F453056
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 485 | 206 | 970 | 532 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100095912|Ga0070713_1000959122 |
| Length | 565 |
| Sequence | MVSRTVTADVTEYSRLPSVMELPNYLNNEHTLGSWLFTTDHKRIGILFAFSITGFFFLGAVAIGIVRLELLTPAPDLVSDDTYNKLFTLHGIVMVWFFLIPSIPATLGNFLLPLMIGAKDLAFPRLNLTSWYLFMAGGIITLVAVIAGGVDSGWTFYVPYSSQFSHSLVAVAAAGVFVNGFSSILTGINFIATTHMLRAPGLTWFRLPLFVWAMYTTSAVMILATPVLAITLLLMAMERLFAIPIFDAAQGGDPLLFQHLFWFYSHPAVYIMLLPAMGVVSEIFTCFARRRVFGYQFMVYALVSIAVIGFFVWGHHMFVAGMSPFANLVFSFLSFVVAVPSAIKVFNWTATLYRGQITFEAAMLYALAFLWLFTVGGLSGLFLATVPIDIHVTDTYFVVAHFHYIMVGGSVSAMFGGLHFWWPKITGRLYPEGWARFAAILMFFGFNLTFFPQFVMGYAGMPRRYHAYAPEFQIFHVLSTAGAAVLGVAYILPLAYFWWSVFHGRRAHSNPWNATGLEWQTESPPPRDNFRQQPLVTAGPYCYHAETEGPEAENRGELRLDPIIT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 61 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 62 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 101 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 102 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 103 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 104 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 105 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 106 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 111 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 115 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 116 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 117 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 118 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 119 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 120 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 121 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 122 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 123 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 124 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 125 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 126 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 127 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 128 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 129 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 130 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 136 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 137 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 138 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 141 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 142 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 143 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 144 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 145 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 146 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 147 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 148 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 149 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 176 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 181 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 184 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 185 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 186 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 187 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 188 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 189 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 190 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 191 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 192 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 193 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 194 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 195 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 196 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 197 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 198 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 199 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 200 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 201 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 202 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 203 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 204 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 205 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 206 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.05 |
| Metatranscriptomes | 0 |
| Isolates | 4.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.24 |
| Nodule | 3.51 |
| Rhizoplane | 3.3 |
| Rhizosphere | 86.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100095912 | 3300005436 | Bacteria | 2559 |
| 2 | JGI24741J21665_1000710 | 3300001915 | Bacteria | 10037 |
| 3 | JGI24741J21665_1003173 | 3300001915 | Bacteria | 4017 |
| 4 | JGI24740J21852_10000530 | 3300001979 | Bacteria | 16298 |
| 5 | rootH2_10005673 | 3300003320 | Bacteria | 75939 |
| 6 | Ga0070658_10061098 | 3300005327 | Bacteria | 3069 |
| 7 | Ga0070683_100002621 | 3300005329 | Bacteria | 14385 |
| 8 | Ga0070683_100008096 | 3300005329 | Bacteria | 8927 |
| 9 | Ga0070680_100001047 | 3300005336 | Bacteria | 19785 |
| 10 | Ga0070680_100001917 | 3300005336 | Bacteria | 15277 |
| 11 | Ga0070680_100018556 | 3300005336 | Bacteria | 5499 |
| 12 | Ga0070680_100031189 | 3300005336 | Bacteria | 4285 |
| 13 | Ga0070680_100087291 | 3300005336 | Bacteria | 2580 |
| 14 | Ga0070660_100020786 | 3300005339 | Bacteria | 4832 |
| 15 | Ga0070660_100056689 | 3300005339 | Bacteria | 3032 |
| 16 | Ga0070691_10011271 | 3300005341 | Bacteria | 4078 |
| 17 | Ga0070661_100009562 | 3300005344 | Bacteria | 6716 |
| 18 | Ga0070661_100014162 | 3300005344 | Bacteria | 5617 |
| 19 | Ga0070661_100068904 | 3300005344 | Bacteria | 2600 |
| 20 | Ga0070692_10005557 | 3300005345 | Bacteria | 5391 |
| 21 | Ga0070659_100008389 | 3300005366 | Bacteria | 7547 |
| 22 | Ga0070659_100010358 | 3300005366 | Bacteria | 6856 |
| 23 | Ga0070659_100080754 | 3300005366 | Bacteria | 2596 |
| 24 | Ga0070709_10005767 | 3300005434 | Bacteria | 6717 |
| 25 | Ga0070709_10032493 | 3300005434 | Bacteria | 3147 |
| 26 | Ga0070714_100002593 | 3300005435 | Bacteria | 13321 |
| 27 | Ga0070714_100012582 | 3300005435 | Bacteria | 6760 |
| 28 | Ga0070714_100044066 | 3300005435 | Bacteria | 3776 |
| 29 | Ga0070714_100066037 | 3300005435 | Bacteria | 3117 |
| 30 | Ga0070714_100077470 | 3300005435 | Bacteria | 2888 |
| 31 | Ga0070713_100005477 | 3300005436 | Bacteria | 8683 |
| 32 | Ga0070713_100149240 | 3300005436 | Bacteria | 2078 |
| 33 | Ga0070710_10013170 | 3300005437 | Bacteria | 4133 |
| 34 | Ga0070711_100076363 | 3300005439 | Bacteria | 2375 |
| 35 | Ga0070705_100003804 | 3300005440 | Bacteria | 7382 |
| 36 | Ga0070708_100029679 | 3300005445 | Bacteria | 4719 |
| 37 | Ga0070662_100009722 | 3300005457 | Bacteria | 6294 |
| 38 | Ga0070681_10000202 | 3300005458 | Bacteria | 46492 |
| 39 | Ga0070681_10000234 | 3300005458 | Bacteria | 43792 |
| 40 | Ga0070681_10004464 | 3300005458 | Bacteria | 13330 |
| 41 | Ga0070681_10005439 | 3300005458 | Bacteria | 12303 |
| 42 | Ga0070681_10030381 | 3300005458 | Bacteria | 5421 |
| 43 | Ga0070681_10126945 | 3300005458 | Bacteria | 2483 |
| 44 | Ga0070699_100008679 | 3300005518 | Bacteria | 8808 |
| 45 | Ga0070699_100013482 | 3300005518 | Bacteria | 7040 |
| 46 | Ga0070679_100000275 | 3300005530 | Bacteria | 43254 |
| 47 | Ga0070679_100002568 | 3300005530 | Bacteria | 16485 |
| 48 | Ga0070679_100002970 | 3300005530 | Bacteria | 15469 |
| 49 | Ga0070679_100005452 | 3300005530 | Bacteria | 11789 |
| 50 | Ga0070679_100018122 | 3300005530 | Bacteria | 6826 |
| 51 | Ga0070679_100069550 | 3300005530 | Bacteria | 3511 |
| 52 | Ga0070679_100207023 | 3300005530 | Bacteria | 1926 |
| 53 | Ga0070684_100002661 | 3300005535 | Bacteria | 13192 |
| 54 | Ga0070684_100010629 | 3300005535 | Bacteria | 7298 |
| 55 | Ga0070684_100067861 | 3300005535 | Bacteria | 3134 |
| 56 | Ga0070684_100171416 | 3300005535 | Bacteria | 1971 |
| 57 | Ga0070697_100006461 | 3300005536 | Bacteria | 9077 |
| 58 | Ga0068853_100012863 | 3300005539 | Bacteria | 6819 |
| 59 | Ga0068853_100022095 | 3300005539 | Bacteria | 5309 |
| 60 | Ga0068853_100026181 | 3300005539 | Bacteria | 4897 |
| 61 | Ga0068853_100129403 | 3300005539 | Bacteria | 2259 |
| 62 | Ga0070695_100003972 | 3300005545 | Bacteria | 8639 |
| 63 | Ga0070696_100001519 | 3300005546 | Bacteria | 15228 |
| 64 | Ga0070696_100007114 | 3300005546 | Bacteria | 7472 |
| 65 | Ga0070696_100031102 | 3300005546 | Bacteria | 3657 |
| 66 | Ga0070693_100003227 | 3300005547 | Bacteria | 7570 |
| 67 | Ga0070665_100002567 | 3300005548 | Bacteria | 19910 |
| 68 | Ga0070704_100008877 | 3300005549 | Bacteria | 6051 |
| 69 | Ga0068855_100001412 | 3300005563 | Bacteria | 29813 |
| 70 | Ga0068855_100005963 | 3300005563 | Bacteria | 14860 |
| 71 | Ga0068855_100009359 | 3300005563 | Bacteria | 11828 |
| 72 | Ga0068855_100012095 | 3300005563 | Bacteria | 10428 |
| 73 | Ga0068855_100014475 | 3300005563 | Bacteria | 9499 |
| 74 | Ga0070664_100154712 | 3300005564 | Bacteria | 2026 |
| 75 | Ga0068854_100002315 | 3300005578 | Bacteria | 11742 |
| 76 | Ga0068854_100023399 | 3300005578 | Bacteria | 4220 |
| 77 | Ga0068854_100037276 | 3300005578 | Bacteria | 3412 |
| 78 | Ga0068854_100109414 | 3300005578 | Bacteria | 2082 |
| 79 | Ga0068856_100023207 | 3300005614 | Bacteria | 6034 |
| 80 | Ga0068856_100056925 | 3300005614 | Bacteria | 3859 |
| 81 | Ga0068856_100066027 | 3300005614 | Bacteria | 3575 |
| 82 | Ga0068856_100070928 | 3300005614 | Bacteria | 3448 |
| 83 | Ga0068852_100006998 | 3300005616 | Bacteria | 8209 |
| 84 | Ga0068858_100001933 | 3300005842 | Bacteria | 21122 |
| 85 | Ga0081538_10020681 | 3300005981 | Bacteria | 4832 |
| 86 | Ga0070717_10024487 | 3300006028 | Bacteria | 4793 |
| 87 | Ga0070712_100024983 | 3300006175 | Bacteria | 3965 |
| 88 | Ga0075370_10019576 | 3300006353 | Bacteria | 3688 |
| 89 | Ga0068871_100139736 | 3300006358 | Bacteria | 2059 |
| 90 | Ga0075428_100002399 | 3300006844 | Bacteria | 20348 |
| 91 | Ga0075431_100011682 | 3300006847 | Bacteria | 8860 |
| 92 | Ga0075434_100000071 | 3300006871 | Bacteria | 53243 |
| 93 | Ga0075435_100000877 | 3300007076 | Bacteria | 18866 |
| 94 | Ga0105240_10005952 | 3300009093 | Bacteria | 18044 |
| 95 | Ga0105240_10007031 | 3300009093 | Bacteria | 16419 |
| 96 | Ga0105240_10011318 | 3300009093 | Bacteria | 12430 |
| 97 | Ga0105240_10034327 | 3300009093 | Bacteria | 6544 |
| 98 | Ga0105240_10073189 | 3300009093 | Bacteria | 4231 |
| 99 | Ga0105240_10149314 | 3300009093 | Bacteria | 2785 |
| 100 | Ga0105240_10179448 | 3300009093 | Bacteria | 2500 |
| 101 | Ga0105240_10253989 | 3300009093 | Bacteria | 2031 |
| 102 | Ga0105240_10282679 | 3300009093 | Bacteria | 1905 |
| 103 | Ga0111539_10006154 | 3300009094 | Bacteria | 15494 |
| 104 | Ga0105245_10036534 | 3300009098 | Bacteria | 4364 |
| 105 | Ga0105241_10002586 | 3300009174 | Bacteria | 13579 |
| 106 | Ga0105241_10003016 | 3300009174 | Bacteria | 12586 |
| 107 | Ga0105237_10002921 | 3300009545 | Bacteria | 20703 |
| 108 | Ga0105237_10013417 | 3300009545 | Bacteria | 8595 |
| 109 | Ga0105237_10066214 | 3300009545 | Bacteria | 3608 |
| 110 | Ga0105238_10005698 | 3300009551 | Bacteria | 12312 |
| 111 | Ga0105238_10021258 | 3300009551 | Bacteria | 6613 |
| 112 | Ga0105238_10021265 | 3300009551 | Bacteria | 6612 |
| 113 | Ga0105238_10093450 | 3300009551 | Bacteria | 2996 |
| 114 | Ga0105238_10199153 | 3300009551 | Bacteria | 1978 |
| 115 | Ga0105239_10003553 | 3300010375 | Bacteria | 19062 |
| 116 | Ga0105239_10004794 | 3300010375 | Bacteria | 16052 |
| 117 | Ga0105239_10005794 | 3300010375 | Bacteria | 14415 |
| 118 | Ga0105239_10041495 | 3300010375 | Bacteria | 5043 |
| 119 | Ga0105239_10071296 | 3300010375 | Bacteria | 3818 |
| 120 | Ga0105239_10132776 | 3300010375 | Bacteria | 2770 |
| 121 | Ga0105239_10137239 | 3300010375 | Bacteria | 2723 |
| 122 | Ga0105239_10194734 | 3300010375 | Bacteria | 2269 |
| 123 | Ga0157373_10002168 | 3300013100 | Bacteria | 14869 |
| 124 | Ga0157373_10019273 | 3300013100 | Bacteria | 4969 |
| 125 | Ga0157373_10030920 | 3300013100 | Bacteria | 3853 |
| 126 | Ga0157371_10000551 | 3300013102 | Bacteria | 44580 |
| 127 | Ga0157370_10003631 | 3300013104 | Bacteria | 18035 |
| 128 | Ga0157370_10010625 | 3300013104 | Bacteria | 9689 |
| 129 | Ga0157370_10014793 | 3300013104 | Bacteria | 7963 |
| 130 | Ga0157370_10057231 | 3300013104 | Bacteria | 3708 |
| 131 | Ga0157370_10081727 | 3300013104 | Bacteria | 3040 |
| 132 | Ga0157369_10001218 | 3300013105 | Bacteria | 32009 |
| 133 | Ga0157369_10011586 | 3300013105 | Bacteria | 10011 |
| 134 | Ga0157369_10030061 | 3300013105 | Bacteria | 5994 |
| 135 | Ga0157369_10061775 | 3300013105 | Bacteria | 4038 |
| 136 | Ga0157369_10072673 | 3300013105 | Bacteria | 3692 |
| 137 | Ga0157369_10211392 | 3300013105 | Bacteria | 2033 |
| 138 | Ga0157372_10000668 | 3300013307 | Bacteria | 37714 |
| 139 | Ga0157372_10004449 | 3300013307 | Bacteria | 14949 |
| 140 | Ga0157372_10015447 | 3300013307 | Bacteria | 8183 |
| 141 | Ga0157372_10043384 | 3300013307 | Bacteria | 4979 |
| 142 | Ga0157372_10050958 | 3300013307 | Bacteria | 4605 |
| 143 | Ga0157372_10058216 | 3300013307 | Bacteria | 4319 |
| 144 | Ga0157372_10186131 | 3300013307 | Bacteria | 2405 |
| 145 | Ga0182008_10021032 | 3300014497 | Bacteria | 3354 |
| 146 | Ga0182007_10001621 | 3300015262 | Bacteria | 11937 |
| 147 | Ga0213872_10059020 | 3300021361 | Bacteria | 1736 |
| 148 | Ga0213876_10000110 | 3300021384 | Bacteria | 90322 |
| 149 | Ga0209677_101747 | 3300025253 | Bacteria | 9025 |
| 150 | Ga0209233_1000654 | 3300025261 | Bacteria | 16891 |
| 151 | Ga0209455_1001581 | 3300025272 | Bacteria | 10032 |
| 152 | Ga0207692_10012534 | 3300025898 | Bacteria | 3644 |
| 153 | Ga0207647_10000240 | 3300025904 | Bacteria | 44855 |
| 154 | Ga0207699_10001446 | 3300025906 | Bacteria | 11276 |
| 155 | Ga0207705_10004651 | 3300025909 | Bacteria | 10358 |
| 156 | Ga0207705_10006310 | 3300025909 | Bacteria | 8800 |
| 157 | Ga0207705_10006671 | 3300025909 | Bacteria | 8537 |
| 158 | Ga0207684_10046438 | 3300025910 | Bacteria | 3684 |
| 159 | Ga0207654_10000888 | 3300025911 | Bacteria | 16582 |
| 160 | Ga0207707_10000177 | 3300025912 | Bacteria | 66169 |
| 161 | Ga0207707_10000295 | 3300025912 | Bacteria | 53118 |
| 162 | Ga0207707_10000438 | 3300025912 | Bacteria | 43316 |
| 163 | Ga0207707_10000480 | 3300025912 | Bacteria | 41364 |
| 164 | Ga0207707_10000629 | 3300025912 | Bacteria | 34950 |
| 165 | Ga0207707_10001999 | 3300025912 | Bacteria | 18517 |
| 166 | Ga0207707_10004566 | 3300025912 | Bacteria | 12169 |
| 167 | Ga0207707_10008006 | 3300025912 | Bacteria | 9181 |
| 168 | Ga0207707_10023351 | 3300025912 | Bacteria | 5410 |
| 169 | Ga0207695_10002355 | 3300025913 | Bacteria | 28094 |
| 170 | Ga0207695_10003043 | 3300025913 | Bacteria | 24037 |
| 171 | Ga0207695_10008100 | 3300025913 | Bacteria | 13217 |
| 172 | Ga0207695_10012643 | 3300025913 | Bacteria | 10112 |
| 173 | Ga0207695_10019247 | 3300025913 | Bacteria | 7863 |
| 174 | Ga0207695_10022460 | 3300025913 | Bacteria | 7159 |
| 175 | Ga0207695_10039567 | 3300025913 | Bacteria | 5067 |
| 176 | Ga0207695_10051885 | 3300025913 | Bacteria | 4302 |
| 177 | Ga0207695_10122911 | 3300025913 | Bacteria | 2562 |
| 178 | Ga0207695_10138694 | 3300025913 | Bacteria | 2383 |
| 179 | Ga0207695_10159939 | 3300025913 | Bacteria | 2184 |
| 180 | Ga0207671_10002597 | 3300025914 | Bacteria | 19078 |
| 181 | Ga0207671_10011995 | 3300025914 | Bacteria | 7003 |
| 182 | Ga0207671_10062668 | 3300025914 | Bacteria | 2762 |
| 183 | Ga0207693_10023681 | 3300025915 | Bacteria | 4872 |
| 184 | Ga0207693_10033398 | 3300025915 | Bacteria | 4060 |
| 185 | Ga0207693_10109459 | 3300025915 | Bacteria | 2167 |
| 186 | Ga0207663_10052029 | 3300025916 | Bacteria | 2553 |
| 187 | Ga0207660_10001343 | 3300025917 | Bacteria | 16470 |
| 188 | Ga0207660_10003909 | 3300025917 | Bacteria | 9709 |
| 189 | Ga0207660_10005892 | 3300025917 | Bacteria | 7961 |
| 190 | Ga0207660_10017846 | 3300025917 | Bacteria | 4723 |
| 191 | Ga0207660_10019175 | 3300025917 | Bacteria | 4568 |
| 192 | Ga0207660_10028499 | 3300025917 | Bacteria | 3820 |
| 193 | Ga0207660_10051357 | 3300025917 | Bacteria | 2931 |
| 194 | Ga0207660_10091193 | 3300025917 | Bacteria | 2259 |
| 195 | Ga0207657_10004715 | 3300025919 | Bacteria | 14388 |
| 196 | Ga0207657_10018774 | 3300025919 | Bacteria | 6587 |
| 197 | Ga0207657_10019277 | 3300025919 | Bacteria | 6483 |
| 198 | Ga0207657_10031611 | 3300025919 | Bacteria | 4792 |
| 199 | Ga0207649_10003380 | 3300025920 | Bacteria | 8727 |
| 200 | Ga0207649_10003782 | 3300025920 | Bacteria | 8257 |
| 201 | Ga0207649_10010448 | 3300025920 | Bacteria | 5101 |
| 202 | Ga0207649_10017840 | 3300025920 | Bacteria | 4026 |
| 203 | Ga0207652_10000148 | 3300025921 | Bacteria | 75801 |
| 204 | Ga0207652_10000438 | 3300025921 | Bacteria | 43260 |
| 205 | Ga0207652_10002234 | 3300025921 | Bacteria | 16513 |
| 206 | Ga0207652_10002454 | 3300025921 | Bacteria | 15642 |
| 207 | Ga0207652_10003966 | 3300025921 | Bacteria | 12099 |
| 208 | Ga0207652_10005126 | 3300025921 | Bacteria | 10633 |
| 209 | Ga0207652_10009861 | 3300025921 | Bacteria | 7685 |
| 210 | Ga0207652_10013975 | 3300025921 | Bacteria | 6501 |
| 211 | Ga0207652_10061343 | 3300025921 | Bacteria | 3247 |
| 212 | Ga0207694_10012808 | 3300025924 | Bacteria | 6317 |
| 213 | Ga0207694_10037613 | 3300025924 | Bacteria | 3718 |
| 214 | Ga0207694_10040591 | 3300025924 | Bacteria | 3584 |
| 215 | Ga0207700_10005369 | 3300025928 | Bacteria | 7654 |
| 216 | Ga0207700_10031593 | 3300025928 | Bacteria | 3764 |
| 217 | Ga0207700_10118809 | 3300025928 | Bacteria | 2140 |
| 218 | Ga0207664_10001750 | 3300025929 | Bacteria | 14308 |
| 219 | Ga0207664_10024731 | 3300025929 | Bacteria | 4515 |
| 220 | Ga0207690_10004416 | 3300025932 | Bacteria | 8299 |
| 221 | Ga0207690_10018534 | 3300025932 | Bacteria | 4269 |
| 222 | Ga0207690_10059988 | 3300025932 | Bacteria | 2579 |
| 223 | Ga0207706_10164921 | 3300025933 | Bacteria | 1947 |
| 224 | Ga0207670_10023061 | 3300025936 | Bacteria | 3868 |
| 225 | Ga0207665_10002969 | 3300025939 | Bacteria | 11368 |
| 226 | Ga0207661_10054390 | 3300025944 | Bacteria | 3206 |
| 227 | Ga0207661_10055604 | 3300025944 | Bacteria | 3175 |
| 228 | Ga0207679_10027707 | 3300025945 | Bacteria | 3922 |
| 229 | Ga0207667_10001466 | 3300025949 | Bacteria | 29592 |
| 230 | Ga0207667_10005158 | 3300025949 | Bacteria | 15956 |
| 231 | Ga0207667_10006044 | 3300025949 | Bacteria | 14725 |
| 232 | Ga0207667_10006663 | 3300025949 | Bacteria | 13963 |
| 233 | Ga0207667_10006791 | 3300025949 | Bacteria | 13820 |
| 234 | Ga0207667_10009324 | 3300025949 | Bacteria | 11575 |
| 235 | Ga0207667_10015302 | 3300025949 | Bacteria | 8723 |
| 236 | Ga0207667_10075633 | 3300025949 | Bacteria | 3496 |
| 237 | Ga0207667_10182214 | 3300025949 | Bacteria | 2157 |
| 238 | Ga0207640_10001189 | 3300025981 | Bacteria | 14221 |
| 239 | Ga0207640_10018675 | 3300025981 | Bacteria | 4080 |
| 240 | Ga0207640_10028063 | 3300025981 | Bacteria | 3436 |
| 241 | Ga0207703_10000763 | 3300026035 | Bacteria | 31718 |
| 242 | Ga0207639_10003701 | 3300026041 | Bacteria | 10284 |
| 243 | Ga0207639_10019200 | 3300026041 | Bacteria | 4871 |
| 244 | Ga0207639_10022235 | 3300026041 | Bacteria | 4565 |
| 245 | Ga0207678_10000650 | 3300026067 | Bacteria | 31953 |
| 246 | Ga0207678_10003106 | 3300026067 | Bacteria | 15041 |
| 247 | Ga0207702_10011536 | 3300026078 | Bacteria | 7363 |
| 248 | Ga0207702_10030222 | 3300026078 | Bacteria | 4514 |
| 249 | Ga0207702_10038373 | 3300026078 | Bacteria | 4011 |
| 250 | Ga0207702_10087573 | 3300026078 | Bacteria | 2719 |
| 251 | Ga0207674_10003058 | 3300026116 | Bacteria | 20694 |
| 252 | Ga0207674_10050822 | 3300026116 | Bacteria | 4233 |
| 253 | Ga0207674_10090584 | 3300026116 | Bacteria | 3050 |
| 254 | Ga0207674_10101154 | 3300026116 | Bacteria | 2863 |
| 255 | Ga0207698_10006713 | 3300026142 | Bacteria | 7191 |
| 256 | Ga0207698_10069071 | 3300026142 | Bacteria | 2792 |
| 257 | Ga0207698_10116633 | 3300026142 | Bacteria | 2251 |
| 258 | Ga0265334_10001829 | 3300028573 | Bacteria | 10133 |
| 259 | Ga0265338_10000029 | 3300028800 | Bacteria | 271824 |
| 260 | Ga0265324_10017325 | 3300029957 | Bacteria | 2621 |
| 261 | Ga0265325_10001061 | 3300031241 | Bacteria | 19772 |
| 262 | Ga0307416_100047337 | 3300032002 | Bacteria | 3403 |
| 263 | Ga0307510_10000705 | 3300033180 | Bacteria | 34297 |
| 264 | Ga0373943_0000387 | 3300035170 | Bacteria | 18476 |
| 265 | Ga0373933_0021321 | 3300035724 | Bacteria | 3680 |
| 266 | Ga0373947_0000965 | 3300035725 | Bacteria | 17544 |
| 267 | Ga0373937_0019321 | 3300036401 | Bacteria | 6097 |
| 268 | Ga0395899_0002359 | 3300037312 | Bacteria | 15373 |
| 269 | Ga0395899_0002689 | 3300037312 | Bacteria | 14336 |
| 270 | Ga0395899_0005914 | 3300037312 | Bacteria | 9498 |
| 271 | Ga0395900_0002500 | 3300037418 | Bacteria | 20203 |
| 272 | Ga0395900_0005675 | 3300037418 | Bacteria | 13049 |
| 273 | Ga0395900_0070489 | 3300037418 | Bacteria | 3594 |
| 274 | Ga0395900_0081492 | 3300037418 | Bacteria | 3325 |
| 275 | Ga0395900_0132922 | 3300037418 | Bacteria | 2549 |
| 276 | Ga0395900_0134147 | 3300037418 | Bacteria | 2536 |
| 277 | Ga0395900_0151169 | 3300037418 | Bacteria | 2372 |
| 278 | Ga0395898_0004355 | 3300037466 | Bacteria | 15496 |
| 279 | Ga0395898_0012143 | 3300037466 | Bacteria | 8913 |
| 280 | Ga0395898_0031690 | 3300037466 | Bacteria | 5280 |
| 281 | Ga0395898_0094923 | 3300037466 | Bacteria | 2866 |
| 282 | Ga0395898_0124923 | 3300037466 | Bacteria | 2465 |
| 283 | Ga0395898_0302195 | 3300037466 | Bacteria | 1526 |
| 284 | Ga0395905_0000747 | 3300037471 | Bacteria | 42856 |
| 285 | Ga0395905_0007499 | 3300037471 | Bacteria | 10853 |
| 286 | Ga0395905_0065625 | 3300037471 | Bacteria | 3398 |
| 287 | Ga0395905_0098406 | 3300037471 | Bacteria | 2747 |
| 288 | Ga0395905_0142931 | 3300037471 | Bacteria | 2251 |
| 289 | Ga0395905_0190416 | 3300037471 | Bacteria | 1924 |
| 290 | Ga0436364_0077336 | 3300037853 | Bacteria | 5759 |
| 291 | Ga0436364_0240030 | 3300037853 | Bacteria | 11501 |
| 292 | Ga0436364_0353090 | 3300037853 | Bacteria | 7514 |
| 293 | Ga0436364_0586291 | 3300037853 | Bacteria | 97560 |
| 294 | Ga0436364_0708881 | 3300037853 | Bacteria | 35067 |
| 295 | Ga0395901_0002327 | 3300038443 | Bacteria | 19364 |
| 296 | Ga0395901_0007696 | 3300038443 | Bacteria | 10869 |
| 297 | Ga0395901_0044877 | 3300038443 | Bacteria | 4584 |
| 298 | Ga0436365_0051833 | 3300039437 | Bacteria | 32975 |
| 299 | Ga0436365_0119251 | 3300039437 | Bacteria | 7728 |
| 300 | Ga0436365_0275035 | 3300039437 | Bacteria | 2271 |
| 301 | Ga0436365_1204615 | 3300039437 | Bacteria | 2958 |
| 302 | Ga0436365_1291084 | 3300039437 | Bacteria | 167262 |
| 303 | Ga0436365_1850675 | 3300039437 | Bacteria | 16914 |
| 304 | Ga0436360_1255064 | 3300039438 | Bacteria | 3093 |
| 305 | Ga0436361_0209567 | 3300039447 | Bacteria | 27123 |
| 306 | Ga0436361_1119569 | 3300039447 | Bacteria | 7900 |
| 307 | Ga0436362_0829594 | 3300039453 | Bacteria | 6411 |
| 308 | Ga0466969_0005483 | 3300044656 | Bacteria | 6748 |
| 309 | Ga0466969_0005964 | 3300044656 | Bacteria | 6482 |
| 310 | Ga0466969_0006983 | 3300044656 | Bacteria | 6008 |
| 311 | Ga0466969_0008783 | 3300044656 | Bacteria | 5356 |
| 312 | Ga0453683_0056769 | 3300044673 | Bacteria | 2450 |
| 313 | Ga0466965_0008080 | 3300044683 | Bacteria | 4860 |
| 314 | Ga0466966_0017733 | 3300044684 | Bacteria | 4700 |
| 315 | Ga0466966_0037904 | 3300044684 | Bacteria | 3106 |
| 316 | Ga0466961_0000451 | 3300044693 | Bacteria | 26138 |
| 317 | Ga0466964_0004100 | 3300044706 | Bacteria | 5363 |
| 318 | Ga0453684_0000671 | 3300044712 | Bacteria | 122605 |
| 319 | Ga0466968_0001610 | 3300044735 | Bacteria | 8153 |
| 320 | Ga0466970_0002696 | 3300044765 | Bacteria | 8575 |
| 321 | Ga0466957_0049862 | 3300044842 | Bacteria | 2546 |
| 322 | Ga0466959_0008263 | 3300045049 | Bacteria | 7350 |
| 323 | Ga0466959_0057045 | 3300045049 | Bacteria | 2848 |
| 324 | Ga0466958_0003110 | 3300045836 | Bacteria | 8526 |
| 325 | Ga0466958_0014733 | 3300045836 | Bacteria | 4466 |
| 326 | Ga0466967_0026456 | 3300045976 | Bacteria | 4806 |
| 327 | Ga0466967_0158500 | 3300045976 | Bacteria | 2123 |
| 328 | Ga0466967_0188633 | 3300045976 | Bacteria | 1948 |
| 329 | Ga0466967_0219436 | 3300045976 | Bacteria | 1806 |
| 330 | Ga0495639_0013094 | 3300046475 | Bacteria | 3580 |
| 331 | Ga0495607_0000060 | 3300046501 | Bacteria | 108449 |
| 332 | Ga0495606_0002102 | 3300046507 | Bacteria | 24240 |
| 333 | Ga0495686_0006031 | 3300047472 | Bacteria | 9407 |
| 334 | Ga0496101_0009883 | 3300048904 | Bacteria | 6286 |
| 335 | Ga0496102_0004215 | 3300048905 | Bacteria | 12156 |
| 336 | Ga0496102_0174776 | 3300048905 | Bacteria | 2022 |
| 337 | Ga0496106_0002322 | 3300048909 | Bacteria | 14177 |
| 338 | Ga0496106_0072206 | 3300048909 | Bacteria | 2639 |
| 339 | Ga0496107_0067331 | 3300048910 | Bacteria | 2598 |
| 340 | Ga0496108_0000037 | 3300048911 | Bacteria | 149614 |
| 341 | Ga0496108_0001632 | 3300048911 | Bacteria | 17771 |
| 342 | Ga0496109_0003738 | 3300048912 | Bacteria | 12720 |
| 343 | Ga0496110_0007578 | 3300048913 | Bacteria | 8671 |
| 344 | Ga0496110_0008560 | 3300048913 | Bacteria | 8236 |
| 345 | Ga0496111_0016726 | 3300048914 | Bacteria | 5059 |
| 346 | Ga0496111_0037396 | 3300048914 | Bacteria | 3474 |
| 347 | Ga0496112_0022022 | 3300048915 | Bacteria | 6067 |
| 348 | Ga0496112_0183979 | 3300048915 | Bacteria | 2053 |
| 349 | Ga0496115_0045621 | 3300048918 | Bacteria | 3500 |
| 350 | Ga0496116_0002394 | 3300048919 | Bacteria | 19766 |
| 351 | Ga0496118_0007103 | 3300048921 | Bacteria | 12020 |
| 352 | Ga0496121_0022044 | 3300048924 | Bacteria | 6202 |
| 353 | Ga0496125_0000331 | 3300048928 | Bacteria | 90719 |
| 354 | Ga0496126_0079201 | 3300048929 | Bacteria | 2909 |
| 355 | Ga0501031_0003951 | 3300049568 | Bacteria | 9549 |
| 356 | Ga0501031_0073893 | 3300049568 | Bacteria | 2220 |
| 357 | Ga0501032_0000055 | 3300049569 | Bacteria | 99207 |
| 358 | Ga0501032_0001930 | 3300049569 | Bacteria | 16331 |
| 359 | Ga0501032_0002690 | 3300049569 | Bacteria | 13856 |
| 360 | Ga0501033_0000163 | 3300049570 | Bacteria | 63913 |
| 361 | Ga0501033_0000960 | 3300049570 | Bacteria | 26179 |
| 362 | Ga0501033_0002886 | 3300049570 | Bacteria | 14393 |
| 363 | Ga0501033_0009215 | 3300049570 | Bacteria | 7601 |
| 364 | Ga0501034_0001317 | 3300049571 | Bacteria | 33620 |
| 365 | Ga0501034_0008452 | 3300049571 | Bacteria | 10873 |
| 366 | Ga0501034_0021771 | 3300049571 | Bacteria | 6531 |
| 367 | Ga0501034_0027830 | 3300049571 | Bacteria | 5749 |
| 368 | Ga0501036_0000021 | 3300049572 | Bacteria | 114136 |
| 369 | Ga0501036_0000363 | 3300049572 | Bacteria | 31929 |
| 370 | Ga0501036_0005434 | 3300049572 | Bacteria | 10327 |
| 371 | Ga0501036_0181117 | 3300049572 | Bacteria | 1774 |
| 372 | Ga0501037_0000193 | 3300049573 | Bacteria | 56422 |
| 373 | Ga0501037_0000314 | 3300049573 | Bacteria | 41093 |
| 374 | Ga0501037_0011253 | 3300049573 | Bacteria | 6587 |
| 375 | Ga0501037_0013195 | 3300049573 | Bacteria | 6090 |
| 376 | Ga0501037_0038941 | 3300049573 | Bacteria | 3501 |
| 377 | Ga0501038_0000070 | 3300049574 | Bacteria | 84371 |
| 378 | Ga0501038_0003569 | 3300049574 | Bacteria | 14470 |
| 379 | Ga0501038_0012897 | 3300049574 | Bacteria | 7624 |
| 380 | Ga0501038_0127220 | 3300049574 | Bacteria | 2096 |
| 381 | Ga0501039_0000213 | 3300049575 | Bacteria | 42565 |
| 382 | Ga0501043_0000297 | 3300049579 | Bacteria | 44905 |
| 383 | Ga0501043_0000528 | 3300049579 | Bacteria | 34344 |
| 384 | Ga0501043_0003051 | 3300049579 | Bacteria | 13907 |
| 385 | Ga0501046_0000354 | 3300049580 | Bacteria | 46165 |
| 386 | Ga0501046_0000723 | 3300049580 | Bacteria | 31896 |
| 387 | Ga0501047_0000136 | 3300049581 | Bacteria | 89236 |
| 388 | Ga0501047_0000232 | 3300049581 | Bacteria | 66245 |
| 389 | Ga0501047_0011817 | 3300049581 | Bacteria | 8258 |
| 390 | Ga0501047_0014029 | 3300049581 | Bacteria | 7614 |
| 391 | Ga0501047_0016466 | 3300049581 | Bacteria | 7058 |
| 392 | Ga0501047_0024045 | 3300049581 | Bacteria | 5851 |
| 393 | Ga0501047_0030751 | 3300049581 | Bacteria | 5175 |
| 394 | Ga0501047_0150909 | 3300049581 | Bacteria | 2200 |
| 395 | Ga0501047_0185455 | 3300049581 | Bacteria | 1946 |
| 396 | Ga0501048_0000549 | 3300049582 | Bacteria | 26486 |
| 397 | Ga0501048_0001340 | 3300049582 | Bacteria | 18669 |
| 398 | Ga0501048_0061095 | 3300049582 | Bacteria | 2669 |
| 399 | Ga0501067_0000177 | 3300049583 | Bacteria | 35936 |
| 400 | Ga0501067_0006328 | 3300049583 | Bacteria | 6565 |
| 401 | Ga0501068_0001111 | 3300049584 | Bacteria | 14242 |
| 402 | Ga0501068_0021396 | 3300049584 | Bacteria | 3776 |
| 403 | Ga0501069_0000053 | 3300049585 | Bacteria | 69525 |
| 404 | Ga0501069_0001057 | 3300049585 | Bacteria | 13186 |
| 405 | Ga0501069_0003421 | 3300049585 | Bacteria | 8151 |
| 406 | Ga0501069_0058936 | 3300049585 | Bacteria | 2142 |
| 407 | Ga0501070_0000584 | 3300049586 | Bacteria | 33258 |
| 408 | Ga0501070_0000809 | 3300049586 | Bacteria | 28427 |
| 409 | Ga0501070_0009108 | 3300049586 | Bacteria | 8394 |
| 410 | Ga0501070_0010492 | 3300049586 | Bacteria | 7834 |
| 411 | Ga0501070_0016165 | 3300049586 | Bacteria | 6271 |
| 412 | Ga0501070_0017520 | 3300049586 | Bacteria | 6013 |
| 413 | Ga0501070_0024007 | 3300049586 | Bacteria | 5113 |
| 414 | Ga0501070_0056726 | 3300049586 | Bacteria | 3247 |
| 415 | Ga0501071_0101661 | 3300049587 | Bacteria | 2119 |
| 416 | Ga0501072_0038522 | 3300049588 | Bacteria | 3752 |
| 417 | Ga0501073_0007452 | 3300049589 | Bacteria | 8135 |
| 418 | Ga0501073_0029134 | 3300049589 | Bacteria | 3945 |
| 419 | Ga0501074_0000290 | 3300049590 | Bacteria | 29108 |
| 420 | Ga0501074_0004851 | 3300049590 | Bacteria | 9645 |
| 421 | Ga0501074_0010550 | 3300049590 | Bacteria | 6704 |
| 422 | Ga0501077_0008756 | 3300049593 | Bacteria | 6279 |
| 423 | Ga0501079_0002529 | 3300049741 | Bacteria | 13273 |
| 424 | Ga0501080_0000022 | 3300049742 | Bacteria | 90630 |
| 425 | Ga0501080_0001079 | 3300049742 | Bacteria | 22484 |
| 426 | Ga0501080_0004288 | 3300049742 | Bacteria | 12657 |
| 427 | Ga0501080_0007875 | 3300049742 | Bacteria | 9643 |
| 428 | Ga0501080_0019442 | 3300049742 | Bacteria | 6291 |
| 429 | Ga0501083_0000300 | 3300049744 | Bacteria | 31205 |
| 430 | Ga0501083_0000385 | 3300049744 | Bacteria | 28012 |
| 431 | Ga0501083_0000780 | 3300049744 | Bacteria | 20915 |
| 432 | Ga0501083_0010807 | 3300049744 | Bacteria | 6419 |
| 433 | Ga0501083_0028354 | 3300049744 | Bacteria | 3859 |
| 434 | Ga0501083_0028424 | 3300049744 | Bacteria | 3853 |
| 435 | Ga0501035_0000120 | 3300049822 | Bacteria | 94532 |
| 436 | Ga0501035_0000867 | 3300049822 | Bacteria | 32271 |
| 437 | Ga0501035_0002746 | 3300049822 | Bacteria | 17074 |
| 438 | Ga0501035_0018243 | 3300049822 | Bacteria | 6464 |
| 439 | Ga0501035_0042818 | 3300049822 | Bacteria | 4082 |
| 440 | Ga0501035_0084501 | 3300049822 | Bacteria | 2799 |
| 441 | Ga0501044_0000179 | 3300049823 | Bacteria | 78633 |
| 442 | Ga0501044_0006502 | 3300049823 | Bacteria | 12911 |
| 443 | Ga0501044_0011041 | 3300049823 | Bacteria | 9799 |
| 444 | Ga0501044_0011281 | 3300049823 | Bacteria | 9683 |
| 445 | Ga0501044_0011930 | 3300049823 | Bacteria | 9417 |
| 446 | Ga0501044_0019140 | 3300049823 | Bacteria | 7329 |
| 447 | Ga0501044_0025115 | 3300049823 | Bacteria | 6318 |
| 448 | Ga0501044_0025681 | 3300049823 | Bacteria | 6245 |
| 449 | Ga0501044_0060163 | 3300049823 | Bacteria | 3890 |
| 450 | Ga0501044_0114503 | 3300049823 | Bacteria | 2702 |
| 451 | Ga0501044_0169582 | 3300049823 | Bacteria | 2155 |
| 452 | nmdc:mga07m45_3561_c2 | 3300050496 | Bacteria | 7086 |
| 453 | nmdc:mga08y16_3948_c1 | 3300050511 | Bacteria | 15438 |
| 454 | nmdc:mga0n895_647_c1 | 3300050512 | Bacteria | 24303 |
| 455 | nmdc:mga0rr50_15629_c1 | 3300050513 | Bacteria | 5015 |
| 456 | nmdc:mga0a205_123_c1 | 3300050515 | Bacteria | 47084 |
| 457 | nmdc:mga0a205_1705_c1 | 3300050515 | Bacteria | 18968 |
| 458 | Ga0500578_0053937 | 3300053086 | Bacteria | 2574 |
| 459 | Ga0501084_0043135 | 3300054114 | Bacteria | 3774 |
| 460 | Ga0501082_0007236 | 3300060353 | Bacteria | 9570 |
| 461 | Ga0501082_0007332 | 3300060353 | Bacteria | 9520 |
| 462 | 2513661407 | 2513237096 | Bacteria | 8722461 |
| 463 | 2513862478 | 2513237137 | Bacteria | 9558895 |
| 464 | 2513923104 | 2513237145 | Bacteria | 8979722 |
| 465 | 2643894522 | 2643221577 | Bacteria | 3710843 |
| 466 | 2671694781 | 2671180139 | Bacteria | 4196045 |
| 467 | 2861693002 | 2861691609 | Bacteria | 5628931 |
| 468 | 2879105108 | 2879099564 | Bacteria | 10442239 |
| 469 | 2894821665 | 2894817345 | Bacteria | 4892941 |
| 470 | 2902331476 | 2902330777 | Bacteria | 6395352 |
| 471 | 2932800235 | 2932794094 | Bacteria | 7915132 |
| 472 | 2932826799 | 2932818245 | Bacteria | 9955613 |
| 473 | 2935775992 | 2935769743 | Bacteria | 7878163 |
| 474 | 2935791604 | 2935785616 | Bacteria | 7962367 |
| 475 | 2935799916 | 2935793552 | Bacteria | 8012592 |
| 476 | 2941534631 | 2941531003 | Bacteria | 7653939 |
| 477 | 3005478011 | 3005474847 | Bacteria | 9259049 |
| 478 | 3005597734 | 3005594810 | Bacteria | 8716512 |
| 479 | 641336548 | 641228493 | Bacteria | 3999591 |
| 480 | 643390356 | 643348555 | Bacteria | 3914947 |
| 481 | 643604440 | 643348564 | Bacteria | 8839022 |
| 482 | 8016629854 | 8016622563 | Bacteria | 7999408 |
| 483 | 8019541513 | 8019538911 | Bacteria | 7872763 |
| 484 | 8019548793 | 8019547302 | Bacteria | 7996444 |
| 485 | 8055272396 | 8055266321 | Bacteria | 7999742 |
| 486 | Ga0070713_100095912 | |||
| 487 | JGI24741J21665_1000710 | |||
| 488 | JGI24741J21665_1003173 | |||
| 489 | JGI24740J21852_10000530 | |||
| 490 | rootH2_10005673 | |||
| 491 | Ga0070658_10061098 | |||
| 492 | Ga0070683_100002621 | |||
| 493 | Ga0070683_100008096 | |||
| 494 | Ga0070680_100001047 | |||
| 495 | Ga0070680_100001917 | |||
| 496 | Ga0070680_100018556 | |||
| 497 | Ga0070680_100031189 | |||
| 498 | Ga0070680_100087291 | |||
| 499 | Ga0070660_100020786 | |||
| 500 | Ga0070660_100056689 | |||
| 501 | Ga0070691_10011271 | |||
| 502 | Ga0070661_100009562 | |||
| 503 | Ga0070661_100014162 | |||
| 504 | Ga0070661_100068904 | |||
| 505 | Ga0070692_10005557 | |||
| 506 | Ga0070659_100008389 | |||
| 507 | Ga0070659_100010358 | |||
| 508 | Ga0070659_100080754 | |||
| 509 | Ga0070709_10005767 | |||
| 510 | Ga0070709_10032493 | |||
| 511 | Ga0070714_100002593 | |||
| 512 | Ga0070714_100012582 | |||
| 513 | Ga0070714_100044066 | |||
| 514 | Ga0070714_100066037 | |||
| 515 | Ga0070714_100077470 | |||
| 516 | Ga0070713_100005477 | |||
| 517 | Ga0070713_100149240 | |||
| 518 | Ga0070710_10013170 | |||
| 519 | Ga0070711_100076363 | |||
| 520 | Ga0070705_100003804 | |||
| 521 | Ga0070708_100029679 | |||
| 522 | Ga0070662_100009722 | |||
| 523 | Ga0070681_10000202 | |||
| 524 | Ga0070681_10000234 | |||
| 525 | Ga0070681_10004464 | |||
| 526 | Ga0070681_10005439 | |||
| 527 | Ga0070681_10030381 | |||
| 528 | Ga0070681_10126945 | |||
| 529 | Ga0070699_100008679 | |||
| 530 | Ga0070699_100013482 | |||
| 531 | Ga0070679_100000275 | |||
| 532 | Ga0070679_100002568 | |||
| 533 | Ga0070679_100002970 | |||
| 534 | Ga0070679_100005452 | |||
| 535 | Ga0070679_100018122 | |||
| 536 | Ga0070679_100069550 | |||
| 537 | Ga0070679_100207023 | |||
| 538 | Ga0070684_100002661 | |||
| 539 | Ga0070684_100010629 | |||
| 540 | Ga0070684_100067861 | |||
| 541 | Ga0070684_100171416 | |||
| 542 | Ga0070697_100006461 | |||
| 543 | Ga0068853_100012863 | |||
| 544 | Ga0068853_100022095 | |||
| 545 | Ga0068853_100026181 | |||
| 546 | Ga0068853_100129403 | |||
| 547 | Ga0070695_100003972 | |||
| 548 | Ga0070696_100001519 | |||
| 549 | Ga0070696_100007114 | |||
| 550 | Ga0070696_100031102 | |||
| 551 | Ga0070693_100003227 | |||
| 552 | Ga0070665_100002567 | |||
| 553 | Ga0070704_100008877 | |||
| 554 | Ga0068855_100001412 | |||
| 555 | Ga0068855_100005963 | |||
| 556 | Ga0068855_100009359 | |||
| 557 | Ga0068855_100012095 | |||
| 558 | Ga0068855_100014475 | |||
| 559 | Ga0070664_100154712 | |||
| 560 | Ga0068854_100002315 | |||
| 561 | Ga0068854_100023399 | |||
| 562 | Ga0068854_100037276 | |||
| 563 | Ga0068854_100109414 | |||
| 564 | Ga0068856_100023207 | |||
| 565 | Ga0068856_100056925 | |||
| 566 | Ga0068856_100066027 | |||
| 567 | Ga0068856_100070928 | |||
| 568 | Ga0068852_100006998 | |||
| 569 | Ga0068858_100001933 | |||
| 570 | Ga0081538_10020681 | |||
| 571 | Ga0070717_10024487 | |||
| 572 | Ga0070712_100024983 | |||
| 573 | Ga0075370_10019576 | |||
| 574 | Ga0068871_100139736 | |||
| 575 | Ga0075428_100002399 | |||
| 576 | Ga0075431_100011682 | |||
| 577 | Ga0075434_100000071 | |||
| 578 | Ga0075435_100000877 | |||
| 579 | Ga0105240_10005952 | |||
| 580 | Ga0105240_10007031 | |||
| 581 | Ga0105240_10011318 | |||
| 582 | Ga0105240_10034327 | |||
| 583 | Ga0105240_10073189 | |||
| 584 | Ga0105240_10149314 | |||
| 585 | Ga0105240_10179448 | |||
| 586 | Ga0105240_10253989 | |||
| 587 | Ga0105240_10282679 | |||
| 588 | Ga0111539_10006154 | |||
| 589 | Ga0105245_10036534 | |||
| 590 | Ga0105241_10002586 | |||
| 591 | Ga0105241_10003016 | |||
| 592 | Ga0105237_10002921 | |||
| 593 | Ga0105237_10013417 | |||
| 594 | Ga0105237_10066214 | |||
| 595 | Ga0105238_10005698 | |||
| 596 | Ga0105238_10021258 | |||
| 597 | Ga0105238_10021265 | |||
| 598 | Ga0105238_10093450 | |||
| 599 | Ga0105238_10199153 | |||
| 600 | Ga0105239_10003553 | |||
| 601 | Ga0105239_10004794 | |||
| 602 | Ga0105239_10005794 | |||
| 603 | Ga0105239_10041495 | |||
| 604 | Ga0105239_10071296 | |||
| 605 | Ga0105239_10132776 | |||
| 606 | Ga0105239_10137239 | |||
| 607 | Ga0105239_10194734 | |||
| 608 | Ga0157373_10002168 | |||
| 609 | Ga0157373_10019273 | |||
| 610 | Ga0157373_10030920 | |||
| 611 | Ga0157371_10000551 | |||
| 612 | Ga0157370_10003631 | |||
| 613 | Ga0157370_10010625 | |||
| 614 | Ga0157370_10014793 | |||
| 615 | Ga0157370_10057231 | |||
| 616 | Ga0157370_10081727 | |||
| 617 | Ga0157369_10001218 | |||
| 618 | Ga0157369_10011586 | |||
| 619 | Ga0157369_10030061 | |||
| 620 | Ga0157369_10061775 | |||
| 621 | Ga0157369_10072673 | |||
| 622 | Ga0157369_10211392 | |||
| 623 | Ga0157372_10000668 | |||
| 624 | Ga0157372_10004449 | |||
| 625 | Ga0157372_10015447 | |||
| 626 | Ga0157372_10043384 | |||
| 627 | Ga0157372_10050958 | |||
| 628 | Ga0157372_10058216 | |||
| 629 | Ga0157372_10186131 | |||
| 630 | Ga0182008_10021032 | |||
| 631 | Ga0182007_10001621 | |||
| 632 | Ga0213872_10059020 | |||
| 633 | Ga0213876_10000110 | |||
| 634 | Ga0209677_101747 | |||
| 635 | Ga0209233_1000654 | |||
| 636 | Ga0209455_1001581 | |||
| 637 | Ga0207692_10012534 | |||
| 638 | Ga0207647_10000240 | |||
| 639 | Ga0207699_10001446 | |||
| 640 | Ga0207705_10004651 | |||
| 641 | Ga0207705_10006310 | |||
| 642 | Ga0207705_10006671 | |||
| 643 | Ga0207684_10046438 | |||
| 644 | Ga0207654_10000888 | |||
| 645 | Ga0207707_10000177 | |||
| 646 | Ga0207707_10000295 | |||
| 647 | Ga0207707_10000438 | |||
| 648 | Ga0207707_10000480 | |||
| 649 | Ga0207707_10000629 | |||
| 650 | Ga0207707_10001999 | |||
| 651 | Ga0207707_10004566 | |||
| 652 | Ga0207707_10008006 | |||
| 653 | Ga0207707_10023351 | |||
| 654 | Ga0207695_10002355 | |||
| 655 | Ga0207695_10003043 | |||
| 656 | Ga0207695_10008100 | |||
| 657 | Ga0207695_10012643 | |||
| 658 | Ga0207695_10019247 | |||
| 659 | Ga0207695_10022460 | |||
| 660 | Ga0207695_10039567 | |||
| 661 | Ga0207695_10051885 | |||
| 662 | Ga0207695_10122911 | |||
| 663 | Ga0207695_10138694 | |||
| 664 | Ga0207695_10159939 | |||
| 665 | Ga0207671_10002597 | |||
| 666 | Ga0207671_10011995 | |||
| 667 | Ga0207671_10062668 | |||
| 668 | Ga0207693_10023681 | |||
| 669 | Ga0207693_10033398 | |||
| 670 | Ga0207693_10109459 | |||
| 671 | Ga0207663_10052029 | |||
| 672 | Ga0207660_10001343 | |||
| 673 | Ga0207660_10003909 | |||
| 674 | Ga0207660_10005892 | |||
| 675 | Ga0207660_10017846 | |||
| 676 | Ga0207660_10019175 | |||
| 677 | Ga0207660_10028499 | |||
| 678 | Ga0207660_10051357 | |||
| 679 | Ga0207660_10091193 | |||
| 680 | Ga0207657_10004715 | |||
| 681 | Ga0207657_10018774 | |||
| 682 | Ga0207657_10019277 | |||
| 683 | Ga0207657_10031611 | |||
| 684 | Ga0207649_10003380 | |||
| 685 | Ga0207649_10003782 | |||
| 686 | Ga0207649_10010448 | |||
| 687 | Ga0207649_10017840 | |||
| 688 | Ga0207652_10000148 | |||
| 689 | Ga0207652_10000438 | |||
| 690 | Ga0207652_10002234 | |||
| 691 | Ga0207652_10002454 | |||
| 692 | Ga0207652_10003966 | |||
| 693 | Ga0207652_10005126 | |||
| 694 | Ga0207652_10009861 | |||
| 695 | Ga0207652_10013975 | |||
| 696 | Ga0207652_10061343 | |||
| 697 | Ga0207694_10012808 | |||
| 698 | Ga0207694_10037613 | |||
| 699 | Ga0207694_10040591 | |||
| 700 | Ga0207700_10005369 | |||
| 701 | Ga0207700_10031593 | |||
| 702 | Ga0207700_10118809 | |||
| 703 | Ga0207664_10001750 | |||
| 704 | Ga0207664_10024731 | |||
| 705 | Ga0207690_10004416 | |||
| 706 | Ga0207690_10018534 | |||
| 707 | Ga0207690_10059988 | |||
| 708 | Ga0207706_10164921 | |||
| 709 | Ga0207670_10023061 | |||
| 710 | Ga0207665_10002969 | |||
| 711 | Ga0207661_10054390 | |||
| 712 | Ga0207661_10055604 | |||
| 713 | Ga0207679_10027707 | |||
| 714 | Ga0207667_10001466 | |||
| 715 | Ga0207667_10005158 | |||
| 716 | Ga0207667_10006044 | |||
| 717 | Ga0207667_10006663 | |||
| 718 | Ga0207667_10006791 | |||
| 719 | Ga0207667_10009324 | |||
| 720 | Ga0207667_10015302 | |||
| 721 | Ga0207667_10075633 | |||
| 722 | Ga0207667_10182214 | |||
| 723 | Ga0207640_10001189 | |||
| 724 | Ga0207640_10018675 | |||
| 725 | Ga0207640_10028063 | |||
| 726 | Ga0207703_10000763 | |||
| 727 | Ga0207639_10003701 | |||
| 728 | Ga0207639_10019200 | |||
| 729 | Ga0207639_10022235 | |||
| 730 | Ga0207678_10000650 | |||
| 731 | Ga0207678_10003106 | |||
| 732 | Ga0207702_10011536 | |||
| 733 | Ga0207702_10030222 | |||
| 734 | Ga0207702_10038373 | |||
| 735 | Ga0207702_10087573 | |||
| 736 | Ga0207674_10003058 | |||
| 737 | Ga0207674_10050822 | |||
| 738 | Ga0207674_10090584 | |||
| 739 | Ga0207674_10101154 | |||
| 740 | Ga0207698_10006713 | |||
| 741 | Ga0207698_10069071 | |||
| 742 | Ga0207698_10116633 | |||
| 743 | Ga0265334_10001829 | |||
| 744 | Ga0265338_10000029 | |||
| 745 | Ga0265324_10017325 | |||
| 746 | Ga0265325_10001061 | |||
| 747 | Ga0307416_100047337 | |||
| 748 | Ga0307510_10000705 | |||
| 749 | Ga0373943_0000387 | |||
| 750 | Ga0373933_0021321 | |||
| 751 | Ga0373947_0000965 | |||
| 752 | Ga0373937_0019321 | |||
| 753 | Ga0395899_0002359 | |||
| 754 | Ga0395899_0002689 | |||
| 755 | Ga0395899_0005914 | |||
| 756 | Ga0395900_0002500 | |||
| 757 | Ga0395900_0005675 | |||
| 758 | Ga0395900_0070489 | |||
| 759 | Ga0395900_0081492 | |||
| 760 | Ga0395900_0132922 | |||
| 761 | Ga0395900_0134147 | |||
| 762 | Ga0395900_0151169 | |||
| 763 | Ga0395898_0004355 | |||
| 764 | Ga0395898_0012143 | |||
| 765 | Ga0395898_0031690 | |||
| 766 | Ga0395898_0094923 | |||
| 767 | Ga0395898_0124923 | |||
| 768 | Ga0395898_0302195 | |||
| 769 | Ga0395905_0000747 | |||
| 770 | Ga0395905_0007499 | |||
| 771 | Ga0395905_0065625 | |||
| 772 | Ga0395905_0098406 | |||
| 773 | Ga0395905_0142931 | |||
| 774 | Ga0395905_0190416 | |||
| 775 | Ga0436364_0077336 | |||
| 776 | Ga0436364_0240030 | |||
| 777 | Ga0436364_0353090 | |||
| 778 | Ga0436364_0586291 | |||
| 779 | Ga0436364_0708881 | |||
| 780 | Ga0395901_0002327 | |||
| 781 | Ga0395901_0007696 | |||
| 782 | Ga0395901_0044877 | |||
| 783 | Ga0436365_0051833 | |||
| 784 | Ga0436365_0119251 | |||
| 785 | Ga0436365_0275035 | |||
| 786 | Ga0436365_1204615 | |||
| 787 | Ga0436365_1291084 | |||
| 788 | Ga0436365_1850675 | |||
| 789 | Ga0436360_1255064 | |||
| 790 | Ga0436361_0209567 | |||
| 791 | Ga0436361_1119569 | |||
| 792 | Ga0436362_0829594 | |||
| 793 | Ga0466969_0005483 | |||
| 794 | Ga0466969_0005964 | |||
| 795 | Ga0466969_0006983 | |||
| 796 | Ga0466969_0008783 | |||
| 797 | Ga0453683_0056769 | |||
| 798 | Ga0466965_0008080 | |||
| 799 | Ga0466966_0017733 | |||
| 800 | Ga0466966_0037904 | |||
| 801 | Ga0466961_0000451 | |||
| 802 | Ga0466964_0004100 | |||
| 803 | Ga0453684_0000671 | |||
| 804 | Ga0466968_0001610 | |||
| 805 | Ga0466970_0002696 | |||
| 806 | Ga0466957_0049862 | |||
| 807 | Ga0466959_0008263 | |||
| 808 | Ga0466959_0057045 | |||
| 809 | Ga0466958_0003110 | |||
| 810 | Ga0466958_0014733 | |||
| 811 | Ga0466967_0026456 | |||
| 812 | Ga0466967_0158500 | |||
| 813 | Ga0466967_0188633 | |||
| 814 | Ga0466967_0219436 | |||
| 815 | Ga0495639_0013094 | |||
| 816 | Ga0495607_0000060 | |||
| 817 | Ga0495606_0002102 | |||
| 818 | Ga0495686_0006031 | |||
| 819 | Ga0496101_0009883 | |||
| 820 | Ga0496102_0004215 | |||
| 821 | Ga0496102_0174776 | |||
| 822 | Ga0496106_0002322 | |||
| 823 | Ga0496106_0072206 | |||
| 824 | Ga0496107_0067331 | |||
| 825 | Ga0496108_0000037 | |||
| 826 | Ga0496108_0001632 | |||
| 827 | Ga0496109_0003738 | |||
| 828 | Ga0496110_0007578 | |||
| 829 | Ga0496110_0008560 | |||
| 830 | Ga0496111_0016726 | |||
| 831 | Ga0496111_0037396 | |||
| 832 | Ga0496112_0022022 | |||
| 833 | Ga0496112_0183979 | |||
| 834 | Ga0496115_0045621 | |||
| 835 | Ga0496116_0002394 | |||
| 836 | Ga0496118_0007103 | |||
| 837 | Ga0496121_0022044 | |||
| 838 | Ga0496125_0000331 | |||
| 839 | Ga0496126_0079201 | |||
| 840 | Ga0501031_0003951 | |||
| 841 | Ga0501031_0073893 | |||
| 842 | Ga0501032_0000055 | |||
| 843 | Ga0501032_0001930 | |||
| 844 | Ga0501032_0002690 | |||
| 845 | Ga0501033_0000163 | |||
| 846 | Ga0501033_0000960 | |||
| 847 | Ga0501033_0002886 | |||
| 848 | Ga0501033_0009215 | |||
| 849 | Ga0501034_0001317 | |||
| 850 | Ga0501034_0008452 | |||
| 851 | Ga0501034_0021771 | |||
| 852 | Ga0501034_0027830 | |||
| 853 | Ga0501036_0000021 | |||
| 854 | Ga0501036_0000363 | |||
| 855 | Ga0501036_0005434 | |||
| 856 | Ga0501036_0181117 | |||
| 857 | Ga0501037_0000193 | |||
| 858 | Ga0501037_0000314 | |||
| 859 | Ga0501037_0011253 | |||
| 860 | Ga0501037_0013195 | |||
| 861 | Ga0501037_0038941 | |||
| 862 | Ga0501038_0000070 | |||
| 863 | Ga0501038_0003569 | |||
| 864 | Ga0501038_0012897 | |||
| 865 | Ga0501038_0127220 | |||
| 866 | Ga0501039_0000213 | |||
| 867 | Ga0501043_0000297 | |||
| 868 | Ga0501043_0000528 | |||
| 869 | Ga0501043_0003051 | |||
| 870 | Ga0501046_0000354 | |||
| 871 | Ga0501046_0000723 | |||
| 872 | Ga0501047_0000136 | |||
| 873 | Ga0501047_0000232 | |||
| 874 | Ga0501047_0011817 | |||
| 875 | Ga0501047_0014029 | |||
| 876 | Ga0501047_0016466 | |||
| 877 | Ga0501047_0024045 | |||
| 878 | Ga0501047_0030751 | |||
| 879 | Ga0501047_0150909 | |||
| 880 | Ga0501047_0185455 | |||
| 881 | Ga0501048_0000549 | |||
| 882 | Ga0501048_0001340 | |||
| 883 | Ga0501048_0061095 | |||
| 884 | Ga0501067_0000177 | |||
| 885 | Ga0501067_0006328 | |||
| 886 | Ga0501068_0001111 | |||
| 887 | Ga0501068_0021396 | |||
| 888 | Ga0501069_0000053 | |||
| 889 | Ga0501069_0001057 | |||
| 890 | Ga0501069_0003421 | |||
| 891 | Ga0501069_0058936 | |||
| 892 | Ga0501070_0000584 | |||
| 893 | Ga0501070_0000809 | |||
| 894 | Ga0501070_0009108 | |||
| 895 | Ga0501070_0010492 | |||
| 896 | Ga0501070_0016165 | |||
| 897 | Ga0501070_0017520 | |||
| 898 | Ga0501070_0024007 | |||
| 899 | Ga0501070_0056726 | |||
| 900 | Ga0501071_0101661 | |||
| 901 | Ga0501072_0038522 | |||
| 902 | Ga0501073_0007452 | |||
| 903 | Ga0501073_0029134 | |||
| 904 | Ga0501074_0000290 | |||
| 905 | Ga0501074_0004851 | |||
| 906 | Ga0501074_0010550 | |||
| 907 | Ga0501077_0008756 | |||
| 908 | Ga0501079_0002529 | |||
| 909 | Ga0501080_0000022 | |||
| 910 | Ga0501080_0001079 | |||
| 911 | Ga0501080_0004288 | |||
| 912 | Ga0501080_0007875 | |||
| 913 | Ga0501080_0019442 | |||
| 914 | Ga0501083_0000300 | |||
| 915 | Ga0501083_0000385 | |||
| 916 | Ga0501083_0000780 | |||
| 917 | Ga0501083_0010807 | |||
| 918 | Ga0501083_0028354 | |||
| 919 | Ga0501083_0028424 | |||
| 920 | Ga0501035_0000120 | |||
| 921 | Ga0501035_0000867 | |||
| 922 | Ga0501035_0002746 | |||
| 923 | Ga0501035_0018243 | |||
| 924 | Ga0501035_0042818 | |||
| 925 | Ga0501035_0084501 | |||
| 926 | Ga0501044_0000179 | |||
| 927 | Ga0501044_0006502 | |||
| 928 | Ga0501044_0011041 | |||
| 929 | Ga0501044_0011281 | |||
| 930 | Ga0501044_0011930 | |||
| 931 | Ga0501044_0019140 | |||
| 932 | Ga0501044_0025115 | |||
| 933 | Ga0501044_0025681 | |||
| 934 | Ga0501044_0060163 | |||
| 935 | Ga0501044_0114503 | |||
| 936 | Ga0501044_0169582 | |||
| 937 | nmdc:mga07m45_3561_c2 | |||
| 938 | nmdc:mga08y16_3948_c1 | |||
| 939 | nmdc:mga0n895_647_c1 | |||
| 940 | nmdc:mga0rr50_15629_c1 | |||
| 941 | nmdc:mga0a205_123_c1 | |||
| 942 | nmdc:mga0a205_1705_c1 | |||
| 943 | Ga0500578_0053937 | |||
| 944 | Ga0501084_0043135 | |||
| 945 | Ga0501082_0007236 | |||
| 946 | Ga0501082_0007332 | |||
| 947 | 2513661407 | |||
| 948 | 2513862478 | |||
| 949 | 2513923104 | |||
| 950 | 2643894522 | |||
| 951 | 2671694781 | |||
| 952 | 2861693002 | |||
| 953 | 2879105108 | |||
| 954 | 2894821665 | |||
| 955 | 2902331476 | |||
| 956 | 2932800235 | |||
| 957 | 2932826799 | |||
| 958 | 2935775992 | |||
| 959 | 2935791604 | |||
| 960 | 2935799916 | |||
| 961 | 2941534631 | |||
| 962 | 3005478011 | |||
| 963 | 3005597734 | |||
| 964 | 641336548 | |||
| 965 | 643390356 | |||
| 966 | 643604440 | |||
| 967 | 8016629854 | |||
| 968 | 8019541513 | |||
| 969 | 8019548793 | |||
| 970 | 8055272396 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1m57-assembly2.cif.gz_G | structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant)) | 0.9244 | 24 | 513 |
| 3oma-assembly2.cif.gz_C | catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation | 0.9208 | 29 | 504 |
| 3omi-assembly2.cif.gz_C | catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation | 0.9206 | 29 | 504 |
| 8d4t-assembly1.cif.gz_N | mammalian civ with gdn bound | 0.9192 | 27 | 515 |
| 8c8q-assembly1.cif.gz_A | cytochrome c oxidase from schizosaccharomyces pombe | 0.9175 | 29 | 515 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZK0_30_556_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9215 | 27 | 512 | 1.20.210.10 |
| af_P9WP71_20_544_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9126 | 22 | 518 | 1.20.210.10 |
| af_Q7HP04_41_512_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9106 | 27 | 470 | 1.20.210.10 |
| af_O21042_10_509_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9006 | 28 | 480 | 1.20.210.10 |
| 2yevD01 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.8985 | 30 | 522 | 1.20.210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A422QD25-F1-model_v4 | Cytochrome oxidase subunit I | 0.9926 | 242 | 431 |
GO:0004129
GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904 |
| AF-A0A3D2M157-F1-model_v4 | Cytochrome c oxidase subunit I | 0.9916 | 248 | 514 |
GO:0004129
GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904 |
| AF-G4Y993-F1-model_v4 | Cytochrome c oxidase subunit 1 (EC 7.1.1.9) | 0.9913 | 242 | 478 |
GO:0004129
GO:0005743 GO:0006123 GO:0015990 GO:0020037 GO:0046872 |
| AF-B7XCS5-F1-model_v4 | Cytochrome c oxidase subunit 1 (EC 7.1.1.9) | 0.9909 | 237 | 398 |
GO:0004129
GO:0005743 GO:0006123 GO:0015990 GO:0020037 GO:0046872 |
| AF-A0A0A1I5H3-F1-model_v4 | Cytochrome c oxidase subunit 1 (EC 7.1.1.9) | 0.9906 | 229 | 434 |
GO:0004129
GO:0005743 GO:0006123 GO:0015990 GO:0020037 GO:0046872 |