F453043

General Info

Members Datasets Scaffolds Average Seq Length
485 251 970 284

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10164954|Ga0065712_101649542
Length 307
Sequence MIRLYGLVYFIQQLAFSAKTIYTMKDQKPRKLDIVVISDVHLGTYGCHAKELLCYLKSIRPKTLILNGDFVDIWQFSKRYWPKSHMKVVKQITKMISKGIKVYYVTGNHDEMLRKFEGFKLGSFQIVNKLLLELDNGEKAWIFHGDVFDVTMKHSRWLAKLGAVGYDLLILLNSFVNYTSERILKKGKISLSKKIKNSVKKAVSFIDDFEQTAADIGIYNNYSYVICGHIHHPQMKMIENSEGRIVYLNSGDWIENLTALEYSKGNWNIYQYQEKEFAHADLNDDDELSTTELFDNMVKEFDLLKAV

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
118 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
119 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
120 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
143 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
192 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
193 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
194 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
195 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
196 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
197 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
198 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
208 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
211 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
217 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
218 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
219 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
220 2738541283 Pedobacter sp. OK701 Isolate Unclassified
221 2738541284 Pedobacter sp. YR016 Isolate Unclassified
222 2738541302 Pedobacter sp. CF074 Isolate Unclassified
223 2738543023 Pedobacter sp. OK628 Isolate Unclassified
224 2739367651 Pedobacter sp. OK291 Isolate Unclassified
225 2739367656 Pedobacter sp. CF523 Isolate Unclassified
226 2739367663 Pedobacter sp. YR510 Isolate Unclassified
227 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
228 2818991437 Pedobacter terrae 518 Isolate Unclassified
229 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
230 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
231 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
232 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
233 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
234 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
235 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
236 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
237 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
238 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
239 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
240 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
241 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
242 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
243 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
244 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
245 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
246 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
247 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
248 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
249 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
250 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
251 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.58
Metatranscriptomes 0.41
Isolates 7.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 0
Rhizoplane 0.82
Rhizosphere 77.11
Stem 0
Stem Tuber 0
Unclassified 2.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10164954 3300005290 Bacteria 1278
2 SwRhRL2b_contig_1762462 2162886007 Bacteria 256265
3 JGI24735J21928_10000015 3300002067 Bacteria 167231
4 JGI25162J39368_1000016 3300002737 Bacteria 288734
5 JGI25162J39368_1000866 3300002737 Bacteria 19829
6 JGI25152J39213_1000300 3300002773 Bacteria 31900
7 JGI25150J39212_1000023 3300002774 Bacteria 130663
8 JGI25151J46595_10000082 3300003187 Bacteria 130832
9 JGI25165J46597_1001134 3300003214 Bacteria 16713
10 JGI25153J46596_10000060 3300003215 Bacteria 131744
11 rootH1_10000428 3300003316 Bacteria 39625
12 rootH1_10013947 3300003316 Bacteria 8478
13 rootH1_10034433 3300003316 Bacteria 16075
14 rootH1_10123889 3300003316 Bacteria 3234
15 rootH2_10009276 3300003320 Bacteria 41219
16 rootH2_10047461 3300003320 Bacteria 5913
17 rootH2_10105521 3300003320 Bacteria 2204
18 rootH2_10198930 3300003320 Bacteria 1991
19 rootL2_10006331 3300003322 Bacteria 36194
20 rootL2_10102636 3300003322 Bacteria 10012
21 rootL2_10125346 3300003322 Bacteria 1465
22 rootL2_10194838 3300003322 Unclassified 2943
23 rootL2_10199322 3300003322 Bacteria 2840
24 rootH1_10003399 3300003323 Bacteria 54122
25 rootH1_10005185 3300003323 Bacteria 15491
26 rootH1_10010280 3300003323 Bacteria 25170
27 rootH1_10016834 3300003323 Bacteria 4138
28 rootH1_10016835 3300003323 Bacteria 2241
29 rootH1_10026116 3300003323 Bacteria 22314
30 rootH1_10055014 3300003323 Bacteria 1762
31 rootH1_10061130 3300003323 Bacteria 27123
32 rootH1_10065583 3300003323 Bacteria 19600
33 rootH1_10079729 3300003323 Bacteria 6006
34 rootH1_10100344 3300003323 Unclassified 3356
35 rootH1_10174448 3300003323 Unclassified 4422
36 Ga0055536_1000002 3300003781 Bacteria 605605
37 Ga0055530_10001421 3300003791 Bacteria 17576
38 Ga0055531_10000287 3300003794 Bacteria 50954
39 Ga0058862_12302803 3300004803 Bacteria 1754
40 Ga0065165_1001313 3300005262 Bacteria 27754
41 Ga0065714_10002204 3300005288 Bacteria 57902
42 Ga0065714_10002553 3300005288 Bacteria 19114
43 Ga0065714_10007689 3300005288 Bacteria 3481
44 Ga0065714_10007833 3300005288 Bacteria 4607
45 Ga0065714_10015308 3300005288 Bacteria 4329
46 Ga0065714_10131349 3300005288 Bacteria 1247
47 Ga0065714_10150540 3300005288 Bacteria 1109
48 Ga0065704_10000188 3300005289 Bacteria 267216
49 Ga0065704_10001732 3300005289 Bacteria 6723
50 Ga0065704_10006409 3300005289 Bacteria 4105
51 Ga0065704_10072149 3300005289 Bacteria 9061
52 Ga0070658_10006144 3300005327 Bacteria 9741
53 Ga0070683_100319255 3300005329 Bacteria 1478
54 Ga0070690_100096244 3300005330 Bacteria 1956
55 Ga0070670_100009693 3300005331 Bacteria 8222
56 Ga0070670_100504946 3300005331 Bacteria 1076
57 Ga0070680_100065076 3300005336 Bacteria 2988
58 Ga0070682_100006134 3300005337 Bacteria 6732
59 Ga0070660_100182562 3300005339 Bacteria 1698
60 Ga0070661_100313666 3300005344 Bacteria 1223
61 Ga0070668_100523284 3300005347 Bacteria 1029
62 Ga0070659_100090664 3300005366 Bacteria 2450
63 Ga0070663_100085742 3300005455 Bacteria 2324
64 Ga0070681_10048767 3300005458 Bacteria 4230
65 Ga0070681_10113532 3300005458 Bacteria 2648
66 Ga0070679_100457246 3300005530 Bacteria 1221
67 Ga0070684_100165640 3300005535 Bacteria 2006
68 Ga0068853_100051494 3300005539 Bacteria 3544
69 Ga0068853_100090283 3300005539 Bacteria 2692
70 Ga0070665_100000061 3300005548 Bacteria 222138
71 Ga0070665_100001020 3300005548 Bacteria 35168
72 Ga0070665_100256672 3300005548 Bacteria 1749
73 Ga0070665_100763166 3300005548 Bacteria 980
74 Ga0068855_100000074 3300005563 Bacteria 119759
75 Ga0068855_100017943 3300005563 Bacteria 8503
76 Ga0068855_100303912 3300005563 Bacteria 1766
77 Ga0068855_100316861 3300005563 Bacteria 1725
78 Ga0068855_100331748 3300005563 Bacteria 1679
79 Ga0068857_100087534 3300005577 Bacteria 2786
80 Ga0068854_100042783 3300005578 Bacteria 3208
81 Ga0068854_100071901 3300005578 Bacteria 2532
82 Ga0068856_100033530 3300005614 Bacteria 5028
83 Ga0068856_100046164 3300005614 Bacteria 4291
84 Ga0068856_100047619 3300005614 Bacteria 4224
85 Ga0068856_100049718 3300005614 Bacteria 4132
86 Ga0068852_100340122 3300005616 Bacteria 1462
87 Ga0068852_100393268 3300005616 Bacteria 1362
88 Ga0068859_100000272 3300005617 Bacteria 51348
89 Ga0068859_100190473 3300005617 Bacteria 2135
90 Ga0068858_100453248 3300005842 Bacteria 1236
91 Ga0068862_100207461 3300005844 Bacteria 1769
92 Ga0075366_10000170 3300006195 Bacteria 27881
93 Ga0075366_10005159 3300006195 Bacteria 7067
94 Ga0075429_100015472 3300006880 Bacteria 6610
95 Ga0097620_100000272 3300006931 Bacteria 51348
96 Ga0097620_100093992 3300006931 Bacteria 3050
97 Ga0097620_100190471 3300006931 Bacteria 2135
98 Ga0105244_10097085 3300009036 Bacteria 1444
99 Ga0105240_10000066 3300009093 Bacteria 212612
100 Ga0105240_10000082 3300009093 Bacteria 195184
101 Ga0105240_10001333 3300009093 Bacteria 42441
102 Ga0105240_10014355 3300009093 Bacteria 10816
103 Ga0105240_10056121 3300009093 Bacteria 4929
104 Ga0105240_10188862 3300009093 Bacteria 2424
105 Ga0105240_10240960 3300009093 Bacteria 2096
106 Ga0105240_10623136 3300009093 Bacteria 1185
107 Ga0105240_10760491 3300009093 Unclassified 1053
108 Ga0111539_10137145 3300009094 Bacteria 2865
109 Ga0111539_10275785 3300009094 Bacteria 1957
110 Ga0114129_10018647 3300009147 Bacteria 9879
111 Ga0105243_10000004 3300009148 Bacteria 601266
112 Ga0105243_10031449 3300009148 Bacteria 4092
113 Ga0105241_10009078 3300009174 Bacteria 7315
114 Ga0105241_10021457 3300009174 Bacteria 4773
115 Ga0105241_10035417 3300009174 Bacteria 3754
116 Ga0105241_10056412 3300009174 Bacteria 3011
117 Ga0105241_10324125 3300009174 Bacteria 1329
118 Ga0105242_10541681 3300009176 Bacteria 1114
119 Ga0105237_10000310 3300009545 Bacteria 67887
120 Ga0105237_10007457 3300009545 Bacteria 11970
121 Ga0105237_10009371 3300009545 Bacteria 10489
122 Ga0105237_10052440 3300009545 Bacteria 4094
123 Ga0105237_10078416 3300009545 Bacteria 3293
124 Ga0105237_10168228 3300009545 Bacteria 2191
125 Ga0105237_10172748 3300009545 Bacteria 2161
126 Ga0105238_10045351 3300009551 Bacteria 4441
127 Ga0105238_10325296 3300009551 Bacteria 1524
128 Ga0105238_10668365 3300009551 Bacteria 1050
129 Ga0105249_10183886 3300009553 Bacteria 2035
130 Ga0105249_10589779 3300009553 Bacteria 1165
131 Ga0105239_10000009 3300010375 Bacteria 361182
132 Ga0105239_10000049 3300010375 Bacteria 177578
133 Ga0105239_10001076 3300010375 Bacteria 37960
134 Ga0105239_10003303 3300010375 Bacteria 19863
135 Ga0105239_10008608 3300010375 Bacteria 11568
136 Ga0105239_10008871 3300010375 Bacteria 11379
137 Ga0105239_10009059 3300010375 Bacteria 11263
138 Ga0105239_10024974 3300010375 Bacteria 6582
139 Ga0105239_10025805 3300010375 Bacteria 6471
140 Ga0105239_10141793 3300010375 Unclassified 2678
141 Ga0105239_10403540 3300010375 Bacteria 1547
142 Ga0157373_10000089 3300013100 Bacteria 78449
143 Ga0157373_10005376 3300013100 Bacteria 9618
144 Ga0157373_10014003 3300013100 Bacteria 5880
145 Ga0157373_10020052 3300013100 Bacteria 4864
146 Ga0157373_10037473 3300013100 Bacteria 3475
147 Ga0157373_10339836 3300013100 Bacteria 1070
148 Ga0157371_10000025 3300013102 Bacteria 279746
149 Ga0157371_10000511 3300013102 Bacteria 46681
150 Ga0157371_10007554 3300013102 Bacteria 8783
151 Ga0157371_10009528 3300013102 Bacteria 7636
152 Ga0157371_10013702 3300013102 Bacteria 6149
153 Ga0157371_10033409 3300013102 Bacteria 3696
154 Ga0157371_10067622 3300013102 Bacteria 2529
155 Ga0157370_10002659 3300013104 Bacteria 21448
156 Ga0157370_10014967 3300013104 Bacteria 7909
157 Ga0157370_10040234 3300013104 Bacteria 4513
158 Ga0157370_10049504 3300013104 Bacteria 4021
159 Ga0157370_10072875 3300013104 Bacteria 3240
160 Ga0157370_10080886 3300013104 Bacteria 3058
161 Ga0157370_10126398 3300013104 Bacteria 2386
162 Ga0157370_10156635 3300013104 Bacteria 2119
163 Ga0157370_10290874 3300013104 Bacteria 1509
164 Ga0157370_10467965 3300013104 Bacteria 1158
165 Ga0157369_10000038 3300013105 Bacteria 189078
166 Ga0157369_10004248 3300013105 Bacteria 16965
167 Ga0157369_10044949 3300013105 Bacteria 4805
168 Ga0157369_10101380 3300013105 Bacteria 3068
169 Ga0157369_10377807 3300013105 Bacteria 1471
170 Ga0157378_10006650 3300013297 Bacteria 10102
171 Ga0157378_10028505 3300013297 Bacteria 4928
172 Ga0157378_10042477 3300013297 Bacteria 4036
173 Ga0163162_10000012 3300013306 Bacteria 292674
174 Ga0163162_10000123 3300013306 Bacteria 68905
175 Ga0163162_10010257 3300013306 Bacteria 9103
176 Ga0157372_10000039 3300013307 Bacteria 165839
177 Ga0157372_10000241 3300013307 Bacteria 60488
178 Ga0157372_10001390 3300013307 Bacteria 26087
179 Ga0157372_10024320 3300013307 Bacteria 6578
180 Ga0157372_10035628 3300013307 Bacteria 5479
181 Ga0157372_10047927 3300013307 Bacteria 4749
182 Ga0157372_10069376 3300013307 Bacteria 3964
183 Ga0157372_10075801 3300013307 Bacteria 3796
184 Ga0157372_10166305 3300013307 Bacteria 2551
185 Ga0157372_10172189 3300013307 Bacteria 2505
186 Ga0157372_10389845 3300013307 Bacteria 1623
187 Ga0157372_10443063 3300013307 Bacteria 1514
188 Ga0157375_10012196 3300013308 Bacteria 7617
189 Ga0157375_10014406 3300013308 Bacteria 7053
190 Ga0157375_10124046 3300013308 Bacteria 2696
191 Ga0163163_10044177 3300014325 Bacteria 4370
192 Ga0157380_10066264 3300014326 Bacteria 2904
193 Ga0182008_10000020 3300014497 Bacteria 228333
194 Ga0182008_10000052 3300014497 Bacteria 103193
195 Ga0182008_10000170 3300014497 Bacteria 50871
196 Ga0182008_10073976 3300014497 Bacteria 1676
197 Ga0182006_1000270 3300015261 Bacteria 46578
198 Ga0182006_1000276 3300015261 Bacteria 45977
199 Ga0182006_1001187 3300015261 Bacteria 16320
200 Ga0182006_1002937 3300015261 Bacteria 9019
201 Ga0182007_10000024 3300015262 Bacteria 181761
202 Ga0182007_10044537 3300015262 Bacteria 1472
203 Ga0183373_1002 3300015682 Bacteria 990153
204 Ga0163161_10000093 3300017792 Bacteria 90618
205 Ga0163161_10000094 3300017792 Bacteria 90423
206 Ga0163161_10001375 3300017792 Bacteria 18039
207 Ga0163161_10010803 3300017792 Bacteria 6327
208 Ga0163161_10032876 3300017792 Bacteria 3705
209 Ga0163161_10099575 3300017792 Bacteria 2162
210 Ga0206351_10116577 3300020077 Bacteria 1438
211 Ga0213872_10152853 3300021361 Bacteria 1007
212 Ga0207427_100122 3300025231 Bacteria 99064
213 Ga0209437_100048 3300025233 Bacteria 405107
214 Ga0209437_100119 3300025233 Bacteria 206549
215 Ga0207425_1000051 3300025245 Bacteria 166795
216 Ga0209026_1000304 3300025250 Bacteria 53704
217 Ga0209129_1000121 3300025258 Bacteria 135404
218 Ga0209129_1016863 3300025258 Bacteria 1452
219 Ga0209233_1000029 3300025261 Bacteria 641642
220 Ga0209233_1004779 3300025261 Bacteria 4564
221 Ga0209455_1004796 3300025272 Bacteria 4328
222 Ga0209676_1000022 3300025292 Bacteria 605659
223 Ga0209025_1000160 3300025294 Bacteria 166795
224 Ga0209758_1000147 3300025297 Bacteria 166795
225 Ga0209050_1000020 3300025298 Bacteria 605671
226 Ga0209050_1008089 3300025298 Bacteria 5709
227 Ga0209257_1000006 3300025304 Bacteria 1570111
228 Ga0207647_10000256 3300025904 Bacteria 43702
229 Ga0207647_10018432 3300025904 Bacteria 4720
230 Ga0207647_10106557 3300025904 Unclassified 1659
231 Ga0207705_10066007 3300025909 Bacteria 2617
232 Ga0207705_10109677 3300025909 Bacteria 2038
233 Ga0207707_10003763 3300025912 Bacteria 13445
234 Ga0207695_10000053 3300025913 Bacteria 396740
235 Ga0207695_10000078 3300025913 Bacteria 297378
236 Ga0207695_10003291 3300025913 Bacteria 22952
237 Ga0207695_10018400 3300025913 Bacteria 8080
238 Ga0207695_10022995 3300025913 Bacteria 7059
239 Ga0207695_10099538 3300025913 Bacteria 2905
240 Ga0207695_10163907 3300025913 Bacteria 2152
241 Ga0207695_10248135 3300025913 Bacteria 1680
242 Ga0207671_10000298 3300025914 Bacteria 73044
243 Ga0207671_10000366 3300025914 Bacteria 64454
244 Ga0207671_10000925 3300025914 Bacteria 36841
245 Ga0207671_10007835 3300025914 Bacteria 9180
246 Ga0207671_10049768 3300025914 Bacteria 3102
247 Ga0207671_10052325 3300025914 Bacteria 3026
248 Ga0207671_10093179 3300025914 Bacteria 2272
249 Ga0207660_10163179 3300025917 Bacteria 1721
250 Ga0207657_10105867 3300025919 Bacteria 2328
251 Ga0207657_10287979 3300025919 Bacteria 1303
252 Ga0207652_10056206 3300025921 Bacteria 3388
253 Ga0207652_10059778 3300025921 Bacteria 3286
254 Ga0207694_10326178 3300025924 Bacteria 1268
255 Ga0207650_10001645 3300025925 Bacteria 15921
256 Ga0207650_10355542 3300025925 Unclassified 1206
257 Ga0207644_10007855 3300025931 Bacteria 6970
258 Ga0207690_10038238 3300025932 Bacteria 3122
259 Ga0207709_10000010 3300025935 Bacteria 601305
260 Ga0207661_10317036 3300025944 Bacteria 1401
261 Ga0207667_10000014 3300025949 Bacteria 421261
262 Ga0207667_10000274 3300025949 Bacteria 71328
263 Ga0207667_10008386 3300025949 Bacteria 12280
264 Ga0207667_10023957 3300025949 Bacteria 6715
265 Ga0207667_10117429 3300025949 Bacteria 2742
266 Ga0207667_10154923 3300025949 Bacteria 2358
267 Ga0207640_10097857 3300025981 Unclassified 2049
268 Ga0207640_10413466 3300025981 Bacteria 1102
269 Ga0207703_10117350 3300026035 Bacteria 2280
270 Ga0207703_10467729 3300026035 Bacteria 1180
271 Ga0207639_10047672 3300026041 Bacteria 3240
272 Ga0207639_10062748 3300026041 Bacteria 2875
273 Ga0207678_10142918 3300026067 Bacteria 2042
274 Ga0207702_10036427 3300026078 Bacteria 4115
275 Ga0207702_10037437 3300026078 Bacteria 4061
276 Ga0207702_10044099 3300026078 Bacteria 3747
277 Ga0207702_10149098 3300026078 Bacteria 2126
278 Ga0207702_10291775 3300026078 Bacteria 1545
279 Ga0207702_10321537 3300026078 Bacteria 1473
280 Ga0207641_10023895 3300026088 Bacteria 5039
281 Ga0207648_10138436 3300026089 Bacteria 2145
282 Ga0207674_10072885 3300026116 Bacteria 3449
283 Ga0207698_10203921 3300026142 Bacteria 1773
284 Ga0207698_10243091 3300026142 Bacteria 1642
285 Ga0207428_10165457 3300027907 Bacteria 1677
286 Ga0268266_10000053 3300028379 Bacteria 295181
287 Ga0268266_10001833 3300028379 Bacteria 24026
288 Ga0307515_10000001 3300028794 Bacteria 4259510
289 Ga0307515_10000016 3300028794 Bacteria 554870
290 Ga0307515_10000316 3300028794 Bacteria 119243
291 Ga0307515_10001308 3300028794 Bacteria 56577
292 Ga0307515_10207796 3300028794 Bacteria 1812
293 Ga0307515_10212349 3300028794 Bacteria 1776
294 Ga0265338_10105050 3300028800 Bacteria 2290
295 Ga0265338_10197563 3300028800 Bacteria 1519
296 Ga0265324_10006646 3300029957 Bacteria 4784
297 Ga0316177_1066261 3300030731 Bacteria 12027
298 Ga0316176_1102297 3300030732 Bacteria 14584
299 Ga0316183_1153674 3300030742 Bacteria 79729
300 Ga0316181_1001096 3300030744 Bacteria 4407
301 Ga0265331_10109396 3300031250 Bacteria 1268
302 Ga0265327_10000006 3300031251 Bacteria 693716
303 Ga0265327_10000013 3300031251 Bacteria 519549
304 Ga0265327_10000228 3300031251 Bacteria 114387
305 Ga0307513_10134206 3300031456 Bacteria 2414
306 Ga0307408_100000889 3300031548 Bacteria 23506
307 Ga0307408_100001538 3300031548 Bacteria 17127
308 Ga0307408_100003026 3300031548 Bacteria 11610
309 Ga0307408_100056973 3300031548 Bacteria 2835
310 Ga0265342_10185149 3300031712 Bacteria 1139
311 Ga0307405_10000011 3300031731 Bacteria 241071
312 Ga0316577_10050394 3300031733 Unclassified 2324
313 Ga0307407_10000018 3300031903 Bacteria 135979
314 Ga0307412_10000001 3300031911 Bacteria 822691
315 Ga0307412_10004065 3300031911 Bacteria 8150
316 Ga0307412_10106720 3300031911 Bacteria 1992
317 Ga0307409_100007913 3300031995 Bacteria 6403
318 Ga0307416_100000050 3300032002 Bacteria 116313
319 Ga0307416_100277840 3300032002 Bacteria 1649
320 Ga0307414_10000816 3300032004 Bacteria 15915
321 Ga0307414_10004830 3300032004 Bacteria 7360
322 Ga0307414_10025228 3300032004 Bacteria 3804
323 Ga0307414_10091015 3300032004 Bacteria 2266
324 Ga0307414_10092388 3300032004 Bacteria 2253
325 Ga0307414_10113908 3300032004 Unclassified 2065
326 Ga0307414_10276225 3300032004 Bacteria 1409
327 Ga0307507_10000337 3300033179 Bacteria 95356
328 Ga0307510_10001184 3300033180 Bacteria 28153
329 Ga0373927_0105157 3300035695 Bacteria 1838
330 Ga0316584_0001440 3300036712 Bacteria 14261
331 Ga0395899_0000282 3300037312 Bacteria 66053
332 Ga0395899_0001270 3300037312 Bacteria 21938
333 Ga0395899_0039694 3300037312 Bacteria 3522
334 Ga0395900_0000195 3300037418 Bacteria 97204
335 Ga0395900_0002423 3300037418 Bacteria 20558
336 Ga0395900_0055381 3300037418 Bacteria 4084
337 Ga0395900_0467557 3300037418 Bacteria 1215
338 Ga0395898_0014682 3300037466 Bacteria 8043
339 Ga0395898_0396359 3300037466 Bacteria 1316
340 Ga0395905_0001272 3300037471 Bacteria 31128
341 Ga0395905_0002456 3300037471 Bacteria 20520
342 Ga0395905_0076270 3300037471 Bacteria 3142
343 Ga0395905_0407966 3300037471 Bacteria 1254
344 Ga0395901_0000644 3300038443 Bacteria 40364
345 Ga0395901_0056799 3300038443 Bacteria 4072
346 Ga0395901_0100689 3300038443 Bacteria 3031
347 Ga0395901_0428910 3300038443 Bacteria 1355
348 Ga0400483_270292 3300039062 Bacteria 1860
349 Ga0400489_08300 3300039093 Archaea 5286
350 Ga0436361_0887739 3300039447 Bacteria 5753
351 Ga0439449_0009241 3300042007 Bacteria 3736
352 Ga0439462_0031620 3300042015 Bacteria 1402
353 Ga0466966_0024501 3300044684 Bacteria 3945
354 Ga0453684_0029777 3300044712 Bacteria 7737
355 Ga0466957_0219227 3300044842 Bacteria 1256
356 Ga0495592_0109311 3300046454 Bacteria 1959
357 Ga0495638_0000036 3300046460 Bacteria 275731
358 Ga0495651_0233501 3300046462 Bacteria 1265
359 Ga0495650_0000144 3300046471 Bacteria 165957
360 Ga0495585_0000091 3300046492 Bacteria 95620
361 Ga0495585_0000642 3300046492 Bacteria 32168
362 Ga0495607_0198071 3300046501 Bacteria 996
363 Ga0495606_0000919 3300046507 Bacteria 43453
364 Ga0495606_0013016 3300046507 Bacteria 6614
365 Ga0495606_0035940 3300046507 Bacteria 3381
366 Ga0495606_0064542 3300046507 Bacteria 2330
367 Ga0495610_0000219 3300046512 Bacteria 61501
368 Ga0495610_0002599 3300046512 Bacteria 14973
369 Ga0495616_0096556 3300046513 Bacteria 1391
370 Ga0495637_0026724 3300046520 Bacteria 2588
371 Ga0495644_0015559 3300046523 Bacteria 2914
372 Ga0495648_0018526 3300046524 Bacteria 4925
373 Ga0495648_0066806 3300046524 Bacteria 2106
374 Ga0495642_0029863 3300046528 Bacteria 2179
375 Ga0495652_0118795 3300046529 Bacteria 2112
376 Ga0495609_0016237 3300046538 Bacteria 3469
377 Ga0495609_0049323 3300046538 Bacteria 1879
378 Ga0495645_0109387 3300046543 Bacteria 1957
379 Ga0495633_0000026 3300046558 Bacteria 204722
380 Ga0495633_0007299 3300046558 Bacteria 6381
381 Ga0495668_0000054 3300046616 Bacteria 203960
382 Ga0495668_0000449 3300046616 Bacteria 52562
383 Ga0495634_0016241 3300046642 Bacteria 5327
384 Ga0495625_0000059 3300046660 Bacteria 180330
385 Ga0495625_0001227 3300046660 Bacteria 32490
386 Ga0495625_0001942 3300046660 Bacteria 23400
387 Ga0495625_0009347 3300046660 Bacteria 8211
388 Ga0495625_0037628 3300046660 Bacteria 3548
389 Ga0495625_0103408 3300046660 Bacteria 1953
390 Ga0495625_0136645 3300046660 Bacteria 1657
391 Ga0495661_0003215 3300046665 Bacteria 12199
392 Ga0495658_0055719 3300046683 Bacteria 2253
393 Ga0495649_0000031 3300046694 Bacteria 151547
394 Ga0495649_0051659 3300046694 Bacteria 2229
395 Ga0495636_0000011 3300047318 Bacteria 87862
396 Ga0495680_0374483 3300047322 Bacteria 987
397 Ga0495683_0043965 3300047323 Bacteria 2247
398 Ga0495687_001100 3300047443 Bacteria 26388
399 Ga0495685_095960 3300047447 Bacteria 980
400 Ga0495681_0113712 3300047470 Bacteria 1169
401 Ga0495686_0000230 3300047472 Bacteria 102747
402 Ga0495686_0000533 3300047472 Bacteria 54324
403 Ga0495686_0002591 3300047472 Bacteria 16802
404 Ga0495614_0036502 3300048089 Bacteria 2110
405 Ga0496114_0004685 3300048917 Bacteria 10637
406 Ga0496115_0002329 3300048918 Bacteria 13612
407 Ga0496115_0123289 3300048918 Bacteria 2133
408 Ga0496116_0010979 3300048919 Bacteria 7542
409 Ga0496117_0001536 3300048920 Bacteria 32827
410 Ga0496122_0000876 3300048925 Bacteria 56653
411 Ga0496123_0019398 3300048926 Bacteria 5361
412 Ga0496123_0059317 3300048926 Bacteria 2475
413 Ga0496125_0077654 3300048928 Bacteria 2558
414 Ga0495678_035096 3300049459 Bacteria 2059
415 Ga0495682_0043051 3300049460 Bacteria 1654
416 Ga0501043_0146613 3300049579 Bacteria 1848
417 Ga0501217_051790 3300049661 Bacteria 1075
418 Ga0501222_000312 3300049662 Bacteria 7702
419 Ga0501242_001440 3300049674 Bacteria 2385
420 Ga0501249_018597 3300049679 Bacteria 1504
421 Ga0501253_012227 3300049683 Bacteria 1339
422 Ga0501257_000664 3300049686 Bacteria 6861
423 Ga0501241_000534 3300049758 Bacteria 8160
424 Ga0501264_000044 3300049761 Bacteria 17523
425 Ga0501035_0116040 3300049822 Bacteria 2343
426 nmdc:mga0k408_1202_c1 3300050493 Bacteria 14176
427 nmdc:mga0k408_82_c1 3300050493 Bacteria 45008
428 nmdc:mga05p37_20345_c1 3300050507 Bacteria 8029
429 nmdc:mga09592_35482_c1 3300050508 Bacteria 4175
430 nmdc:mga06r32_23982_c1 3300050510 Bacteria 5655
431 nmdc:mga08y16_18441_c1 3300050511 Bacteria 7353
432 nmdc:mga08y16_239016_c1 3300050511 Bacteria 1878
433 nmdc:mga08y16_253949_c1 3300050511 Bacteria 1816
434 Ga0500647_0035688 3300053091 Bacteria 2377
435 Ga0500651_0001126 3300053093 Bacteria 13227
436 Ga0500556_0009883 3300053104 Unclassified 2786
437 Ga0500592_009917 3300053116 Unclassified 1515
438 Ga0500608_002212 3300053122 Bacteria 7015
439 Ga0500608_020989 3300053122 Bacteria 3012
440 Ga0500618_000018 3300053125 Bacteria 163272
441 Ga0500618_036621 3300053125 Bacteria 1136
442 Ga0500642_0046343 3300053130 Bacteria 1901
443 Ga0500559_0041595 3300053136 Bacteria 2003
444 Ga0500568_0031471 3300053139 Bacteria 2189
445 Ga0500616_0000004 3300053153 Bacteria 1002714
446 Ga0500616_0000868 3300053153 Bacteria 33454
447 Ga0500616_0028960 3300053153 Bacteria 3050
448 Ga0500616_0109880 3300053153 Bacteria 1333
449 Ga0500622_0001026 3300053156 Bacteria 23406
450 Ga0500624_000264 3300053157 Bacteria 18308
451 Ga0500627_0089500 3300053158 Unclassified 1377
452 2586209950 2585427687 Bacteria 5544917
453 2599481995 2599185184 Bacteria 6430550
454 2738756086 2738541283 Bacteria 7222293
455 2738763292 2738541284 Bacteria 5199923
456 2738852440 2738541302 Bacteria 5944758
457 2739304171 2738543023 Bacteria 6767879
458 2739591452 2739367651 Bacteria 6359826
459 2739615266 2739367656 Bacteria 5152243
460 2739645606 2739367663 Bacteria 5040914
461 2776616102 2775506987 Bacteria 5373360
462 2819549565 2818991437 Bacteria 5805520
463 2833643452 2833640130 Bacteria 4858325
464 2842727320 2842722452 Bacteria 6263924
465 2842904969 2842903701 Bacteria 6986368
466 2842913717 2842909656 Bacteria 6185908
467 2849285451 2849281842 Bacteria 6065644
468 2852625524 2852623160 Bacteria 4376875
469 2852630654 2852627209 Bacteria 5896285
470 2857628228 2857627736 Bacteria 5625397
471 2884934527 2884933994 Bacteria 4535041
472 2902049722 2902048731 Bacteria 4976191
473 2904447300 2904445276 Bacteria 5310396
474 2904785837 2904780799 Bacteria 5840761
475 2910250803 2910245624 Bacteria 6935613
476 2919182459 2919177583 Bacteria 5641607
477 2919190614 2919186247 Bacteria 6244071
478 2928082104 2928078545 Bacteria 6534839
479 2928149318 2928147474 Bacteria 6512076
480 2932087946 2932082852 Bacteria 6563563
481 2939669176 2939664404 Bacteria 6364494
482 2945998359 2945997725 Bacteria 6404843
483 2954020827 2954016120 Bacteria 6446024
484 2977234198 2977232053 Bacteria 5485925
485 8055589925 8055588893 Bacteria 3619545
486 Ga0065712_10164954
487 SwRhRL2b_contig_1762462
488 JGI24735J21928_10000015
489 JGI25162J39368_1000016
490 JGI25162J39368_1000866
491 JGI25152J39213_1000300
492 JGI25150J39212_1000023
493 JGI25151J46595_10000082
494 JGI25165J46597_1001134
495 JGI25153J46596_10000060
496 rootH1_10000428
497 rootH1_10013947
498 rootH1_10034433
499 rootH1_10123889
500 rootH2_10009276
501 rootH2_10047461
502 rootH2_10105521
503 rootH2_10198930
504 rootL2_10006331
505 rootL2_10102636
506 rootL2_10125346
507 rootL2_10194838
508 rootL2_10199322
509 rootH1_10003399
510 rootH1_10005185
511 rootH1_10010280
512 rootH1_10016834
513 rootH1_10016835
514 rootH1_10026116
515 rootH1_10055014
516 rootH1_10061130
517 rootH1_10065583
518 rootH1_10079729
519 rootH1_10100344
520 rootH1_10174448
521 Ga0055536_1000002
522 Ga0055530_10001421
523 Ga0055531_10000287
524 Ga0058862_12302803
525 Ga0065165_1001313
526 Ga0065714_10002204
527 Ga0065714_10002553
528 Ga0065714_10007689
529 Ga0065714_10007833
530 Ga0065714_10015308
531 Ga0065714_10131349
532 Ga0065714_10150540
533 Ga0065704_10000188
534 Ga0065704_10001732
535 Ga0065704_10006409
536 Ga0065704_10072149
537 Ga0070658_10006144
538 Ga0070683_100319255
539 Ga0070690_100096244
540 Ga0070670_100009693
541 Ga0070670_100504946
542 Ga0070680_100065076
543 Ga0070682_100006134
544 Ga0070660_100182562
545 Ga0070661_100313666
546 Ga0070668_100523284
547 Ga0070659_100090664
548 Ga0070663_100085742
549 Ga0070681_10048767
550 Ga0070681_10113532
551 Ga0070679_100457246
552 Ga0070684_100165640
553 Ga0068853_100051494
554 Ga0068853_100090283
555 Ga0070665_100000061
556 Ga0070665_100001020
557 Ga0070665_100256672
558 Ga0070665_100763166
559 Ga0068855_100000074
560 Ga0068855_100017943
561 Ga0068855_100303912
562 Ga0068855_100316861
563 Ga0068855_100331748
564 Ga0068857_100087534
565 Ga0068854_100042783
566 Ga0068854_100071901
567 Ga0068856_100033530
568 Ga0068856_100046164
569 Ga0068856_100047619
570 Ga0068856_100049718
571 Ga0068852_100340122
572 Ga0068852_100393268
573 Ga0068859_100000272
574 Ga0068859_100190473
575 Ga0068858_100453248
576 Ga0068862_100207461
577 Ga0075366_10000170
578 Ga0075366_10005159
579 Ga0075429_100015472
580 Ga0097620_100000272
581 Ga0097620_100093992
582 Ga0097620_100190471
583 Ga0105244_10097085
584 Ga0105240_10000066
585 Ga0105240_10000082
586 Ga0105240_10001333
587 Ga0105240_10014355
588 Ga0105240_10056121
589 Ga0105240_10188862
590 Ga0105240_10240960
591 Ga0105240_10623136
592 Ga0105240_10760491
593 Ga0111539_10137145
594 Ga0111539_10275785
595 Ga0114129_10018647
596 Ga0105243_10000004
597 Ga0105243_10031449
598 Ga0105241_10009078
599 Ga0105241_10021457
600 Ga0105241_10035417
601 Ga0105241_10056412
602 Ga0105241_10324125
603 Ga0105242_10541681
604 Ga0105237_10000310
605 Ga0105237_10007457
606 Ga0105237_10009371
607 Ga0105237_10052440
608 Ga0105237_10078416
609 Ga0105237_10168228
610 Ga0105237_10172748
611 Ga0105238_10045351
612 Ga0105238_10325296
613 Ga0105238_10668365
614 Ga0105249_10183886
615 Ga0105249_10589779
616 Ga0105239_10000009
617 Ga0105239_10000049
618 Ga0105239_10001076
619 Ga0105239_10003303
620 Ga0105239_10008608
621 Ga0105239_10008871
622 Ga0105239_10009059
623 Ga0105239_10024974
624 Ga0105239_10025805
625 Ga0105239_10141793
626 Ga0105239_10403540
627 Ga0157373_10000089
628 Ga0157373_10005376
629 Ga0157373_10014003
630 Ga0157373_10020052
631 Ga0157373_10037473
632 Ga0157373_10339836
633 Ga0157371_10000025
634 Ga0157371_10000511
635 Ga0157371_10007554
636 Ga0157371_10009528
637 Ga0157371_10013702
638 Ga0157371_10033409
639 Ga0157371_10067622
640 Ga0157370_10002659
641 Ga0157370_10014967
642 Ga0157370_10040234
643 Ga0157370_10049504
644 Ga0157370_10072875
645 Ga0157370_10080886
646 Ga0157370_10126398
647 Ga0157370_10156635
648 Ga0157370_10290874
649 Ga0157370_10467965
650 Ga0157369_10000038
651 Ga0157369_10004248
652 Ga0157369_10044949
653 Ga0157369_10101380
654 Ga0157369_10377807
655 Ga0157378_10006650
656 Ga0157378_10028505
657 Ga0157378_10042477
658 Ga0163162_10000012
659 Ga0163162_10000123
660 Ga0163162_10010257
661 Ga0157372_10000039
662 Ga0157372_10000241
663 Ga0157372_10001390
664 Ga0157372_10024320
665 Ga0157372_10035628
666 Ga0157372_10047927
667 Ga0157372_10069376
668 Ga0157372_10075801
669 Ga0157372_10166305
670 Ga0157372_10172189
671 Ga0157372_10389845
672 Ga0157372_10443063
673 Ga0157375_10012196
674 Ga0157375_10014406
675 Ga0157375_10124046
676 Ga0163163_10044177
677 Ga0157380_10066264
678 Ga0182008_10000020
679 Ga0182008_10000052
680 Ga0182008_10000170
681 Ga0182008_10073976
682 Ga0182006_1000270
683 Ga0182006_1000276
684 Ga0182006_1001187
685 Ga0182006_1002937
686 Ga0182007_10000024
687 Ga0182007_10044537
688 Ga0183373_1002
689 Ga0163161_10000093
690 Ga0163161_10000094
691 Ga0163161_10001375
692 Ga0163161_10010803
693 Ga0163161_10032876
694 Ga0163161_10099575
695 Ga0206351_10116577
696 Ga0213872_10152853
697 Ga0207427_100122
698 Ga0209437_100048
699 Ga0209437_100119
700 Ga0207425_1000051
701 Ga0209026_1000304
702 Ga0209129_1000121
703 Ga0209129_1016863
704 Ga0209233_1000029
705 Ga0209233_1004779
706 Ga0209455_1004796
707 Ga0209676_1000022
708 Ga0209025_1000160
709 Ga0209758_1000147
710 Ga0209050_1000020
711 Ga0209050_1008089
712 Ga0209257_1000006
713 Ga0207647_10000256
714 Ga0207647_10018432
715 Ga0207647_10106557
716 Ga0207705_10066007
717 Ga0207705_10109677
718 Ga0207707_10003763
719 Ga0207695_10000053
720 Ga0207695_10000078
721 Ga0207695_10003291
722 Ga0207695_10018400
723 Ga0207695_10022995
724 Ga0207695_10099538
725 Ga0207695_10163907
726 Ga0207695_10248135
727 Ga0207671_10000298
728 Ga0207671_10000366
729 Ga0207671_10000925
730 Ga0207671_10007835
731 Ga0207671_10049768
732 Ga0207671_10052325
733 Ga0207671_10093179
734 Ga0207660_10163179
735 Ga0207657_10105867
736 Ga0207657_10287979
737 Ga0207652_10056206
738 Ga0207652_10059778
739 Ga0207694_10326178
740 Ga0207650_10001645
741 Ga0207650_10355542
742 Ga0207644_10007855
743 Ga0207690_10038238
744 Ga0207709_10000010
745 Ga0207661_10317036
746 Ga0207667_10000014
747 Ga0207667_10000274
748 Ga0207667_10008386
749 Ga0207667_10023957
750 Ga0207667_10117429
751 Ga0207667_10154923
752 Ga0207640_10097857
753 Ga0207640_10413466
754 Ga0207703_10117350
755 Ga0207703_10467729
756 Ga0207639_10047672
757 Ga0207639_10062748
758 Ga0207678_10142918
759 Ga0207702_10036427
760 Ga0207702_10037437
761 Ga0207702_10044099
762 Ga0207702_10149098
763 Ga0207702_10291775
764 Ga0207702_10321537
765 Ga0207641_10023895
766 Ga0207648_10138436
767 Ga0207674_10072885
768 Ga0207698_10203921
769 Ga0207698_10243091
770 Ga0207428_10165457
771 Ga0268266_10000053
772 Ga0268266_10001833
773 Ga0307515_10000001
774 Ga0307515_10000016
775 Ga0307515_10000316
776 Ga0307515_10001308
777 Ga0307515_10207796
778 Ga0307515_10212349
779 Ga0265338_10105050
780 Ga0265338_10197563
781 Ga0265324_10006646
782 Ga0316177_1066261
783 Ga0316176_1102297
784 Ga0316183_1153674
785 Ga0316181_1001096
786 Ga0265331_10109396
787 Ga0265327_10000006
788 Ga0265327_10000013
789 Ga0265327_10000228
790 Ga0307513_10134206
791 Ga0307408_100000889
792 Ga0307408_100001538
793 Ga0307408_100003026
794 Ga0307408_100056973
795 Ga0265342_10185149
796 Ga0307405_10000011
797 Ga0316577_10050394
798 Ga0307407_10000018
799 Ga0307412_10000001
800 Ga0307412_10004065
801 Ga0307412_10106720
802 Ga0307409_100007913
803 Ga0307416_100000050
804 Ga0307416_100277840
805 Ga0307414_10000816
806 Ga0307414_10004830
807 Ga0307414_10025228
808 Ga0307414_10091015
809 Ga0307414_10092388
810 Ga0307414_10113908
811 Ga0307414_10276225
812 Ga0307507_10000337
813 Ga0307510_10001184
814 Ga0373927_0105157
815 Ga0316584_0001440
816 Ga0395899_0000282
817 Ga0395899_0001270
818 Ga0395899_0039694
819 Ga0395900_0000195
820 Ga0395900_0002423
821 Ga0395900_0055381
822 Ga0395900_0467557
823 Ga0395898_0014682
824 Ga0395898_0396359
825 Ga0395905_0001272
826 Ga0395905_0002456
827 Ga0395905_0076270
828 Ga0395905_0407966
829 Ga0395901_0000644
830 Ga0395901_0056799
831 Ga0395901_0100689
832 Ga0395901_0428910
833 Ga0400483_270292
834 Ga0400489_08300
835 Ga0436361_0887739
836 Ga0439449_0009241
837 Ga0439462_0031620
838 Ga0466966_0024501
839 Ga0453684_0029777
840 Ga0466957_0219227
841 Ga0495592_0109311
842 Ga0495638_0000036
843 Ga0495651_0233501
844 Ga0495650_0000144
845 Ga0495585_0000091
846 Ga0495585_0000642
847 Ga0495607_0198071
848 Ga0495606_0000919
849 Ga0495606_0013016
850 Ga0495606_0035940
851 Ga0495606_0064542
852 Ga0495610_0000219
853 Ga0495610_0002599
854 Ga0495616_0096556
855 Ga0495637_0026724
856 Ga0495644_0015559
857 Ga0495648_0018526
858 Ga0495648_0066806
859 Ga0495642_0029863
860 Ga0495652_0118795
861 Ga0495609_0016237
862 Ga0495609_0049323
863 Ga0495645_0109387
864 Ga0495633_0000026
865 Ga0495633_0007299
866 Ga0495668_0000054
867 Ga0495668_0000449
868 Ga0495634_0016241
869 Ga0495625_0000059
870 Ga0495625_0001227
871 Ga0495625_0001942
872 Ga0495625_0009347
873 Ga0495625_0037628
874 Ga0495625_0103408
875 Ga0495625_0136645
876 Ga0495661_0003215
877 Ga0495658_0055719
878 Ga0495649_0000031
879 Ga0495649_0051659
880 Ga0495636_0000011
881 Ga0495680_0374483
882 Ga0495683_0043965
883 Ga0495687_001100
884 Ga0495685_095960
885 Ga0495681_0113712
886 Ga0495686_0000230
887 Ga0495686_0000533
888 Ga0495686_0002591
889 Ga0495614_0036502
890 Ga0496114_0004685
891 Ga0496115_0002329
892 Ga0496115_0123289
893 Ga0496116_0010979
894 Ga0496117_0001536
895 Ga0496122_0000876
896 Ga0496123_0019398
897 Ga0496123_0059317
898 Ga0496125_0077654
899 Ga0495678_035096
900 Ga0495682_0043051
901 Ga0501043_0146613
902 Ga0501217_051790
903 Ga0501222_000312
904 Ga0501242_001440
905 Ga0501249_018597
906 Ga0501253_012227
907 Ga0501257_000664
908 Ga0501241_000534
909 Ga0501264_000044
910 Ga0501035_0116040
911 nmdc:mga0k408_1202_c1
912 nmdc:mga0k408_82_c1
913 nmdc:mga05p37_20345_c1
914 nmdc:mga09592_35482_c1
915 nmdc:mga06r32_23982_c1
916 nmdc:mga08y16_18441_c1
917 nmdc:mga08y16_239016_c1
918 nmdc:mga08y16_253949_c1
919 Ga0500647_0035688
920 Ga0500651_0001126
921 Ga0500556_0009883
922 Ga0500592_009917
923 Ga0500608_002212
924 Ga0500608_020989
925 Ga0500618_000018
926 Ga0500618_036621
927 Ga0500642_0046343
928 Ga0500559_0041595
929 Ga0500568_0031471
930 Ga0500616_0000004
931 Ga0500616_0000868
932 Ga0500616_0028960
933 Ga0500616_0109880
934 Ga0500622_0001026
935 Ga0500624_000264
936 Ga0500627_0089500
937 2586209950
938 2599481995
939 2738756086
940 2738763292
941 2738852440
942 2739304171
943 2739591452
944 2739615266
945 2739645606
946 2776616102
947 2819549565
948 2833643452
949 2842727320
950 2842904969
951 2842913717
952 2849285451
953 2852625524
954 2852630654
955 2857628228
956 2884934527
957 2902049722
958 2904447300
959 2904785837
960 2910250803
961 2919182459
962 2919190614
963 2928082104
964 2928149318
965 2932087946
966 2939669176
967 2945998359
968 2954020827
969 2977234198
970 8055589925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

32

171

0.77

PF00149

Metallophos

Calcineurin-like phosphoesterase

32

233

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.6326 12 247
5wly-assembly1.cif.gz_A e. coli lpxh- 8 mutations 0.6281 12 248
5wly-assembly1.cif.gz_A e. coli lpxh- 8 mutations 0.6203 12 248
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.6195 12 247
7ss6-assembly1.cif.gz_A structure of klebsiella lpxh in complex with jh-lph-45 0.6063 12 247
ID Description Score Start End Superfamily
1s3lA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6326 12 247 3.60.21.10
1s3lA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6195 12 247 3.60.21.10
af_P46735_912_1105_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6007 98 121 2.30.29.30
af_G5ECZ0_808_1006_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5778 98 120 2.30.29.30
af_Q4AB27_1092_1286_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5569 98 121 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A3D1D5X7-F1-model_v4 deleted 0.9655 6 108
AF-A0A4Q5RDA2-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9637 7 116 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A3D1D5X7-F1-model_v4 deleted 0.9564 6 108
AF-A0A3D1H7X3-F1-model_v4 UDP-2,3-diacylglucosamine hydrolase 0.9523 7 129 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A6L4ZFX8-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9522 4 118 GO:0005886
GO:0008758
GO:0009245
GO:0046872

Map