F452964

General Info

Members Datasets Scaffolds Average Seq Length
484 254 968 432

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0005034|Ga0373926_0005034_715_2259
Length 514
Sequence MDADQPHTPAGRAAGTGRPDGDDGSWIAPGVTGPVSALVRLPGSKSMTNRALVLAALAEGPTQITGPLAARDTALMVAALRALGCGIQTGRDLAGPWLAEPGAAPGGLAGWPPAGSSGHDGELAGREGAARSVVVNVGNAGTVLRFVPAIAALTSADVRFIGDERVAERPLLPMLSALRELGAQIEGGGNGTVPFVVRGGGGLPGGAVTLDASSSSQLISGLLLAAPRYGKGVEVRHQGPPVPSAPHIEMTVAMLRARGVDVTAGTQQAGATPANDAGLTAGPDAMSRPPAAAAITGDTGGERAVCDTWAVLPGAIAAGTIDVEPDLSNAVPFLAAALAIGGEVTIAGWPTASLQPVARVLGLLAAMGATVSQTAAGLRVSGDGRIRGITADLSEVGELTPVLTALAALASSPSRFVGVGHLRRHECDRLAALAGEIGGLGGDVTELPDGLSIRPRPLRSDGVVFDSHDDHRLVMAAAVLGLATGGLRIGNAATAGKTFPGFARFWTQTLAPAG

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
90 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 2506783011 Frankia datiscae Dg1 Isolate Nodule
235 2643221615 Nocardioides sp. Root224 Isolate Unclassified
236 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
237 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
238 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
239 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
240 2773857933 Frankia sp. BMG5.30 Isolate Nodule
241 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
242 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
243 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
244 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
245 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
246 2919069694 Microbacterium sp. 1154 Isolate Unclassified
247 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
248 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
249 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
250 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
251 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
252 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
253 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
254 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.66
Metatranscriptomes 0
Isolates 4.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0
Endosphere 5.37
Nodule 0.41
Rhizoplane 5.79
Rhizosphere 83.26
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0005034 3300035083 Bacteria 4343
2 JGI24737J22298_10005641 3300001990 Bacteria 4310
3 Ga0070683_100017361 3300005329 Bacteria 6362
4 Ga0070683_100171097 3300005329 Bacteria 2062
5 Ga0070682_100032302 3300005337 Bacteria 3172
6 Ga0070660_100039490 3300005339 Bacteria 3588
7 Ga0070659_100021705 3300005366 Bacteria 4896
8 Ga0070709_10011177 3300005434 Bacteria 4994
9 Ga0070709_10014866 3300005434 Bacteria 4414
10 Ga0070714_100000526 3300005435 Bacteria 27664
11 Ga0070714_100010642 3300005435 Bacteria 7278
12 Ga0070714_100029576 3300005435 Bacteria 4555
13 Ga0070714_100038110 3300005435 Bacteria 4042
14 Ga0070714_100048639 3300005435 Bacteria 3607
15 Ga0070713_100003751 3300005436 Bacteria 10057
16 Ga0070713_100036583 3300005436 Bacteria 3962
17 Ga0070710_10002321 3300005437 Bacteria 9000
18 Ga0070710_10006274 3300005437 Bacteria 5697
19 Ga0070710_10051417 3300005437 Bacteria 2313
20 Ga0070711_100008206 3300005439 Bacteria 6386
21 Ga0070711_100035546 3300005439 Bacteria 3332
22 Ga0070711_100091400 3300005439 Bacteria 2194
23 Ga0070708_100026434 3300005445 Bacteria 4968
24 Ga0070708_100047121 3300005445 Bacteria 3806
25 Ga0070708_100063495 3300005445 Bacteria 3306
26 Ga0070706_100005959 3300005467 Bacteria 11530
27 Ga0070706_100013802 3300005467 Bacteria 7468
28 Ga0070706_100015699 3300005467 Bacteria 6995
29 Ga0070706_100028692 3300005467 Bacteria 5124
30 Ga0070706_100090675 3300005467 Bacteria 2835
31 Ga0070706_100206311 3300005467 Bacteria 1835
32 Ga0070707_100000127 3300005468 Bacteria 71273
33 Ga0070707_100001180 3300005468 Bacteria 25707
34 Ga0070707_100025784 3300005468 Bacteria 5580
35 Ga0070707_100249192 3300005468 Bacteria 1728
36 Ga0070698_100002462 3300005471 Bacteria 20439
37 Ga0070698_100002810 3300005471 Bacteria 19152
38 Ga0070698_100014078 3300005471 Bacteria 8457
39 Ga0070698_100072330 3300005471 Bacteria 3456
40 Ga0070684_100062003 3300005535 Bacteria 3274
41 Ga0070684_100131825 3300005535 Bacteria 2255
42 Ga0070696_100065838 3300005546 Bacteria 2540
43 Ga0070665_100001745 3300005548 Bacteria 24881
44 Ga0070665_100196512 3300005548 Bacteria 2018
45 Ga0068855_100003196 3300005563 Bacteria 20063
46 Ga0070664_100105099 3300005564 Bacteria 2459
47 Ga0068857_100004898 3300005577 Bacteria 11361
48 Ga0068857_100078875 3300005577 Bacteria 2939
49 Ga0068856_100008876 3300005614 Bacteria 9780
50 Ga0068856_100047753 3300005614 Bacteria 4218
51 Ga0068856_100089196 3300005614 Bacteria 3066
52 Ga0070702_100044624 3300005615 Bacteria 2504
53 Ga0068864_100014834 3300005618 Bacteria 6474
54 Ga0068863_100048749 3300005841 Bacteria 4016
55 Ga0068858_100123044 3300005842 Bacteria 2428
56 Ga0068860_100118980 3300005843 Bacteria 2529
57 Ga0068860_100200421 3300005843 Bacteria 1934
58 Ga0081455_10020473 3300005937 Bacteria 6225
59 Ga0081540_1002330 3300005983 Bacteria 15548
60 Ga0081540_1016528 3300005983 Bacteria 4611
61 Ga0081539_10002008 3300005985 Bacteria 30810
62 Ga0070717_10111550 3300006028 Bacteria 2334
63 Ga0075365_10000189 3300006038 Bacteria 20092
64 Ga0075365_10002346 3300006038 Bacteria 9224
65 Ga0075365_10012029 3300006038 Bacteria 5118
66 Ga0075363_100000630 3300006048 Bacteria 11660
67 Ga0075363_100038494 3300006048 Bacteria 2515
68 Ga0075363_100061583 3300006048 Bacteria 2023
69 Ga0075363_100067962 3300006048 Bacteria 1932
70 Ga0075364_10001416 3300006051 Bacteria 13006
71 Ga0075364_10024742 3300006051 Bacteria 3815
72 Ga0075364_10036265 3300006051 Bacteria 3187
73 Ga0075364_10042605 3300006051 Bacteria 2950
74 Ga0075364_10074153 3300006051 Bacteria 2243
75 Ga0070715_10002562 3300006163 Bacteria 5606
76 Ga0070716_100001777 3300006173 Bacteria 9759
77 Ga0070716_100011764 3300006173 Bacteria 4413
78 Ga0070716_100040485 3300006173 Bacteria 2592
79 Ga0070712_100023717 3300006175 Bacteria 4057
80 Ga0070712_100049787 3300006175 Bacteria 2911
81 Ga0075367_10002790 3300006178 Bacteria 8096
82 Ga0075369_10003346 3300006186 Bacteria 5826
83 Ga0075370_10007955 3300006353 Bacteria 5432
84 Ga0075370_10045595 3300006353 Bacteria 2480
85 Ga0075428_100034318 3300006844 Bacteria 5597
86 Ga0075428_100084581 3300006844 Bacteria 3461
87 Ga0075431_100014188 3300006847 Bacteria 8058
88 Ga0075431_100158252 3300006847 Bacteria 2330
89 Ga0075433_10028383 3300006852 Bacteria 4757
90 Ga0075434_100028737 3300006871 Bacteria 5467
91 Ga0068865_100024740 3300006881 Bacteria 3943
92 Ga0075436_100008756 3300006914 Bacteria 6921
93 Ga0075436_100057634 3300006914 Bacteria 2683
94 Ga0075435_100005309 3300007076 Bacteria 8975
95 Ga0075435_100025516 3300007076 Bacteria 4601
96 Ga0105245_10001875 3300009098 Bacteria 19079
97 Ga0114129_10001931 3300009147 Bacteria 28347
98 Ga0114129_10004583 3300009147 Bacteria 19500
99 Ga0105248_10003471 3300009177 Bacteria 17511
100 Ga0105237_10012012 3300009545 Bacteria 9148
101 Ga0105238_10222463 3300009551 Bacteria 1864
102 Ga0105249_10018486 3300009553 Bacteria 6204
103 Ga0105249_10325182 3300009553 Bacteria 1550
104 Ga0105239_10084008 3300010375 Bacteria 3507
105 Ga0157369_10046817 3300013105 Bacteria 4700
106 Ga0163162_10258505 3300013306 Bacteria 1873
107 Ga0157375_10003685 3300013308 Bacteria 13302
108 Ga0157375_10369156 3300013308 Bacteria 1601
109 Ga0163163_10098501 3300014325 Bacteria 2945
110 Ga0157379_10002556 3300014968 Bacteria 15266
111 Ga0213876_10019693 3300021384 Bacteria 3564
112 Ga0213875_10030333 3300021388 Bacteria 2560
113 Ga0207692_10007834 3300025898 Bacteria 4396
114 Ga0207692_10009411 3300025898 Bacteria 4081
115 Ga0207699_10000723 3300025906 Bacteria 15748
116 Ga0207699_10003044 3300025906 Bacteria 7957
117 Ga0207699_10004441 3300025906 Bacteria 6708
118 Ga0207643_10034610 3300025908 Bacteria 2831
119 Ga0207684_10001782 3300025910 Bacteria 22690
120 Ga0207684_10011796 3300025910 Bacteria 7620
121 Ga0207671_10007956 3300025914 Bacteria 9083
122 Ga0207693_10036188 3300025915 Bacteria 3891
123 Ga0207693_10058949 3300025915 Bacteria 3007
124 Ga0207693_10111753 3300025915 Bacteria 2143
125 Ga0207663_10011430 3300025916 Bacteria 4767
126 Ga0207663_10027859 3300025916 Bacteria 3299
127 Ga0207662_10031620 3300025918 Bacteria 3075
128 Ga0207657_10084327 3300025919 Bacteria 2664
129 Ga0207646_10000264 3300025922 Bacteria 71299
130 Ga0207646_10001334 3300025922 Bacteria 30684
131 Ga0207646_10003773 3300025922 Bacteria 16878
132 Ga0207646_10026051 3300025922 Bacteria 5344
133 Ga0207646_10157834 3300025922 Bacteria 2046
134 Ga0207687_10012627 3300025927 Bacteria 5518
135 Ga0207700_10003000 3300025928 Bacteria 9730
136 Ga0207700_10005604 3300025928 Bacteria 7536
137 Ga0207700_10013984 3300025928 Bacteria 5246
138 Ga0207700_10031952 3300025928 Bacteria 3747
139 Ga0207700_10080405 3300025928 Bacteria 2541
140 Ga0207664_10002040 3300025929 Bacteria 13312
141 Ga0207664_10007914 3300025929 Bacteria 7385
142 Ga0207664_10019554 3300025929 Bacteria 5007
143 Ga0207664_10035807 3300025929 Bacteria 3832
144 Ga0207690_10033498 3300025932 Bacteria 3304
145 Ga0207665_10004765 3300025939 Bacteria 9021
146 Ga0207665_10014219 3300025939 Bacteria 5238
147 Ga0207665_10146804 3300025939 Bacteria 1686
148 Ga0207711_10002035 3300025941 Bacteria 18284
149 Ga0207689_10043314 3300025942 Bacteria 3721
150 Ga0207661_10103551 3300025944 Bacteria 2395
151 Ga0207679_10097452 3300025945 Bacteria 2291
152 Ga0207667_10003875 3300025949 Bacteria 18400
153 Ga0207677_10236145 3300026023 Bacteria 1476
154 Ga0207703_10075010 3300026035 Bacteria 2802
155 Ga0207641_10096044 3300026088 Bacteria 2603
156 Ga0207674_10002647 3300026116 Bacteria 22374
157 Ga0207674_10004074 3300026116 Bacteria 17710
158 Ga0207674_10042289 3300026116 Bacteria 4708
159 Ga0207428_10015813 3300027907 Bacteria 6513
160 Ga0268266_10011077 3300028379 Bacteria 7852
161 Ga0268264_10040270 3300028381 Bacteria 3861
162 Ga0265337_1000047 3300028556 Bacteria 53962
163 Ga0265326_10004458 3300028558 Bacteria 4484
164 Ga0265319_1010152 3300028563 Bacteria 3947
165 Ga0265334_10000196 3300028573 Bacteria 34888
166 Ga0265338_10000315 3300028800 Bacteria 87685
167 Ga0265338_10004007 3300028800 Bacteria 20224
168 Ga0265338_10013005 3300028800 Bacteria 9440
169 Ga0265324_10003734 3300029957 Bacteria 7134
170 Ga0265332_10000555 3300031238 Bacteria 25185
171 Ga0265320_10001951 3300031240 Bacteria 14562
172 Ga0265325_10012168 3300031241 Bacteria 4925
173 Ga0265340_10005298 3300031247 Bacteria 7163
174 Ga0265339_10033366 3300031249 Bacteria 2899
175 Ga0265314_10007466 3300031711 Bacteria 9481
176 Ga0265342_10011381 3300031712 Bacteria 6096
177 Ga0316576_10013494 3300031727 Bacteria 5433
178 Ga0316578_10009742 3300031728 Bacteria 4954
179 Ga0307410_10009623 3300031852 Bacteria 5434
180 Ga0307407_10003878 3300031903 Bacteria 6234
181 Ga0307409_100000649 3300031995 Bacteria 15381
182 Ga0307416_100045327 3300032002 Bacteria 3462
183 Ga0307415_100000600 3300032126 Bacteria 15760
184 Ga0373948_0002505 3300034817 Bacteria 2728
185 Ga0373926_0004231 3300035083 Bacteria 4690
186 Ga0373934_0000561 3300035086 Bacteria 13097
187 Ga0373934_0004892 3300035086 Bacteria 4959
188 Ga0373934_0009784 3300035086 Bacteria 3597
189 Ga0373940_0006868 3300035088 Bacteria 2547
190 Ga0373944_0004380 3300035089 Bacteria 3674
191 Ga0373923_0002025 3300035111 Bacteria 6101
192 Ga0373923_0006485 3300035111 Bacteria 4050
193 Ga0373936_0000347 3300035113 Bacteria 15677
194 Ga0373936_0026672 3300035113 Bacteria 2263
195 Ga0373939_0014392 3300035114 Bacteria 2052
196 Ga0373953_0000233 3300035117 Bacteria 15083
197 Ga0373953_0013097 3300035117 Bacteria 2953
198 Ga0373953_0070663 3300035117 Bacteria 1440
199 Ga0373954_0000481 3300035118 Bacteria 14980
200 Ga0373954_0012350 3300035118 Bacteria 3796
201 Ga0373954_0028913 3300035118 Bacteria 2550
202 Ga0373954_0036834 3300035118 Bacteria 2272
203 Ga0373956_0001048 3300035119 Bacteria 11380
204 Ga0373956_0003076 3300035119 Bacteria 6751
205 Ga0373956_0023416 3300035119 Bacteria 2650
206 Ga0373957_0000738 3300035120 Bacteria 8491
207 Ga0373957_0004674 3300035120 Bacteria 4187
208 Ga0373957_0015517 3300035120 Bacteria 2623
209 Ga0373943_0000269 3300035170 Bacteria 21448
210 Ga0373946_0002656 3300035171 Bacteria 6311
211 Ga0373946_0045579 3300035171 Bacteria 1815
212 Ga0373955_0001112 3300035172 Bacteria 11425
213 Ga0373955_0005070 3300035172 Bacteria 5890
214 Ga0316574_0047149 3300035398 Bacteria 2674
215 Ga0316574_0080754 3300035398 Bacteria 2064
216 Ga0373924_0004987 3300035410 Bacteria 4670
217 Ga0373924_0031240 3300035410 Bacteria 2140
218 Ga0373924_0035749 3300035410 Bacteria 2015
219 Ga0373935_0000373 3300035692 Bacteria 22971
220 Ga0373935_0006429 3300035692 Bacteria 7015
221 Ga0373935_0044280 3300035692 Bacteria 2804
222 Ga0373927_0003404 3300035695 Bacteria 11440
223 Ga0373933_0000079 3300035724 Bacteria 60394
224 Ga0373933_0001758 3300035724 Bacteria 12570
225 Ga0373933_0004437 3300035724 Bacteria 7701
226 Ga0373933_0014534 3300035724 Bacteria 4380
227 Ga0373933_0044033 3300035724 Bacteria 2642
228 Ga0373933_0096785 3300035724 Bacteria 1827
229 Ga0373947_0000007 3300035725 Bacteria 192259
230 Ga0373947_0005634 3300035725 Bacteria 7303
231 Ga0373937_0000189 3300036401 Bacteria 60393
232 Ga0373937_0022234 3300036401 Bacteria 5699
233 Ga0373937_0032811 3300036401 Bacteria 4711
234 Ga0373937_0083590 3300036401 Bacteria 2953
235 Ga0373937_0206248 3300036401 Bacteria 1848
236 Ga0316584_0001229 3300036712 Bacteria 15141
237 Ga0373925_0001710 3300037068 Bacteria 18498
238 Ga0373925_0049696 3300037068 Bacteria 3126
239 Ga0373925_0081340 3300037068 Bacteria 2463
240 Ga0373925_0135597 3300037068 Bacteria 1923
241 Ga0373925_0184714 3300037068 Bacteria 1652
242 Ga0436364_0106856 3300037853 Bacteria 2572
243 Ga0436364_0209569 3300037853 Bacteria 4325
244 Ga0436364_0986170 3300037853 Bacteria 2268
245 Ga0436365_0393187 3300039437 Bacteria 11582
246 Ga0436365_1691907 3300039437 Bacteria 1646
247 Ga0439465_0001921 3300041413 Bacteria 6816
248 Ga0466965_0013948 3300044683 Bacteria 3799
249 Ga0466966_0014087 3300044684 Bacteria 5294
250 Ga0466961_0010863 3300044693 Bacteria 5815
251 Ga0466961_0096181 3300044693 Bacteria 1867
252 Ga0466964_0008073 3300044706 Bacteria 3947
253 Ga0466970_0016154 3300044765 Bacteria 3845
254 Ga0466957_0017570 3300044842 Bacteria 4192
255 Ga0466957_0033702 3300044842 Bacteria 3073
256 Ga0466960_0007045 3300044901 Bacteria 4544
257 Ga0466960_0031858 3300044901 Bacteria 2435
258 Ga0466959_0004319 3300045049 Bacteria 9490
259 Ga0466959_0032689 3300045049 Bacteria 3851
260 Ga0466958_0011794 3300045836 Bacteria 4934
261 Ga0466958_0018646 3300045836 Bacteria 4031
262 Ga0466958_0137602 3300045836 Bacteria 1536
263 Ga0466967_0043217 3300045976 Bacteria 3900
264 Ga0466967_0047308 3300045976 Bacteria 3749
265 Ga0466967_0224724 3300045976 Bacteria 1785
266 Ga0466967_0226818 3300045976 Bacteria 1777
267 Ga0495592_0000154 3300046454 Bacteria 59985
268 Ga0495592_0076931 3300046454 Bacteria 2420
269 Ga0495592_0101656 3300046454 Bacteria 2048
270 Ga0495629_0003669 3300046459 Bacteria 11601
271 Ga0495629_0009680 3300046459 Bacteria 7039
272 Ga0495641_0003291 3300046461 Bacteria 12200
273 Ga0495641_0011293 3300046461 Bacteria 5103
274 Ga0495651_0001468 3300046462 Bacteria 18227
275 Ga0495651_0065663 3300046462 Bacteria 2770
276 Ga0495651_0095120 3300046462 Bacteria 2228
277 Ga0495651_0176822 3300046462 Bacteria 1514
278 Ga0495651_0197307 3300046462 Bacteria 1411
279 Ga0495653_0005775 3300046463 Bacteria 10130
280 Ga0495653_0034000 3300046463 Bacteria 4035
281 Ga0495653_0117350 3300046463 Bacteria 1901
282 Ga0495582_0006221 3300046473 Bacteria 6648
283 Ga0495582_0086486 3300046473 Bacteria 1744
284 Ga0495582_0158307 3300046473 Bacteria 1287
285 Ga0495639_0026077 3300046475 Bacteria 2581
286 Ga0495662_0010098 3300046476 Bacteria 4630
287 Ga0495662_0091118 3300046476 Bacteria 1486
288 Ga0495664_0000535 3300046477 Bacteria 19109
289 Ga0495664_0007516 3300046477 Bacteria 6059
290 Ga0495664_0011653 3300046477 Bacteria 4962
291 Ga0495664_0017428 3300046477 Bacteria 4105
292 Ga0495608_0000123 3300046511 Bacteria 55519
293 Ga0495608_0020301 3300046511 Bacteria 4567
294 Ga0495608_0032142 3300046511 Bacteria 3547
295 Ga0495608_0061103 3300046511 Bacteria 2478
296 Ga0495618_0013261 3300046514 Bacteria 5015
297 Ga0495618_0016971 3300046514 Bacteria 4462
298 Ga0495618_0026855 3300046514 Bacteria 3581
299 Ga0495628_0002772 3300046516 Bacteria 15701
300 Ga0495628_0082037 3300046516 Bacteria 2504
301 Ga0495630_0011233 3300046517 Bacteria 6478
302 Ga0495666_0082163 3300046526 Bacteria 1523
303 Ga0495652_0000278 3300046529 Bacteria 60389
304 Ga0495652_0041137 3300046529 Bacteria 3991
305 Ga0495652_0088949 3300046529 Bacteria 2530
306 Ga0495652_0090494 3300046529 Bacteria 2503
307 Ga0495652_0140879 3300046529 Bacteria 1896
308 Ga0495665_0002309 3300046531 Bacteria 10305
309 Ga0495665_0022190 3300046531 Bacteria 3413
310 Ga0495640_0009144 3300046533 Bacteria 7734
311 Ga0495640_0030704 3300046533 Bacteria 3844
312 Ga0495640_0162236 3300046533 Bacteria 1431
313 Ga0495587_0000126 3300046536 Bacteria 57849
314 Ga0495587_0016503 3300046536 Bacteria 4593
315 Ga0495587_0018672 3300046536 Bacteria 4298
316 Ga0495587_0034811 3300046536 Bacteria 3035
317 Ga0495645_0018616 3300046543 Bacteria 4990
318 Ga0495645_0040139 3300046543 Bacteria 3414
319 Ga0495645_0049044 3300046543 Bacteria 3075
320 Ga0495667_0000123 3300046559 Bacteria 55776
321 Ga0495667_0005676 3300046559 Bacteria 8444
322 Ga0495667_0024018 3300046559 Bacteria 4105
323 Ga0495667_0047062 3300046559 Bacteria 2850
324 Ga0495667_0047416 3300046559 Bacteria 2839
325 Ga0495667_0096151 3300046559 Bacteria 1917
326 Ga0495634_0013575 3300046642 Bacteria 5883
327 Ga0495634_0025430 3300046642 Bacteria 4142
328 Ga0495634_0031351 3300046642 Bacteria 3662
329 Ga0495634_0046472 3300046642 Bacteria 2929
330 Ga0495635_0003979 3300046663 Bacteria 10274
331 Ga0495635_0006344 3300046663 Bacteria 8245
332 Ga0495635_0036900 3300046663 Bacteria 3384
333 Ga0495635_0074739 3300046663 Bacteria 2321
334 Ga0495588_0013820 3300046674 Bacteria 3852
335 Ga0495657_0000164 3300046675 Bacteria 59903
336 Ga0495657_0048146 3300046675 Bacteria 2877
337 Ga0495657_0059118 3300046675 Bacteria 2543
338 Ga0495657_0095350 3300046675 Bacteria 1901
339 Ga0495657_0113653 3300046675 Bacteria 1712
340 Ga0495599_0000096 3300046678 Bacteria 61855
341 Ga0495599_0016286 3300046678 Bacteria 4616
342 Ga0495599_0026632 3300046678 Bacteria 3624
343 Ga0495623_0000243 3300046679 Bacteria 35316
344 Ga0495623_0017848 3300046679 Bacteria 4583
345 Ga0495623_0063717 3300046679 Bacteria 2307
346 Ga0495646_0027232 3300046680 Bacteria 3586
347 Ga0495646_0040201 3300046680 Bacteria 2881
348 Ga0495646_0045947 3300046680 Bacteria 2665
349 Ga0495647_0051760 3300046681 Bacteria 1597
350 Ga0495658_0076385 3300046683 Bacteria 1958
351 Ga0495613_0023513 3300046689 Bacteria 4591
352 Ga0495613_0075878 3300046689 Bacteria 2447
353 Ga0495624_0020085 3300046690 Bacteria 4450
354 Ga0495600_0003363 3300046809 Bacteria 9407
355 Ga0495600_0011396 3300046809 Bacteria 5537
356 Ga0495600_0068109 3300046809 Bacteria 2326
357 Ga0495581_0005534 3300047315 Bacteria 7317
358 Ga0495581_0019829 3300047315 Bacteria 3904
359 Ga0495581_0028749 3300047315 Bacteria 3223
360 Ga0495604_0000141 3300047317 Bacteria 61811
361 Ga0495604_0015711 3300047317 Bacteria 6041
362 Ga0495604_0033529 3300047317 Bacteria 4064
363 Ga0495604_0133836 3300047317 Bacteria 1779
364 Ga0495674_0000921 3300047319 Bacteria 28109
365 Ga0495674_0021122 3300047319 Bacteria 6023
366 Ga0495674_0056564 3300047319 Bacteria 3434
367 Ga0495674_0063732 3300047319 Bacteria 3205
368 Ga0495676_0013276 3300047321 Bacteria 7406
369 Ga0495676_0187842 3300047321 Bacteria 1443
370 Ga0495680_0000874 3300047322 Bacteria 33467
371 Ga0495680_0017113 3300047322 Bacteria 6203
372 Ga0495680_0033433 3300047322 Bacteria 4163
373 Ga0495680_0059386 3300047322 Bacteria 2952
374 Ga0495675_0016882 3300047444 Bacteria 4618
375 Ga0495675_0103782 3300047444 Bacteria 1777
376 Ga0495675_0166073 3300047444 Bacteria 1357
377 Ga0495684_0001898 3300047471 Bacteria 16753
378 Ga0495684_0009060 3300047471 Bacteria 7684
379 Ga0495684_0015156 3300047471 Bacteria 5935
380 Ga0495684_0086460 3300047471 Bacteria 2376
381 Ga0495684_0127420 3300047471 Bacteria 1914
382 Ga0495593_0004138 3300047673 Bacteria 8634
383 Ga0495602_0000189 3300048088 Bacteria 58271
384 Ga0495602_0032490 3300048088 Bacteria 4912
385 Ga0495602_0046174 3300048088 Bacteria 3936
386 Ga0495602_0078347 3300048088 Bacteria 2791
387 Ga0495602_0088621 3300048088 Bacteria 2575
388 Ga0496100_0057178 3300048903 Bacteria 2554
389 Ga0496101_0066767 3300048904 Bacteria 2625
390 Ga0496101_0115516 3300048904 Bacteria 2024
391 Ga0496102_0103674 3300048905 Bacteria 2645
392 Ga0496102_0201281 3300048905 Bacteria 1877
393 Ga0496104_0001843 3300048907 Bacteria 18340
394 Ga0496104_0174257 3300048907 Bacteria 2061
395 Ga0496105_0024968 3300048908 Bacteria 4858
396 Ga0496105_0140857 3300048908 Bacteria 1985
397 Ga0496106_0116961 3300048909 Bacteria 2080
398 Ga0496107_0089003 3300048910 Bacteria 2254
399 Ga0496107_0091765 3300048910 Bacteria 2220
400 Ga0496108_0215702 3300048911 Bacteria 1666
401 Ga0496109_0031639 3300048912 Bacteria 4751
402 Ga0496109_0054464 3300048912 Bacteria 3649
403 Ga0496109_0178142 3300048912 Bacteria 1996
404 Ga0496110_0001726 3300048913 Bacteria 16096
405 Ga0496110_0007706 3300048913 Bacteria 8617
406 Ga0496110_0021583 3300048913 Bacteria 5456
407 Ga0496110_0254212 3300048913 Bacteria 1599
408 Ga0496110_0262219 3300048913 Bacteria 1573
409 Ga0496111_0043079 3300048914 Bacteria 3243
410 Ga0496112_0002530 3300048915 Bacteria 14770
411 Ga0496114_0051359 3300048917 Bacteria 3433
412 Ga0496114_0113226 3300048917 Bacteria 2326
413 Ga0496115_0032672 3300048918 Bacteria 4106
414 Ga0496115_0081306 3300048918 Bacteria 2639
415 Ga0496115_0120003 3300048918 Unclassified 2163
416 Ga0496126_0041020 3300048929 Bacteria 4288
417 Ga0501033_0005697 3300049570 Bacteria 9820
418 Ga0501034_0226101 3300049571 Bacteria 1822
419 Ga0501040_0195599 3300049576 Bacteria 1435
420 Ga0501042_0117988 3300049578 Bacteria 1910
421 Ga0501043_0106178 3300049579 Bacteria 2206
422 Ga0501043_0163726 3300049579 Bacteria 1737
423 Ga0501048_0260878 3300049582 Bacteria 1231
424 Ga0501067_0000186 3300049583 Bacteria 35281
425 Ga0501067_0007567 3300049583 Bacteria 6039
426 Ga0501069_0014860 3300049585 Bacteria 4169
427 Ga0501070_0001163 3300049586 Bacteria 23531
428 Ga0501070_0085824 3300049586 Bacteria 2606
429 Ga0501070_0089525 3300049586 Bacteria 2547
430 Ga0501073_0066282 3300049589 Bacteria 2517
431 Ga0501074_0006228 3300049590 Bacteria 8610
432 Ga0501079_0000971 3300049741 Bacteria 19779
433 Ga0501079_0018741 3300049741 Bacteria 5288
434 Ga0501080_0000278 3300049742 Bacteria 38585
435 Ga0501083_0052819 3300049744 Bacteria 2729
436 Ga0501044_0042122 3300049823 Bacteria 4752
437 nmdc:mga03n38_3638_c1 3300050490 Bacteria 4981
438 nmdc:mga03n38_68866_c1 3300050490 Bacteria 1632
439 nmdc:mga00v17_1839_c1 3300050491 Bacteria 10962
440 nmdc:mga00v17_87633_c1 3300050491 Bacteria 1951
441 nmdc:mga0yw44_85097_c1 3300050492 Bacteria 1989
442 nmdc:mga06z11_28987_c1 3300050494 Bacteria 2662
443 nmdc:mga06z11_99107_c1 3300050494 Bacteria 1596
444 nmdc:mga05p37_174352_c1 3300050507 Bacteria 2621
445 nmdc:mga05p37_5027_c1 3300050507 Bacteria 15495
446 nmdc:mga0qj67_148927_c1 3300050509 Bacteria 1898
447 nmdc:mga08y16_126114_c1 3300050511 Bacteria 2663
448 nmdc:mga0rr50_22725_c1 3300050513 Bacteria 4310
449 nmdc:mga08x19_12800_c1 3300050514 Bacteria 5060
450 nmdc:mga0a205_93339_c1 3300050515 Bacteria 2908
451 nmdc:mga0sz30_17583_c1 3300050516 Bacteria 2853
452 nmdc:mga0sz30_62629_c1 3300050516 Bacteria 1591
453 Ga0495601_0017946 3300053077 Bacteria 4302
454 Ga0495601_0103477 3300053077 Bacteria 1840
455 Ga0495612_0006530 3300053078 Bacteria 4792
456 Ga0495612_0035759 3300053078 Bacteria 2014
457 Ga0500635_0018017 3300053080 Bacteria 2125
458 Ga0495595_0001222 3300053084 Bacteria 9995
459 Ga0495595_0004215 3300053084 Bacteria 5781
460 Ga0495595_0026902 3300053084 Bacteria 2559
461 Ga0495619_0016278 3300053085 Bacteria 4706
462 Ga0466962_0084543 3300061719 Bacteria 1518
463 Ga0530510_0047460 3300061734 Bacteria 3103
464 2506865514 2506783011 Bacteria 5323186
465 2644090707 2643221615 Bacteria 5487866
466 2644320511 2643221657 Bacteria 5490246
467 2644538097 2643221697 Bacteria 3575694
468 2676489135 2675903060 Bacteria 10051191
469 2774378551 2773857758 Bacteria 3592392
470 2774901159 2773857933 Bacteria 5818019
471 2812322446 2811994872 Bacteria 4121241
472 2884702782 2884693830 Bacteria 11273186
473 2895449097 2895442618 Bacteria 11027144
474 2906800826 2906799679 Bacteria 4031749
475 2908678737 2908678064 Bacteria 3482747
476 2919071088 2919069694 Bacteria 3622919
477 2929214245 2929212328 Bacteria 7708288
478 2974298050 2974294766 Bacteria 3767688
479 2974325712 2974324384 Bacteria 3750535
480 2977265900 2977264416 Bacteria 3750737
481 2984576899 2984576629 Bacteria 4248407
482 2984595322 2984592036 Bacteria 3670284
483 2990258647 2990256926 Bacteria 4252839
484 8056063349 8056060235 Bacteria 7259403
485 Ga0373926_0005034
486 JGI24737J22298_10005641
487 Ga0070683_100017361
488 Ga0070683_100171097
489 Ga0070682_100032302
490 Ga0070660_100039490
491 Ga0070659_100021705
492 Ga0070709_10011177
493 Ga0070709_10014866
494 Ga0070714_100000526
495 Ga0070714_100010642
496 Ga0070714_100029576
497 Ga0070714_100038110
498 Ga0070714_100048639
499 Ga0070713_100003751
500 Ga0070713_100036583
501 Ga0070710_10002321
502 Ga0070710_10006274
503 Ga0070710_10051417
504 Ga0070711_100008206
505 Ga0070711_100035546
506 Ga0070711_100091400
507 Ga0070708_100026434
508 Ga0070708_100047121
509 Ga0070708_100063495
510 Ga0070706_100005959
511 Ga0070706_100013802
512 Ga0070706_100015699
513 Ga0070706_100028692
514 Ga0070706_100090675
515 Ga0070706_100206311
516 Ga0070707_100000127
517 Ga0070707_100001180
518 Ga0070707_100025784
519 Ga0070707_100249192
520 Ga0070698_100002462
521 Ga0070698_100002810
522 Ga0070698_100014078
523 Ga0070698_100072330
524 Ga0070684_100062003
525 Ga0070684_100131825
526 Ga0070696_100065838
527 Ga0070665_100001745
528 Ga0070665_100196512
529 Ga0068855_100003196
530 Ga0070664_100105099
531 Ga0068857_100004898
532 Ga0068857_100078875
533 Ga0068856_100008876
534 Ga0068856_100047753
535 Ga0068856_100089196
536 Ga0070702_100044624
537 Ga0068864_100014834
538 Ga0068863_100048749
539 Ga0068858_100123044
540 Ga0068860_100118980
541 Ga0068860_100200421
542 Ga0081455_10020473
543 Ga0081540_1002330
544 Ga0081540_1016528
545 Ga0081539_10002008
546 Ga0070717_10111550
547 Ga0075365_10000189
548 Ga0075365_10002346
549 Ga0075365_10012029
550 Ga0075363_100000630
551 Ga0075363_100038494
552 Ga0075363_100061583
553 Ga0075363_100067962
554 Ga0075364_10001416
555 Ga0075364_10024742
556 Ga0075364_10036265
557 Ga0075364_10042605
558 Ga0075364_10074153
559 Ga0070715_10002562
560 Ga0070716_100001777
561 Ga0070716_100011764
562 Ga0070716_100040485
563 Ga0070712_100023717
564 Ga0070712_100049787
565 Ga0075367_10002790
566 Ga0075369_10003346
567 Ga0075370_10007955
568 Ga0075370_10045595
569 Ga0075428_100034318
570 Ga0075428_100084581
571 Ga0075431_100014188
572 Ga0075431_100158252
573 Ga0075433_10028383
574 Ga0075434_100028737
575 Ga0068865_100024740
576 Ga0075436_100008756
577 Ga0075436_100057634
578 Ga0075435_100005309
579 Ga0075435_100025516
580 Ga0105245_10001875
581 Ga0114129_10001931
582 Ga0114129_10004583
583 Ga0105248_10003471
584 Ga0105237_10012012
585 Ga0105238_10222463
586 Ga0105249_10018486
587 Ga0105249_10325182
588 Ga0105239_10084008
589 Ga0157369_10046817
590 Ga0163162_10258505
591 Ga0157375_10003685
592 Ga0157375_10369156
593 Ga0163163_10098501
594 Ga0157379_10002556
595 Ga0213876_10019693
596 Ga0213875_10030333
597 Ga0207692_10007834
598 Ga0207692_10009411
599 Ga0207699_10000723
600 Ga0207699_10003044
601 Ga0207699_10004441
602 Ga0207643_10034610
603 Ga0207684_10001782
604 Ga0207684_10011796
605 Ga0207671_10007956
606 Ga0207693_10036188
607 Ga0207693_10058949
608 Ga0207693_10111753
609 Ga0207663_10011430
610 Ga0207663_10027859
611 Ga0207662_10031620
612 Ga0207657_10084327
613 Ga0207646_10000264
614 Ga0207646_10001334
615 Ga0207646_10003773
616 Ga0207646_10026051
617 Ga0207646_10157834
618 Ga0207687_10012627
619 Ga0207700_10003000
620 Ga0207700_10005604
621 Ga0207700_10013984
622 Ga0207700_10031952
623 Ga0207700_10080405
624 Ga0207664_10002040
625 Ga0207664_10007914
626 Ga0207664_10019554
627 Ga0207664_10035807
628 Ga0207690_10033498
629 Ga0207665_10004765
630 Ga0207665_10014219
631 Ga0207665_10146804
632 Ga0207711_10002035
633 Ga0207689_10043314
634 Ga0207661_10103551
635 Ga0207679_10097452
636 Ga0207667_10003875
637 Ga0207677_10236145
638 Ga0207703_10075010
639 Ga0207641_10096044
640 Ga0207674_10002647
641 Ga0207674_10004074
642 Ga0207674_10042289
643 Ga0207428_10015813
644 Ga0268266_10011077
645 Ga0268264_10040270
646 Ga0265337_1000047
647 Ga0265326_10004458
648 Ga0265319_1010152
649 Ga0265334_10000196
650 Ga0265338_10000315
651 Ga0265338_10004007
652 Ga0265338_10013005
653 Ga0265324_10003734
654 Ga0265332_10000555
655 Ga0265320_10001951
656 Ga0265325_10012168
657 Ga0265340_10005298
658 Ga0265339_10033366
659 Ga0265314_10007466
660 Ga0265342_10011381
661 Ga0316576_10013494
662 Ga0316578_10009742
663 Ga0307410_10009623
664 Ga0307407_10003878
665 Ga0307409_100000649
666 Ga0307416_100045327
667 Ga0307415_100000600
668 Ga0373948_0002505
669 Ga0373926_0004231
670 Ga0373934_0000561
671 Ga0373934_0004892
672 Ga0373934_0009784
673 Ga0373940_0006868
674 Ga0373944_0004380
675 Ga0373923_0002025
676 Ga0373923_0006485
677 Ga0373936_0000347
678 Ga0373936_0026672
679 Ga0373939_0014392
680 Ga0373953_0000233
681 Ga0373953_0013097
682 Ga0373953_0070663
683 Ga0373954_0000481
684 Ga0373954_0012350
685 Ga0373954_0028913
686 Ga0373954_0036834
687 Ga0373956_0001048
688 Ga0373956_0003076
689 Ga0373956_0023416
690 Ga0373957_0000738
691 Ga0373957_0004674
692 Ga0373957_0015517
693 Ga0373943_0000269
694 Ga0373946_0002656
695 Ga0373946_0045579
696 Ga0373955_0001112
697 Ga0373955_0005070
698 Ga0316574_0047149
699 Ga0316574_0080754
700 Ga0373924_0004987
701 Ga0373924_0031240
702 Ga0373924_0035749
703 Ga0373935_0000373
704 Ga0373935_0006429
705 Ga0373935_0044280
706 Ga0373927_0003404
707 Ga0373933_0000079
708 Ga0373933_0001758
709 Ga0373933_0004437
710 Ga0373933_0014534
711 Ga0373933_0044033
712 Ga0373933_0096785
713 Ga0373947_0000007
714 Ga0373947_0005634
715 Ga0373937_0000189
716 Ga0373937_0022234
717 Ga0373937_0032811
718 Ga0373937_0083590
719 Ga0373937_0206248
720 Ga0316584_0001229
721 Ga0373925_0001710
722 Ga0373925_0049696
723 Ga0373925_0081340
724 Ga0373925_0135597
725 Ga0373925_0184714
726 Ga0436364_0106856
727 Ga0436364_0209569
728 Ga0436364_0986170
729 Ga0436365_0393187
730 Ga0436365_1691907
731 Ga0439465_0001921
732 Ga0466965_0013948
733 Ga0466966_0014087
734 Ga0466961_0010863
735 Ga0466961_0096181
736 Ga0466964_0008073
737 Ga0466970_0016154
738 Ga0466957_0017570
739 Ga0466957_0033702
740 Ga0466960_0007045
741 Ga0466960_0031858
742 Ga0466959_0004319
743 Ga0466959_0032689
744 Ga0466958_0011794
745 Ga0466958_0018646
746 Ga0466958_0137602
747 Ga0466967_0043217
748 Ga0466967_0047308
749 Ga0466967_0224724
750 Ga0466967_0226818
751 Ga0495592_0000154
752 Ga0495592_0076931
753 Ga0495592_0101656
754 Ga0495629_0003669
755 Ga0495629_0009680
756 Ga0495641_0003291
757 Ga0495641_0011293
758 Ga0495651_0001468
759 Ga0495651_0065663
760 Ga0495651_0095120
761 Ga0495651_0176822
762 Ga0495651_0197307
763 Ga0495653_0005775
764 Ga0495653_0034000
765 Ga0495653_0117350
766 Ga0495582_0006221
767 Ga0495582_0086486
768 Ga0495582_0158307
769 Ga0495639_0026077
770 Ga0495662_0010098
771 Ga0495662_0091118
772 Ga0495664_0000535
773 Ga0495664_0007516
774 Ga0495664_0011653
775 Ga0495664_0017428
776 Ga0495608_0000123
777 Ga0495608_0020301
778 Ga0495608_0032142
779 Ga0495608_0061103
780 Ga0495618_0013261
781 Ga0495618_0016971
782 Ga0495618_0026855
783 Ga0495628_0002772
784 Ga0495628_0082037
785 Ga0495630_0011233
786 Ga0495666_0082163
787 Ga0495652_0000278
788 Ga0495652_0041137
789 Ga0495652_0088949
790 Ga0495652_0090494
791 Ga0495652_0140879
792 Ga0495665_0002309
793 Ga0495665_0022190
794 Ga0495640_0009144
795 Ga0495640_0030704
796 Ga0495640_0162236
797 Ga0495587_0000126
798 Ga0495587_0016503
799 Ga0495587_0018672
800 Ga0495587_0034811
801 Ga0495645_0018616
802 Ga0495645_0040139
803 Ga0495645_0049044
804 Ga0495667_0000123
805 Ga0495667_0005676
806 Ga0495667_0024018
807 Ga0495667_0047062
808 Ga0495667_0047416
809 Ga0495667_0096151
810 Ga0495634_0013575
811 Ga0495634_0025430
812 Ga0495634_0031351
813 Ga0495634_0046472
814 Ga0495635_0003979
815 Ga0495635_0006344
816 Ga0495635_0036900
817 Ga0495635_0074739
818 Ga0495588_0013820
819 Ga0495657_0000164
820 Ga0495657_0048146
821 Ga0495657_0059118
822 Ga0495657_0095350
823 Ga0495657_0113653
824 Ga0495599_0000096
825 Ga0495599_0016286
826 Ga0495599_0026632
827 Ga0495623_0000243
828 Ga0495623_0017848
829 Ga0495623_0063717
830 Ga0495646_0027232
831 Ga0495646_0040201
832 Ga0495646_0045947
833 Ga0495647_0051760
834 Ga0495658_0076385
835 Ga0495613_0023513
836 Ga0495613_0075878
837 Ga0495624_0020085
838 Ga0495600_0003363
839 Ga0495600_0011396
840 Ga0495600_0068109
841 Ga0495581_0005534
842 Ga0495581_0019829
843 Ga0495581_0028749
844 Ga0495604_0000141
845 Ga0495604_0015711
846 Ga0495604_0033529
847 Ga0495604_0133836
848 Ga0495674_0000921
849 Ga0495674_0021122
850 Ga0495674_0056564
851 Ga0495674_0063732
852 Ga0495676_0013276
853 Ga0495676_0187842
854 Ga0495680_0000874
855 Ga0495680_0017113
856 Ga0495680_0033433
857 Ga0495680_0059386
858 Ga0495675_0016882
859 Ga0495675_0103782
860 Ga0495675_0166073
861 Ga0495684_0001898
862 Ga0495684_0009060
863 Ga0495684_0015156
864 Ga0495684_0086460
865 Ga0495684_0127420
866 Ga0495593_0004138
867 Ga0495602_0000189
868 Ga0495602_0032490
869 Ga0495602_0046174
870 Ga0495602_0078347
871 Ga0495602_0088621
872 Ga0496100_0057178
873 Ga0496101_0066767
874 Ga0496101_0115516
875 Ga0496102_0103674
876 Ga0496102_0201281
877 Ga0496104_0001843
878 Ga0496104_0174257
879 Ga0496105_0024968
880 Ga0496105_0140857
881 Ga0496106_0116961
882 Ga0496107_0089003
883 Ga0496107_0091765
884 Ga0496108_0215702
885 Ga0496109_0031639
886 Ga0496109_0054464
887 Ga0496109_0178142
888 Ga0496110_0001726
889 Ga0496110_0007706
890 Ga0496110_0021583
891 Ga0496110_0254212
892 Ga0496110_0262219
893 Ga0496111_0043079
894 Ga0496112_0002530
895 Ga0496114_0051359
896 Ga0496114_0113226
897 Ga0496115_0032672
898 Ga0496115_0081306
899 Ga0496115_0120003
900 Ga0496126_0041020
901 Ga0501033_0005697
902 Ga0501034_0226101
903 Ga0501040_0195599
904 Ga0501042_0117988
905 Ga0501043_0106178
906 Ga0501043_0163726
907 Ga0501048_0260878
908 Ga0501067_0000186
909 Ga0501067_0007567
910 Ga0501069_0014860
911 Ga0501070_0001163
912 Ga0501070_0085824
913 Ga0501070_0089525
914 Ga0501073_0066282
915 Ga0501074_0006228
916 Ga0501079_0000971
917 Ga0501079_0018741
918 Ga0501080_0000278
919 Ga0501083_0052819
920 Ga0501044_0042122
921 nmdc:mga03n38_3638_c1
922 nmdc:mga03n38_68866_c1
923 nmdc:mga00v17_1839_c1
924 nmdc:mga00v17_87633_c1
925 nmdc:mga0yw44_85097_c1
926 nmdc:mga06z11_28987_c1
927 nmdc:mga06z11_99107_c1
928 nmdc:mga05p37_174352_c1
929 nmdc:mga05p37_5027_c1
930 nmdc:mga0qj67_148927_c1
931 nmdc:mga08y16_126114_c1
932 nmdc:mga0rr50_22725_c1
933 nmdc:mga08x19_12800_c1
934 nmdc:mga0a205_93339_c1
935 nmdc:mga0sz30_17583_c1
936 nmdc:mga0sz30_62629_c1
937 Ga0495601_0017946
938 Ga0495601_0103477
939 Ga0495612_0006530
940 Ga0495612_0035759
941 Ga0500635_0018017
942 Ga0495595_0001222
943 Ga0495595_0004215
944 Ga0495595_0026902
945 Ga0495619_0016278
946 Ga0466962_0084543
947 Ga0530510_0047460
948 2506865514
949 2644090707
950 2644320511
951 2644538097
952 2676489135
953 2774378551
954 2774901159
955 2812322446
956 2884702782
957 2895449097
958 2906800826
959 2908678737
960 2919071088
961 2929214245
962 2974298050
963 2974325712
964 2977265900
965 2984576899
966 2984595322
967 2990258647
968 8056063349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

293

506

0.93

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

31

94

0.93

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

120

299

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o15-assembly1.cif.gz_A mycobacterium tuberculosis epsp synthase after partial products withdrawal 0.9227 4 428
2o15-assembly1.cif.gz_A mycobacterium tuberculosis epsp synthase after partial products withdrawal 0.9206 4 428
7tm4-assembly1.cif.gz_A crystal structure of apo 3-phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae 0.9136 5 428
7tm4-assembly1.cif.gz_A crystal structure of apo 3-phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae 0.9074 5 428
7tbu-assembly2.cif.gz_B crystal structure of the 5-enolpyruvate-shikimate-3-phosphate synthase (epsps) domain of aro1 from candida albicans in complex with shikimate-3-phosphate 0.9073 14 410
ID Description Score Start End Superfamily
af_P9WPY5_236_421_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.9756 242 424 1.20.200.10
2o0eA01 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9717 245 428 3.65.10.10
af_P9WPY5_236_421_1.20.200.10 Mainly Alpha;Up-down Bundle;Fumarase C; Chain A, domain 2;Fumarase/aspartase (Central domain) 0.955 242 424 1.20.200.10
af_Q57925_221_429_3.65.10.10 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9453 233 428 3.65.10.10
1g6sA01 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9325 245 428 3.65.10.10
ID Description Score Start End GO Terms
AF-A0A0F7FX65-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase 0.9906 264 423 GO:0003866
GO:0009423
AF-A0A6B3H562-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase 0.9906 98 209 GO:0003866
GO:0009423
AF-A0A7J0CZ36-F1-model_v4 Enolpyruvate transferase domain-containing protein 0.9876 259 426 GO:0003866
GO:0009423
AF-A0A2G4G6L7-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase 0.9856 305 428 GO:0003866
GO:0009423
AF-W0Z9A9-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) 0.9833 302 426 GO:0003866
GO:0009423

Map