262 3300025909 Bacteria 5516
200 Ga0207705_10018509 3300025909 Bacteria 4980
201 Ga0207705_10034797 3300025909 Bacteria 3602
202 Ga0207705_10043952 3300025909 Bacteria 3210
203 Ga0207684_10009632 3300025910 Bacteria 8522
204 Ga0207654_10000229 3300025911 Bacteria 34372
205 Ga0207654_10000490 3300025911 Bacteria 22658
206 Ga0207654_10015746 3300025911 Bacteria 3930
207 Ga0207695_10000001 3300025913 Bacteria 2888630
208 Ga0207695_10000129 3300025913 Bacteria 225939
209 Ga0207695_10000194 3300025913 Bacteria 171422
210 Ga0207695_10000263 3300025913 Bacteria 132894
211 Ga0207695_10000428 3300025913 Bacteria 93076
212 Ga0207695_10006198 3300025913 Bacteria 15587
213 Ga0207695_10026639 3300025913 Bacteria 6451
214 Ga0207695_10028193 3300025913 Bacteria 6234
215 Ga0207695_10037309 3300025913 Bacteria 5244
216 Ga0207695_10085814 3300025913 Bacteria 3176
217 Ga0207695_10188942 3300025913 Bacteria 1978
218 Ga0207671_10003735 3300025914 Bacteria 15004
219 Ga0207671_10008200 3300025914 Bacteria 8903
220 Ga0207657_10026422 3300025919 Bacteria 5337
221 Ga0207657_10036348 3300025919 Bacteria 4409
222 Ga0207657_10109308 3300025919 Bacteria 2285
223 Ga0207652_10001776 3300025921 Bacteria 18778
224 Ga0207652_10108643 3300025921 Bacteria 2458
225 Ga0207652_10133250 3300025921 Bacteria 2217
226 Ga0207694_10000036 3300025924 Bacteria 194034
227 Ga0207694_10000749 3300025924 Bacteria 29171
228 Ga0207694_10002282 3300025924 Bacteria 15696
229 Ga0207694_10035178 3300025924 Bacteria 3842
230 Ga0207694_10159084 3300025924 Bacteria 1824
231 Ga0207650_10025866 3300025925 Bacteria 4183
232 Ga0207650_10098537 3300025925 Bacteria 2246
233 Ga0207687_10016331 3300025927 Bacteria 4874
234 Ga0207644_10001784 3300025931 Bacteria 13929
235 Ga0207644_10003780 3300025931 Bacteria 9806
236 Ga0207644_10011501 3300025931 Bacteria 5857
237 Ga0207690_10016176 3300025932 Bacteria 4535
238 Ga0207690_10019293 3300025932 Bacteria 4196
239 Ga0207706_10001880 3300025933 Bacteria 20583
240 Ga0207691_10006364 3300025940 Bacteria 11408
241 Ga0207711_10000013 3300025941 Bacteria 514850
242 Ga0207711_10005835 3300025941 Bacteria 10401
243 Ga0207711_10090756 3300025941 Bacteria 2686
244 Ga0207711_10102105 3300025941 Bacteria 2538
245 Ga0207711_10267166 3300025941 Bacteria 1573
246 Ga0207689_10001455 3300025942 Bacteria 22661
247 Ga0207689_10038719 3300025942 Bacteria 3947
248 Ga0207661_10005737 3300025944 Bacteria 8759
249 Ga0207661_10030746 3300025944 Bacteria 4139
250 Ga0207661_10035604 3300025944 Bacteria 3881
251 Ga0207667_10001622 3300025949 Bacteria 28296
252 Ga0207667_10003825 3300025949 Bacteria 18507
253 Ga0207667_10003877 3300025949 Bacteria 18393
254 Ga0207667_10007018 3300025949 Bacteria 13604
255 Ga0207667_10009690 3300025949 Bacteria 11331
256 Ga0207667_10018384 3300025949 Bacteria 7840
257 Ga0207667_10065243 3300025949 Bacteria 3798
258 Ga0207667_10080176 3300025949 Bacteria 3382
259 Ga0207667_10174954 3300025949 Bacteria 2206
260 Ga0207667_10306263 3300025949 Bacteria 1623
261 Ga0207712_10012352 3300025961 Bacteria 5455
262 Ga0207640_10000028 3300025981 Bacteria 135727
263 Ga0207640_10188603 3300025981 Bacteria 1552
264 Ga0207677_10029239 3300026023 Bacteria 3498
265 Ga0207677_10039222 3300026023 Bacteria 3112
266 Ga0207639_10000049 3300026041 Bacteria 124603
267 Ga0207639_10000094 3300026041 Bacteria 74921
268 Ga0207639_10012641 3300026041 Bacteria 5885
269 Ga0207678_10001052 3300026067 Bacteria 25258
270 Ga0207678_10033926 3300026067 Bacteria 4446
271 Ga0207702_10005190 3300026078 Bacteria 11452
272 Ga0207702_10046406 3300026078 Bacteria 3657
273 Ga0207702_10088920 3300026078 Bacteria 2700
274 Ga0207641_10005842 3300026088 Bacteria 10443
275 Ga0207676_10006227 3300026095 Bacteria 8424
276 Ga0207676_10008548 3300026095 Bacteria 7277
277 Ga0207676_10124742 3300026095 Bacteria 2179
278 Ga0207674_10004432 3300026116 Bacteria 16877
279 Ga0207674_10009962 3300026116 Bacteria 10814
280 Ga0207674_10016370 3300026116 Bacteria 8120
281 Ga0207683_10001144 3300026121 Bacteria 24107
282 Ga0207698_10000017 3300026142 Bacteria 178846
283 Ga0207698_10000037 3300026142 Bacteria 103991
284 Ga0207698_10014760 3300026142 Bacteria 5206
285 Ga0207698_10029357 3300026142 Bacteria 3938
286 Ga0268266_10001982 3300028379 Bacteria 22957
287 Ga0268266_10024843 3300028379 Bacteria 5098
288 Ga0268266_10043681 3300028379 Bacteria 3831
289 Ga0268266_10094940 3300028379 Bacteria 2619
290 Ga0268266_10122836 3300028379 Bacteria 2312
291 Ga0268264_10001478 3300028381 Bacteria 21925
292 Ga0265318_10042503 3300028577 Bacteria 1724
293 Ga0265338_10001002 3300028800 Bacteria 47431
294 Ga0265338_10008925 3300028800 Bacteria 12066
295 Ga0265338_10033116 3300028800 Bacteria 5023
296 Ga0265338_10044107 3300028800 Bacteria 4123
297 Ga0265338_10094883 3300028800 Bacteria 2453
298 Ga0265330_10004955 3300031235 Bacteria 6704
299 Ga0265330_10005509 3300031235 Bacteria 6310
300 Ga0265330_10007824 3300031235 Bacteria 5185
301 Ga0265332_10014466 3300031238 Bacteria 3491
302 Ga0265328_10017154 3300031239 Bacteria 2808
303 Ga0265325_10001870 3300031241 Bacteria 14530
304 Ga0265325_10008972 3300031241 Bacteria 5872
305 Ga0265325_10015752 3300031241 Bacteria 4242
306 Ga0265325_10038597 3300031241 Bacteria 2520
307 Ga0265329_10021878 3300031242 Bacteria 2143
308 Ga0265340_10008321 3300031247 Bacteria 5604
309 Ga0265340_10017409 3300031247 Bacteria 3718
310 Ga0265340_10021649 3300031247 Bacteria 3296
311 Ga0265339_10000031 3300031249 Bacteria 133838
312 Ga0265339_10003764 3300031249 Bacteria 10576
313 Ga0265339_10017271 3300031249 Bacteria 4277
314 Ga0265339_10023013 3300031249 Bacteria 3604
315 Ga0265339_10045400 3300031249 Bacteria 2418
316 Ga0265331_10039611 3300031250 Bacteria 2297
317 Ga0265316_10001845 3300031344 Bacteria 22273
318 Ga0265316_10004137 3300031344 Bacteria 14519
319 Ga0265316_10015742 3300031344 Bacteria 6599
320 Ga0265316_10016178 3300031344 Bacteria 6483
321 Ga0265316_10017868 3300031344 Bacteria 6113
322 Ga0265316_10051787 3300031344 Bacteria 3223
323 Ga0265316_10052720 3300031344 Bacteria 3190
324 Ga0265316_10060927 3300031344 Bacteria 2932
325 Ga0307513_10003296 3300031456 Bacteria 21988
326 Ga0265313_10003041 3300031595 Bacteria 13938
327 Ga0265313_10003980 3300031595 Bacteria 11605
328 Ga0265313_10035957 3300031595 Bacteria 2489
329 Ga0265313_10068721 3300031595 Bacteria 1636
330 Ga0265314_10000025 3300031711 Bacteria 292548
331 Ga0265314_10014587 3300031711 Bacteria 6273
332 Ga0265342_10003478 3300031712 Bacteria 12900
333 Ga0265342_10005807 3300031712 Bacteria 9321
334 Ga0265342_10020339 3300031712 Bacteria 4261
335 Ga0265342_10033832 3300031712 Bacteria 3139
336 Ga0307410_10090497 3300031852 Bacteria 2170
337 Ga0307412_10072168 3300031911 Bacteria 2359
338 Ga0307510_10093615 3300033180 Bacteria 2835
339 Ga0373954_0011045 3300035118 Bacteria 3997
340 Ga0373931_0104973 3300035691 Bacteria 1595
341 Ga0373935_0047675 3300035692 Bacteria 2710
342 Ga0373937_0001874 3300036401 Bacteria 17662
343 Ga0373937_0072343 3300036401 Bacteria 3180
344 Ga0395900_0021561 3300037418 Bacteria 6587
345 Ga0395905_0027474 3300037471 Bacteria 5367
346 Ga0436360_1213990 3300039438 Bacteria 7244
347 Ga0436361_1020706 3300039447 Bacteria 66534
348 Ga0436363_0909993 3300039450 Bacteria 1712
349 Ga0436363_1143306 3300039450 Bacteria 3067
350 Ga0436362_0246260 3300039453 Bacteria 1838
351 Ga0451576_0167553 3300045051 Bacteria 2292
352 Ga0466967_0001557 3300045976 Bacteria 13448
353 Ga0466967_0060362 3300045976 Bacteria 3360
354 Ga0495603_0001318 3300046455 Bacteria 14383
355 Ga0495603_0129970 3300046455 Bacteria 1467
356 Ga0495629_0013741 3300046459 Bacteria 5841
357 Ga0495629_0063086 3300046459 Bacteria 2587
358 Ga0495653_0071108 3300046463 Bacteria 2602
359 Ga0495650_0000006 3300046471 Bacteria 721347
360 Ga0495580_0000247 3300046472 Bacteria 42646
361 Ga0495580_0004423 3300046472 Bacteria 11809
362 Ga0495582_0001535 3300046473 Bacteria 13032
363 Ga0495582_0021797 3300046473 Bacteria 3505
364 Ga0495639_0046569 3300046475 Bacteria 1963
365 Ga0495662_0000149 3300046476 Bacteria 27408
366 Ga0495585_0015790 3300046492 Bacteria 4385
367 Ga0495594_0000056 3300046499 Bacteria 49399
368 Ga0495594_0027531 3300046499 Bacteria 3063
369 Ga0495628_0021032 3300046516 Bacteria 5375
370 Ga0495631_0013524 3300046518 Bacteria 3960
371 Ga0495643_0001548 3300046522 Bacteria 20538
372 Ga0495644_0000013 3300046523 Bacteria 94729
373 Ga0495642_0042524 3300046528 Bacteria 1851
374 Ga0495642_0054162 3300046528 Bacteria 1654
375 Ga0495652_0065024 3300046529 Bacteria 3066
376 Ga0495665_0000998 3300046531 Bacteria 15022
377 Ga0495665_0010652 3300046531 Bacteria 4980
378 Ga0495665_0025258 3300046531 Bacteria 3192
379 Ga0495640_0056871 3300046533 Bacteria 2671
380 Ga0495645_0011643 3300046543 Bacteria 6195
381 Ga0495645_0012438 3300046543 Bacteria 5997
382 Ga0495645_0019106 3300046543 Bacteria 4932
383 Ga0495645_0088775 3300046543 Bacteria 2211
384 Ga0495622_0078398 3300046557 Bacteria 1521
385 Ga0495633_0007514 3300046558 Bacteria 6262
386 Ga0495667_0003258 3300046559 Bacteria 10879
387 Ga0495668_0012411 3300046616 Bacteria 5051
388 Ga0495634_0009865 3300046642 Bacteria 7025
389 Ga0495625_0000074 3300046660 Bacteria 164813
390 Ga0495625_0008798 3300046660 Bacteria 8548
391 Ga0495625_0012187 3300046660 Bacteria 6975
392 Ga0495625_0019939 3300046660 Bacteria 5187
393 Ga0495625_0056248 3300046660 Bacteria 2801
394 Ga0495635_0011174 3300046663 Bacteria 6294
395 Ga0495661_0004061 3300046665 Bacteria 10663
396 Ga0495599_0042764 3300046678 Bacteria 2843
397 Ga0495623_0022148 3300046679 Bacteria 4104
398 Ga0495623_0117006 3300046679 Bacteria 1610
399 Ga0495669_0040171 3300046684 Bacteria 2074
400 Ga0495613_0004679 3300046689 Bacteria 10269
401 Ga0495613_0044385 3300046689 Bacteria 3289
402 Ga0495613_0060607 3300046689 Bacteria 2771
403 Ga0495649_0009078 3300046694 Bacteria 5934
404 Ga0495600_0037248 3300046809 Bacteria 3161
405 Ga0495600_0045762 3300046809 Bacteria 2856
406 Ga0495581_0004161 3300047315 Bacteria 8341
407 Ga0495581_0017772 3300047315 Bacteria 4132
408 Ga0495604_0017504 3300047317 Bacteria 5738
409 Ga0495674_0169646 3300047319 Bacteria 1822
410 Ga0495672_0005044 3300047320 Bacteria 10557
411 Ga0495675_0033791 3300047444 Bacteria 3264
412 Ga0495686_0000009 3300047472 Bacteria 661643
413 Ga0495686_0000427 3300047472 Bacteria 66176
414 Ga0495686_0004566 3300047472 Bacteria 11335
415 Ga0495686_0013911 3300047472 Bacteria 5567
416 Ga0495593_0054699 3300047673 Bacteria 2103
417 Ga0495602_0075191 3300048088 Bacteria 2868
418 Ga0495614_0008850 3300048089 Bacteria 4468
419 Ga0495614_0013382 3300048089 Bacteria 3598
420 Ga0496100_0013016 3300048903 Bacteria 4787
421 Ga0496101_0095182 3300048904 Bacteria 2221
422 Ga0496101_0138983 3300048904 Bacteria 1850
423 Ga0496102_0055044 3300048905 Bacteria 3628
424 Ga0496104_0000626 3300048907 Bacteria 30277
425 Ga0496104_0010846 3300048907 Bacteria 8150
426 Ga0496104_0020078 3300048907 Bacteria 6120
427 Ga0496104_0081608 3300048907 Bacteria 3084
428 Ga0496104_0111911 3300048907 Bacteria 2618
429 Ga0496105_0005270 3300048908 Bacteria 9800
430 Ga0496106_0113356 3300048909 Bacteria 2113
431 Ga0496107_0094960 3300048910 Bacteria 2181
432 Ga0496108_0042848 3300048911 Bacteria 3779
433 Ga0496110_0059899 3300048913 Bacteria 3357
434 Ga0496112_0002331 3300048915 Bacteria 15237
435 Ga0496112_0176552 3300048915 Bacteria 2101
436 Ga0496113_0032103 3300048916 Bacteria 3814
437 Ga0496114_0062187 3300048917 Bacteria 3124
438 Ga0496115_0004604 3300048918 Bacteria 9987
439 Ga0496126_0000014 3300048929 Bacteria 686881
440 Ga0496126_0001162 3300048929 Bacteria 43477
441 Ga0496126_0009360 3300048929 Bacteria 10414
442 Ga0496126_0011405 3300048929 Bacteria 9205
443 Ga0495682_0056588 3300049460 Bacteria 1421
444 Ga0501031_0019770 3300049568 Bacteria 4388
445 Ga0501032_0004740 3300049569 Bacteria 10209
446 Ga0501034_0003911 3300049571 Bacteria 16735
447 Ga0501036_0001520 3300049572 Bacteria 17900
448 Ga0501037_0012395 3300049573 Bacteria 6277
449 Ga0501038_0002388 3300049574 Bacteria 17496
450 Ga0501038_0075578 3300049574 Bacteria 2847
451 Ga0501039_0093310 3300049575 Bacteria 2346
452 Ga0501042_0007140 3300049578 Bacteria 7307
453 Ga0501043_0057255 3300049579 Bacteria 3061
454 Ga0501043_0069963 3300049579 Bacteria 2756
455 Ga0501046_0000312 3300049580 Bacteria 48878
456 Ga0501047_0010439 3300049581 Bacteria 8789
457 Ga0501047_0156109 3300049581 Bacteria 2155
458 Ga0501048_0013788 3300049582 Bacteria 5996
459 Ga0501070_0156227 3300049586 Bacteria 1881
460 Ga0501071_0003412 3300049587 Bacteria 9928
461 Ga0501072_0005141 3300049588 Bacteria 9950
462 Ga0501073_0029827 3300049589 Bacteria 3897
463 Ga0501073_0097682 3300049589 Bacteria 2040
464 Ga0501074_0037309 3300049590 Bacteria 3523
465 Ga0501075_0000584 3300049591 Bacteria 22235
466 Ga0501080_0023595 3300049742 Bacteria 5699
467 Ga0501081_0001296 3300049743 Bacteria 15232
468 Ga0501035_0000664 3300049822 Bacteria 37957
469 Ga0501035_0040732 3300049822 Bacteria 4196
470 Ga0501044_0016063 3300049823 Bacteria 8050
471 Ga0501044_0197330 3300049823 Bacteria 1972
472 Ga0501045_0000331 3300049824 Bacteria 27828
473 nmdc:mga09592_6235_c1 3300050508 Bacteria 9708
474 nmdc:mga0n895_31830_c1 3300050512 Bacteria 5055
475 nmdc:mga0a205_28319_c1 3300050515 Bacteria 5356
476 Ga0495601_0111685 3300053077 Bacteria 1770
477 Ga0495619_0038992 3300053085 Bacteria 3101
478 Ga0500651_0000009 3300053093 Bacteria 270362
479 Ga0500595_000072 3300053119 Bacteria 71795
480 Ga0500595_026538 3300053119 Bacteria 1995
481 Ga0501084_0003678 3300054114 Bacteria 12445
482 Ga0501082_0000595 3300060353 Bacteria 31876
483 Ga0530510_0007175 3300061734 Bacteria 7755
484 2884219018 2884215851 Bacteria 4554841
485 Ga0207698_10169939
486 rootH2_10033281
487 Ga0070658_10000101
488 Ga0070658_10016181
489 Ga0070658_10018010
490 Ga0070683_100006870
491 Ga0070683_100009696
492 Ga0070683_100048922
493 Ga0068869_100001206
494 Ga0070666_10015665
495 Ga0070680_100071499
496 Ga0070680_100096035
497 Ga0068868_100013750
498 Ga0068868_100029154
499 Ga0068868_100031339
500 Ga0070660_100004584
501 Ga0070660_100105792
502 Ga0070661_100008544
503 Ga0070661_100023533
504 Ga0070671_100000235
505 Ga0070671_100001212
506 Ga0070671_100016792
507 Ga0070659_100001286
508 Ga0070659_100024272
509 Ga0070667_100017390
510 Ga0070667_100095609
511 Ga0070708_100008934
512 Ga0070663_100006615
513 Ga0070681_10065990
514 Ga0070681_10160006
515 Ga0068867_100097470
516 Ga0070706_100001749
517 Ga0070707_100153770
518 Ga0070684_100008565
519 Ga0070684_100256572
520 Ga0070697_100001488
521 Ga0068853_100000176
522 Ga0068853_100000912
523 Ga0068853_100068197
524 Ga0068853_100077211
525 Ga0070665_100022144
526 Ga0070665_100118489
527 Ga0068855_100001117
528 Ga0068855_100002330
529 Ga0068855_100003821
530 Ga0068855_100006977
531 Ga0068855_100007326
532 Ga0068855_100017028
533 Ga0068855_100038607
534 Ga0068855_100160641
535 Ga0068857_100002783
536 Ga0068857_100006312
537 Ga0068857_100081371
538 Ga0068854_100000019
539 Ga0068854_100079099
540 Ga0068854_100134345
541 Ga0068856_100005068
542 Ga0068856_100125656
543 Ga0068852_100000041
544 Ga0068852_100000338
545 Ga0068852_100047619
546 Ga0068852_100122451
547 Ga0068852_100129548
548 Ga0068859_100007032
549 Ga0068859_100087006
550 Ga0068864_100004120
551 Ga0068864_100013848
552 Ga0068866_10032413
553 Ga0068861_100072563
554 Ga0068851_10002984
555 Ga0068863_100003622
556 Ga0068858_100014464
557 Ga0068858_100226340
558 Ga0068860_100006785
559 Ga0068860_100076201
560 Ga0081455_10010679
561 Ga0070717_10006261
562 Ga0070717_10073518
563 Ga0097621_100000431
564 Ga0097621_100003942
565 Ga0097621_100005247
566 Ga0068871_100007776
567 Ga0068871_100026598
568 Ga0075431_100020179
569 Ga0075433_10045883
570 Ga0075434_100009362
571 Ga0075434_100032972
572 Ga0075429_100037311
573 Ga0097620_100007033
574 Ga0097620_100087006
575 Ga0105240_10000001
576 Ga0105240_10000251
577 Ga0105240_10002247
578 Ga0105240_10003247
579 Ga0105240_10004439
580 Ga0105240_10009662
581 Ga0105240_10012023
582 Ga0105240_10014820
583 Ga0105240_10028134
584 Ga0105240_10079375
585 Ga0105240_10094351
586 Ga0105240_10116044
587 Ga0105240_10319098
588 Ga0105245_10001223
589 Ga0105245_10022781
590 Ga0105243_10038287
591 Ga0105241_10000259
592 Ga0105241_10000458
593 Ga0105241_10002080
594 Ga0105241_10003509
595 Ga0105241_10026834
596 Ga0105241_10119799
597 Ga0105248_10000003
598 Ga0105248_10000639
599 Ga0105248_10011582
600 Ga0105248_10013518
601 Ga0105248_10089222
602 Ga0105237_10012532
603 Ga0105237_10013833
604 Ga0105237_10076180
605 Ga0105238_10001587
606 Ga0105238_10003727
607 Ga0105238_10005042
608 Ga0105238_10011748
609 Ga0105238_10025365
610 Ga0105238_10027097
611 Ga0105238_10034266
612 Ga0105238_10046566
613 Ga0105249_10024390
614 Ga0105249_10154245
615 Ga0105239_10005701
616 Ga0105239_10019794
617 Ga0105239_10030708
618 Ga0105246_10011258
619 Ga0157370_10000003
620 Ga0157370_10008814
621 Ga0157370_10018054
622 Ga0157370_10019232
623 Ga0157370_10065273
624 Ga0157370_10117578
625 Ga0157370_10186695
626 Ga0157369_10000094
627 Ga0157369_10001914
628 Ga0157369_10004449
629 Ga0157369_10005464
630 Ga0157369_10006412
631 Ga0157369_10009603
632 Ga0157369_10013036
633 Ga0157369_10018945
634 Ga0157369_10020243
635 Ga0157369_10026019
636 Ga0157369_10076362
637 Ga0157369_10098336
638 Ga0157369_10111837
639 Ga0157374_10001112
640 Ga0157374_10001439
641 Ga0157374_10014101
642 Ga0157374_10021624
643 Ga0157374_10067036
644 Ga0157374_10128877
645 Ga0157378_10001618
646 Ga0157378_10037375
647 Ga0157378_10096447
648 Ga0163162_10003588
649 Ga0163162_10008603
650 Ga0163162_10026765
651 Ga0163162_10079070
652 Ga0157372_10000074
653 Ga0157372_10003222
654 Ga0157372_10009997
655 Ga0157372_10012297
656 Ga0157372_10016588
657 Ga0157372_10041524
658 Ga0157372_10064349
659 Ga0157372_10114110
660 Ga0157372_10117059
661 Ga0157372_10341229
662 Ga0157375_10007374
663 Ga0157375_10088503
664 Ga0157375_10203218
665 Ga0163163_10002120
666 Ga0163163_10006725
667 Ga0163163_10008582
668 Ga0163163_10121686
669 Ga0157380_10012980
670 Ga0157379_10003213
671 Ga0157379_10032341
672 Ga0157379_10140398
673 Ga0157379_10178022
674 Ga0157376_10107844
675 Ga0157376_10274379
676 Ga0213872_10000315
677 Ga0209233_1004548
678 Ga0207656_10027950
679 Ga0207710_10003278
680 Ga0207647_10000811
681 Ga0207647_10021282
682 Ga0207705_10000109
683 Ga0207705_10015262
684 Ga0207705_10018509
685 Ga0207705_10034797
686 Ga0207705_10043952
687 Ga0207684_10009632
688 Ga0207654_10000229
689 Ga0207654_10000490
690 Ga0207654_10015746
691 Ga0207695_10000001
692 Ga0207695_10000129
693 Ga0207695_10000194
694 Ga0207695_10000263
695 Ga0207695_10000428
696 Ga0207695_10006198
697 Ga0207695_10026639
698 Ga0207695_10028193
699 Ga0207695_10037309
700 Ga0207695_10085814
701 Ga0207695_10188942
702 Ga0207671_10003735
703 Ga0207671_10008200
704 Ga0207657_10026422
705 Ga0207657_10036348
706 Ga0207657_10109308
707 Ga0207652_10001776
708 Ga0207652_10108643
709 Ga0207652_10133250
710 Ga0207694_10000036
711 Ga0207694_10000749
712 Ga0207694_10002282
713 Ga0207694_10035178
714 Ga0207694_10159084
715 Ga0207650_10025866
716 Ga0207650_10098537
717 Ga0207687_10016331
718 Ga0207644_10001784
719 Ga0207644_10003780
720 Ga0207644_10011501
721 Ga0207690_10016176
722 Ga0207690_10019293
723 Ga0207706_10001880
724 Ga0207691_10006364
725 Ga0207711_10000013
726 Ga0207711_10005835
727 Ga0207711_10090756
728 Ga0207711_10102105
729 Ga0207711_10267166
730 Ga0207689_10001455
731 Ga0207689_10038719
732 Ga0207661_10005737
733 Ga0207661_10030746
734 Ga0207661_10035604
735 Ga0207667_10001622
736 Ga0207667_10003825
737 Ga0207667_10003877
738 Ga0207667_10007018
739 Ga0207667_10009690
740 Ga0207667_10018384
741 Ga0207667_10065243
742 Ga0207667_10080176
743 Ga0207667_10174954
744 Ga0207667_10306263
745 Ga0207712_10012352
746 Ga0207640_10000028
747 Ga0207640_10188603
748 Ga0207677_10029239
749 Ga0207677_10039222
750 Ga0207639_10000049
751 Ga0207639_10000094
752 Ga0207639_10012641
753 Ga0207678_10001052
754 Ga0207678_10033926
755 Ga0207702_10005190
756 Ga0207702_10046406
757 Ga0207702_10088920
758 Ga0207641_10005842
759 Ga0207676_10006227
760 Ga0207676_10008548
761 Ga0207676_10124742
762 Ga0207674_10004432
763 Ga0207674_10009962
764 Ga0207674_10016370
765 Ga0207683_10001144
766 Ga0207698_10000017
767 Ga0207698_10000037
768 Ga0207698_10014760
769 Ga0207698_10029357
770 Ga0268266_10001982
771 Ga0268266_10024843
772 Ga0268266_10043681
773 Ga0268266_10094940
774 Ga0268266_10122836
775 Ga0268264_10001478
776 Ga0265318_10042503
777 Ga0265338_10001002
778 Ga0265338_10008925
779 Ga0265338_10033116
780 Ga0265338_10044107
781 Ga0265338_10094883
782 Ga0265330_10004955
783 Ga0265330_10005509
784 Ga0265330_10007824
785 Ga0265332_10014466
786 Ga0265328_10017154
787 Ga0265325_10001870
788 Ga0265325_10008972
789 Ga0265325_10015752
790 Ga0265325_10038597
791 Ga0265329_10021878
792 Ga0265340_10008321
793 Ga0265340_10017409
794 Ga0265340_10021649
795 Ga0265339_10000031
796 Ga0265339_10003764
797 Ga0265339_10017271
798 Ga0265339_10023013
799 Ga0265339_10045400
800 Ga0265331_10039611
801 Ga0265316_10001845
802 Ga0265316_10004137
803 Ga0265316_10015742
804 Ga0265316_10016178
805 Ga0265316_10017868
806 Ga0265316_10051787
807 Ga0265316_10052720
808 Ga0265316_10060927
809 Ga0307513_10003296
810 Ga0265313_10003041
811 Ga0265313_10003980
812 Ga0265313_10035957
813 Ga0265313_10068721
814 Ga0265314_10000025
815 Ga0265314_10014587
816 Ga0265342_10003478
817 Ga0265342_10005807
818 Ga0265342_10020339
819 Ga0265342_10033832
820 Ga0307410_10090497
821 Ga0307412_10072168
822 Ga0307510_10093615
823 Ga0373954_0011045
824 Ga0373931_0104973
825 Ga0373935_0047675
826 Ga0373937_0001874
827 Ga0373937_0072343
828 Ga0395900_0021561
829 Ga0395905_0027474
830 Ga0436360_1213990
831 Ga0436361_1020706
832 Ga0436363_0909993
833 Ga0436363_1143306
834 Ga0436362_0246260
835 Ga0451576_0167553
836 Ga0466967_0001557
837 Ga0466967_0060362
838 Ga0495603_0001318
839 Ga0495603_0129970
840 Ga0495629_0013741
841 Ga0495629_0063086
842 Ga0495653_0071108
843 Ga0495650_0000006
844 Ga0495580_0000247
845 Ga0495580_0004423
846 Ga0495582_0001535
847 Ga0495582_0021797
848 Ga0495639_0046569
849 Ga0495662_0000149
850 Ga0495585_0015790
851 Ga0495594_0000056
852 Ga0495594_0027531
853 Ga0495628_0021032
854 Ga0495631_0013524
855 Ga0495643_0001548
856 Ga0495644_0000013
857 Ga0495642_0042524
858 Ga0495642_0054162
859 Ga0495652_0065024
860 Ga0495665_0000998
861 Ga0495665_0010652
862 Ga0495665_0025258
863 Ga0495640_0056871
864 Ga0495645_0011643
865 Ga0495645_0012438
866 Ga0495645_0019106
867 Ga0495645_0088775
868 Ga0495622_0078398
869 Ga0495633_0007514
870 Ga0495667_0003258
871 Ga0495668_0012411
872 Ga0495634_0009865
873 Ga0495625_0000074
874 Ga0495625_0008798
875 Ga0495625_0012187
876 Ga0495625_0019939
877 Ga0495625_0056248
878 Ga0495635_0011174
879 Ga0495661_0004061
880 Ga0495599_0042764
881 Ga0495623_0022148
882 Ga0495623_0117006
883 Ga0495669_0040171
884 Ga0495613_0004679
885 Ga0495613_0044385
886 Ga0495613_0060607
887 Ga0495649_0009078
888 Ga0495600_0037248
889 Ga0495600_0045762
890 Ga0495581_0004161
891 Ga0495581_0017772
892 Ga0495604_0017504
893 Ga0495674_0169646
894 Ga0495672_0005044
895 Ga0495675_0033791
896 Ga0495686_0000009
897 Ga0495686_0000427
898 Ga0495686_0004566
899 Ga0495686_0013911
900 Ga0495593_0054699
901 Ga0495602_0075191
902 Ga0495614_0008850
903 Ga0495614_0013382
904 Ga0496100_0013016
905 Ga0496101_0095182
906 Ga0496101_0138983
907 Ga0496102_0055044
908 Ga0496104_0000626
909 Ga0496104_0010846
910 Ga0496104_0020078
911 Ga0496104_0081608
912 Ga0496104_0111911
913 Ga0496105_0005270
914 Ga0496106_0113356
915 Ga0496107_0094960
916 Ga0496108_0042848
917 Ga0496110_0059899
918 Ga0496112_0002331
919 Ga0496112_0176552
920 Ga0496113_0032103
921 Ga0496114_0062187
922 Ga0496115_0004604
923 Ga0496126_0000014
924 Ga0496126_0001162
925 Ga0496126_0009360
926 Ga0496126_0011405
927 Ga0495682_0056588
928 Ga0501031_0019770
929 Ga0501032_0004740
930 Ga0501034_0003911
931 Ga0501036_0001520
932 Ga0501037_0012395
933 Ga0501038_0002388
934 Ga0501038_0075578
935 Ga0501039_0093310
936 Ga0501042_0007140
937 Ga0501043_0057255
938 Ga0501043_0069963
939 Ga0501046_0000312
940 Ga0501047_0010439
941 Ga0501047_0156109
942 Ga0501048_0013788
943 Ga0501070_0156227
944 Ga0501071_0003412
945 Ga0501072_0005141
946 Ga0501073_0029827
947 Ga0501073_0097682
948 Ga0501074_0037309
949 Ga0501075_0000584
950 Ga0501080_0023595
951 Ga0501081_0001296
952 Ga0501035_0000664
953 Ga0501035_0040732
954 Ga0501044_0016063
955 Ga0501044_0197330
956 Ga0501045_0000331
957 nmdc:mga09592_6235_c1
958 nmdc:mga0n895_31830_c1
959 nmdc:mga0a205_28319_c1
960 Ga0495601_0111685
961 Ga0495619_0038992
962 Ga0500651_0000009
963 Ga0500595_000072
964 Ga0500595_026538
965 Ga0501084_0003678
966 Ga0501082_0000595
967 Ga0530510_0007175
968 2884219018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

72

502

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ip4-assembly1.cif.gz_A the high resolution structure of gatcab 0.8897 16 474
4wj3-assembly2.cif.gz_D crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.8865 16 474
3kfu-assembly1.cif.gz_H crystal structure of the transamidosome 0.8651 18 478
3h0r-assembly7.cif.gz_S structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.8645 16 478
6c62-assembly1.cif.gz_A an unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. 0.8621 16 474
ID Description Score Start End Superfamily
2dqnA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8901 16 474 3.90.1300.10
4wj3D00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8865 16 474 3.90.1300.10
af_Q9LI77_43_527_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8847 15 474 3.90.1300.10
af_Q58560_2_434_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8771 33 475 3.90.1300.10
af_Q5FWT5_3_499_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8755 15 474 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A2T1CIC8-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA 0.9627 15 231 GO:0016740
AF-A0A6I1IQD4-F1-model_v4 deleted 0.9621 164 294
AF-A0A7C6WBK3-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA (EC 6.3.5.7) 0.9601 16 268 GO:0016740
GO:0050567
AF-A0A3C0SA14-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA 0.959 16 243 GO:0016740
AF-A0A7K0YX71-F1-model_v4 deleted 0.9574 16 156

Map