F453056

General Info

Members Datasets Scaffolds Average Seq Length
485 206 970 532

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100095912|Ga0070713_1000959122
Length 565
Sequence MVSRTVTADVTEYSRLPSVMELPNYLNNEHTLGSWLFTTDHKRIGILFAFSITGFFFLGAVAIGIVRLELLTPAPDLVSDDTYNKLFTLHGIVMVWFFLIPSIPATLGNFLLPLMIGAKDLAFPRLNLTSWYLFMAGGIITLVAVIAGGVDSGWTFYVPYSSQFSHSLVAVAAAGVFVNGFSSILTGINFIATTHMLRAPGLTWFRLPLFVWAMYTTSAVMILATPVLAITLLLMAMERLFAIPIFDAAQGGDPLLFQHLFWFYSHPAVYIMLLPAMGVVSEIFTCFARRRVFGYQFMVYALVSIAVIGFFVWGHHMFVAGMSPFANLVFSFLSFVVAVPSAIKVFNWTATLYRGQITFEAAMLYALAFLWLFTVGGLSGLFLATVPIDIHVTDTYFVVAHFHYIMVGGSVSAMFGGLHFWWPKITGRLYPEGWARFAAILMFFGFNLTFFPQFVMGYAGMPRRYHAYAPEFQIFHVLSTAGAAVLGVAYILPLAYFWWSVFHGRRAHSNPWNATGLEWQTESPPPRDNFRQQPLVTAGPYCYHAETEGPEAENRGELRLDPIIT

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
184 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
185 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
186 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
187 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
188 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
189 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
190 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
191 2902330777 Methylobacterium sp. 2A Isolate Unclassified
192 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
193 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
194 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
195 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
196 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
197 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
198 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
199 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
200 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
201 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
202 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
203 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
204 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
205 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
206 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 0
Isolates 4.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 3.51
Rhizoplane 3.3
Rhizosphere 86.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100095912 3300005436 Bacteria 2559
2 JGI24741J21665_1000710 3300001915 Bacteria 10037
3 JGI24741J21665_1003173 3300001915 Bacteria 4017
4 JGI24740J21852_10000530 3300001979 Bacteria 16298
5 rootH2_10005673 3300003320 Bacteria 75939
6 Ga0070658_10061098 3300005327 Bacteria 3069
7 Ga0070683_100002621 3300005329 Bacteria 14385
8 Ga0070683_100008096 3300005329 Bacteria 8927
9 Ga0070680_100001047 3300005336 Bacteria 19785
10 Ga0070680_100001917 3300005336 Bacteria 15277
11 Ga0070680_100018556 3300005336 Bacteria 5499
12 Ga0070680_100031189 3300005336 Bacteria 4285
13 Ga0070680_100087291 3300005336 Bacteria 2580
14 Ga0070660_100020786 3300005339 Bacteria 4832
15 Ga0070660_100056689 3300005339 Bacteria 3032
16 Ga0070691_10011271 3300005341 Bacteria 4078
17 Ga0070661_100009562 3300005344 Bacteria 6716
18 Ga0070661_100014162 3300005344 Bacteria 5617
19 Ga0070661_100068904 3300005344 Bacteria 2600
20 Ga0070692_10005557 3300005345 Bacteria 5391
21 Ga0070659_100008389 3300005366 Bacteria 7547
22 Ga0070659_100010358 3300005366 Bacteria 6856
23 Ga0070659_100080754 3300005366 Bacteria 2596
24 Ga0070709_10005767 3300005434 Bacteria 6717
25 Ga0070709_10032493 3300005434 Bacteria 3147
26 Ga0070714_100002593 3300005435 Bacteria 13321
27 Ga0070714_100012582 3300005435 Bacteria 6760
28 Ga0070714_100044066 3300005435 Bacteria 3776
29 Ga0070714_100066037 3300005435 Bacteria 3117
30 Ga0070714_100077470 3300005435 Bacteria 2888
31 Ga0070713_100005477 3300005436 Bacteria 8683
32 Ga0070713_100149240 3300005436 Bacteria 2078
33 Ga0070710_10013170 3300005437 Bacteria 4133
34 Ga0070711_100076363 3300005439 Bacteria 2375
35 Ga0070705_100003804 3300005440 Bacteria 7382
36 Ga0070708_100029679 3300005445 Bacteria 4719
37 Ga0070662_100009722 3300005457 Bacteria 6294
38 Ga0070681_10000202 3300005458 Bacteria 46492
39 Ga0070681_10000234 3300005458 Bacteria 43792
40 Ga0070681_10004464 3300005458 Bacteria 13330
41 Ga0070681_10005439 3300005458 Bacteria 12303
42 Ga0070681_10030381 3300005458 Bacteria 5421
43 Ga0070681_10126945 3300005458 Bacteria 2483
44 Ga0070699_100008679 3300005518 Bacteria 8808
45 Ga0070699_100013482 3300005518 Bacteria 7040
46 Ga0070679_100000275 3300005530 Bacteria 43254
47 Ga0070679_100002568 3300005530 Bacteria 16485
48 Ga0070679_100002970 3300005530 Bacteria 15469
49 Ga0070679_100005452 3300005530 Bacteria 11789
50 Ga0070679_100018122 3300005530 Bacteria 6826
51 Ga0070679_100069550 3300005530 Bacteria 3511
52 Ga0070679_100207023 3300005530 Bacteria 1926
53 Ga0070684_100002661 3300005535 Bacteria 13192
54 Ga0070684_100010629 3300005535 Bacteria 7298
55 Ga0070684_100067861 3300005535 Bacteria 3134
56 Ga0070684_100171416 3300005535 Bacteria 1971
57 Ga0070697_100006461 3300005536 Bacteria 9077
58 Ga0068853_100012863 3300005539 Bacteria 6819
59 Ga0068853_100022095 3300005539 Bacteria 5309
60 Ga0068853_100026181 3300005539 Bacteria 4897
61 Ga0068853_100129403 3300005539 Bacteria 2259
62 Ga0070695_100003972 3300005545 Bacteria 8639
63 Ga0070696_100001519 3300005546 Bacteria 15228
64 Ga0070696_100007114 3300005546 Bacteria 7472
65 Ga0070696_100031102 3300005546 Bacteria 3657
66 Ga0070693_100003227 3300005547 Bacteria 7570
67 Ga0070665_100002567 3300005548 Bacteria 19910
68 Ga0070704_100008877 3300005549 Bacteria 6051
69 Ga0068855_100001412 3300005563 Bacteria 29813
70 Ga0068855_100005963 3300005563 Bacteria 14860
71 Ga0068855_100009359 3300005563 Bacteria 11828
72 Ga0068855_100012095 3300005563 Bacteria 10428
73 Ga0068855_100014475 3300005563 Bacteria 9499
74 Ga0070664_100154712 3300005564 Bacteria 2026
75 Ga0068854_100002315 3300005578 Bacteria 11742
76 Ga0068854_100023399 3300005578 Bacteria 4220
77 Ga0068854_100037276 3300005578 Bacteria 3412
78 Ga0068854_100109414 3300005578 Bacteria 2082
79 Ga0068856_100023207 3300005614 Bacteria 6034
80 Ga0068856_100056925 3300005614 Bacteria 3859
81 Ga0068856_100066027 3300005614 Bacteria 3575
82 Ga0068856_100070928 3300005614 Bacteria 3448
83 Ga0068852_100006998 3300005616 Bacteria 8209
84 Ga0068858_100001933 3300005842 Bacteria 21122
85 Ga0081538_10020681 3300005981 Bacteria 4832
86 Ga0070717_10024487 3300006028 Bacteria 4793
87 Ga0070712_100024983 3300006175 Bacteria 3965
88 Ga0075370_10019576 3300006353 Bacteria 3688
89 Ga0068871_100139736 3300006358 Bacteria 2059
90 Ga0075428_100002399 3300006844 Bacteria 20348
91 Ga0075431_100011682 3300006847 Bacteria 8860
92 Ga0075434_100000071 3300006871 Bacteria 53243
93 Ga0075435_100000877 3300007076 Bacteria 18866
94 Ga0105240_10005952 3300009093 Bacteria 18044
95 Ga0105240_10007031 3300009093 Bacteria 16419
96 Ga0105240_10011318 3300009093 Bacteria 12430
97 Ga0105240_10034327 3300009093 Bacteria 6544
98 Ga0105240_10073189 3300009093 Bacteria 4231
99 Ga0105240_10149314 3300009093 Bacteria 2785
100 Ga0105240_10179448 3300009093 Bacteria 2500
101 Ga0105240_10253989 3300009093 Bacteria 2031
102 Ga0105240_10282679 3300009093 Bacteria 1905
103 Ga0111539_10006154 3300009094 Bacteria 15494
104 Ga0105245_10036534 3300009098 Bacteria 4364
105 Ga0105241_10002586 3300009174 Bacteria 13579
106 Ga0105241_10003016 3300009174 Bacteria 12586
107 Ga0105237_10002921 3300009545 Bacteria 20703
108 Ga0105237_10013417 3300009545 Bacteria 8595
109 Ga0105237_10066214 3300009545 Bacteria 3608
110 Ga0105238_10005698 3300009551 Bacteria 12312
111 Ga0105238_10021258 3300009551 Bacteria 6613
112 Ga0105238_10021265 3300009551 Bacteria 6612
113 Ga0105238_10093450 3300009551 Bacteria 2996
114 Ga0105238_10199153 3300009551 Bacteria 1978
115 Ga0105239_10003553 3300010375 Bacteria 19062
116 Ga0105239_10004794 3300010375 Bacteria 16052
117 Ga0105239_10005794 3300010375 Bacteria 14415
118 Ga0105239_10041495 3300010375 Bacteria 5043
119 Ga0105239_10071296 3300010375 Bacteria 3818
120 Ga0105239_10132776 3300010375 Bacteria 2770
121 Ga0105239_10137239 3300010375 Bacteria 2723
122 Ga0105239_10194734 3300010375 Bacteria 2269
123 Ga0157373_10002168 3300013100 Bacteria 14869
124 Ga0157373_10019273 3300013100 Bacteria 4969
125 Ga0157373_10030920 3300013100 Bacteria 3853
126 Ga0157371_10000551 3300013102 Bacteria 44580
127 Ga0157370_10003631 3300013104 Bacteria 18035
128 Ga0157370_10010625 3300013104 Bacteria 9689
129 Ga0157370_10014793 3300013104 Bacteria 7963
130 Ga0157370_10057231 3300013104 Bacteria 3708
131 Ga0157370_10081727 3300013104 Bacteria 3040
132 Ga0157369_10001218 3300013105 Bacteria 32009
133 Ga0157369_10011586 3300013105 Bacteria 10011
134 Ga0157369_10030061 3300013105 Bacteria 5994
135 Ga0157369_10061775 3300013105 Bacteria 4038
136 Ga0157369_10072673 3300013105 Bacteria 3692
137 Ga0157369_10211392 3300013105 Bacteria 2033
138 Ga0157372_10000668 3300013307 Bacteria 37714
139 Ga0157372_10004449 3300013307 Bacteria 14949
140 Ga0157372_10015447 3300013307 Bacteria 8183
141 Ga0157372_10043384 3300013307 Bacteria 4979
142 Ga0157372_10050958 3300013307 Bacteria 4605
143 Ga0157372_10058216 3300013307 Bacteria 4319
144 Ga0157372_10186131 3300013307 Bacteria 2405
145 Ga0182008_10021032 3300014497 Bacteria 3354
146 Ga0182007_10001621 3300015262 Bacteria 11937
147 Ga0213872_10059020 3300021361 Bacteria 1736
148 Ga0213876_10000110 3300021384 Bacteria 90322
149 Ga0209677_101747 3300025253 Bacteria 9025
150 Ga0209233_1000654 3300025261 Bacteria 16891
151 Ga0209455_1001581 3300025272 Bacteria 10032
152 Ga0207692_10012534 3300025898 Bacteria 3644
153 Ga0207647_10000240 3300025904 Bacteria 44855
154 Ga0207699_10001446 3300025906 Bacteria 11276
155 Ga0207705_10004651 3300025909 Bacteria 10358
156 Ga0207705_10006310 3300025909 Bacteria 8800
157 Ga0207705_10006671 3300025909 Bacteria 8537
158 Ga0207684_10046438 3300025910 Bacteria 3684
159 Ga0207654_10000888 3300025911 Bacteria 16582
160 Ga0207707_10000177 3300025912 Bacteria 66169
161 Ga0207707_10000295 3300025912 Bacteria 53118
162 Ga0207707_10000438 3300025912 Bacteria 43316
163 Ga0207707_10000480 3300025912 Bacteria 41364
164 Ga0207707_10000629 3300025912 Bacteria 34950
165 Ga0207707_10001999 3300025912 Bacteria 18517
166 Ga0207707_10004566 3300025912 Bacteria 12169
167 Ga0207707_10008006 3300025912 Bacteria 9181
168 Ga0207707_10023351 3300025912 Bacteria 5410
169 Ga0207695_10002355 3300025913 Bacteria 28094
170 Ga0207695_10003043 3300025913 Bacteria 24037
171 Ga0207695_10008100 3300025913 Bacteria 13217
172 Ga0207695_10012643 3300025913 Bacteria 10112
173 Ga0207695_10019247 3300025913 Bacteria 7863
174 Ga0207695_10022460 3300025913 Bacteria 7159
175 Ga0207695_10039567 3300025913 Bacteria 5067
176 Ga0207695_10051885 3300025913 Bacteria 4302
177 Ga0207695_10122911 3300025913 Bacteria 2562
178 Ga0207695_10138694 3300025913 Bacteria 2383
179 Ga0207695_10159939 3300025913 Bacteria 2184
180 Ga0207671_10002597 3300025914 Bacteria 19078
181 Ga0207671_10011995 3300025914 Bacteria 7003
182 Ga0207671_10062668 3300025914 Bacteria 2762
183 Ga0207693_10023681 3300025915 Bacteria 4872
184 Ga0207693_10033398 3300025915 Bacteria 4060
185 Ga0207693_10109459 3300025915 Bacteria 2167
186 Ga0207663_10052029 3300025916 Bacteria 2553
187 Ga0207660_10001343 3300025917 Bacteria 16470
188 Ga0207660_10003909 3300025917 Bacteria 9709
189 Ga0207660_10005892 3300025917 Bacteria 7961
190 Ga0207660_10017846 3300025917 Bacteria 4723
191 Ga0207660_10019175 3300025917 Bacteria 4568
192 Ga0207660_10028499 3300025917 Bacteria 3820
193 Ga0207660_10051357 3300025917 Bacteria 2931
194 Ga0207660_10091193 3300025917 Bacteria 2259
195 Ga0207657_10004715 3300025919 Bacteria 14388
196 Ga0207657_10018774 3300025919 Bacteria 6587
197 Ga0207657_10019277 3300025919 Bacteria 6483
198 Ga0207657_10031611 3300025919 Bacteria 4792
199 Ga0207649_10003380 3300025920 Bacteria 8727
200 Ga0207649_10003782 3300025920 Bacteria 8257
201 Ga0207649_10010448 3300025920 Bacteria 5101
202 Ga0207649_10017840 3300025920 Bacteria 4026
203 Ga0207652_10000148 3300025921 Bacteria 75801
204 Ga0207652_10000438 3300025921 Bacteria 43260
205 Ga0207652_10002234 3300025921 Bacteria 16513
206 Ga0207652_10002454 3300025921 Bacteria 15642
207 Ga0207652_10003966 3300025921 Bacteria 12099
208 Ga0207652_10005126 3300025921 Bacteria 10633
209 Ga0207652_10009861 3300025921 Bacteria 7685
210 Ga0207652_10013975 3300025921 Bacteria 6501
211 Ga0207652_10061343 3300025921 Bacteria 3247
212 Ga0207694_10012808 3300025924 Bacteria 6317
213 Ga0207694_10037613 3300025924 Bacteria 3718
214 Ga0207694_10040591 3300025924 Bacteria 3584
215 Ga0207700_10005369 3300025928 Bacteria 7654
216 Ga0207700_10031593 3300025928 Bacteria 3764
217 Ga0207700_10118809 3300025928 Bacteria 2140
218 Ga0207664_10001750 3300025929 Bacteria 14308
219 Ga0207664_10024731 3300025929 Bacteria 4515
220 Ga0207690_10004416 3300025932 Bacteria 8299
221 Ga0207690_10018534 3300025932 Bacteria 4269
222 Ga0207690_10059988 3300025932 Bacteria 2579
223 Ga0207706_10164921 3300025933 Bacteria 1947
224 Ga0207670_10023061 3300025936 Bacteria 3868
225 Ga0207665_10002969 3300025939 Bacteria 11368
226 Ga0207661_10054390 3300025944 Bacteria 3206
227 Ga0207661_10055604 3300025944 Bacteria 3175
228 Ga0207679_10027707 3300025945 Bacteria 3922
229 Ga0207667_10001466 3300025949 Bacteria 29592
230 Ga0207667_10005158 3300025949 Bacteria 15956
231 Ga0207667_10006044 3300025949 Bacteria 14725
232 Ga0207667_10006663 3300025949 Bacteria 13963
233 Ga0207667_10006791 3300025949 Bacteria 13820
234 Ga0207667_10009324 3300025949 Bacteria 11575
235 Ga0207667_10015302 3300025949 Bacteria 8723
236 Ga0207667_10075633 3300025949 Bacteria 3496
237 Ga0207667_10182214 3300025949 Bacteria 2157
238 Ga0207640_10001189 3300025981 Bacteria 14221
239 Ga0207640_10018675 3300025981 Bacteria 4080
240 Ga0207640_10028063 3300025981 Bacteria 3436
241 Ga0207703_10000763 3300026035 Bacteria 31718
242 Ga0207639_10003701 3300026041 Bacteria 10284
243 Ga0207639_10019200 3300026041 Bacteria 4871
244 Ga0207639_10022235 3300026041 Bacteria 4565
245 Ga0207678_10000650 3300026067 Bacteria 31953
246 Ga0207678_10003106 3300026067 Bacteria 15041
247 Ga0207702_10011536 3300026078 Bacteria 7363
248 Ga0207702_10030222 3300026078 Bacteria 4514
249 Ga0207702_10038373 3300026078 Bacteria 4011
250 Ga0207702_10087573 3300026078 Bacteria 2719
251 Ga0207674_10003058 3300026116 Bacteria 20694
252 Ga0207674_10050822 3300026116 Bacteria 4233
253 Ga0207674_10090584 3300026116 Bacteria 3050
254 Ga0207674_10101154 3300026116 Bacteria 2863
255 Ga0207698_10006713 3300026142 Bacteria 7191
256 Ga0207698_10069071 3300026142 Bacteria 2792
257 Ga0207698_10116633 3300026142 Bacteria 2251
258 Ga0265334_10001829 3300028573 Bacteria 10133
259 Ga0265338_10000029 3300028800 Bacteria 271824
260 Ga0265324_10017325 3300029957 Bacteria 2621
261 Ga0265325_10001061 3300031241 Bacteria 19772
262 Ga0307416_100047337 3300032002 Bacteria 3403
263 Ga0307510_10000705 3300033180 Bacteria 34297
264 Ga0373943_0000387 3300035170 Bacteria 18476
265 Ga0373933_0021321 3300035724 Bacteria 3680
266 Ga0373947_0000965 3300035725 Bacteria 17544
267 Ga0373937_0019321 3300036401 Bacteria 6097
268 Ga0395899_0002359 3300037312 Bacteria 15373
269 Ga0395899_0002689 3300037312 Bacteria 14336
270 Ga0395899_0005914 3300037312 Bacteria 9498
271 Ga0395900_0002500 3300037418 Bacteria 20203
272 Ga0395900_0005675 3300037418 Bacteria 13049
273 Ga0395900_0070489 3300037418 Bacteria 3594
274 Ga0395900_0081492 3300037418 Bacteria 3325
275 Ga0395900_0132922 3300037418 Bacteria 2549
276 Ga0395900_0134147 3300037418 Bacteria 2536
277 Ga0395900_0151169 3300037418 Bacteria 2372
278 Ga0395898_0004355 3300037466 Bacteria 15496
279 Ga0395898_0012143 3300037466 Bacteria 8913
280 Ga0395898_0031690 3300037466 Bacteria 5280
281 Ga0395898_0094923 3300037466 Bacteria 2866
282 Ga0395898_0124923 3300037466 Bacteria 2465
283 Ga0395898_0302195 3300037466 Bacteria 1526
284 Ga0395905_0000747 3300037471 Bacteria 42856
285 Ga0395905_0007499 3300037471 Bacteria 10853
286 Ga0395905_0065625 3300037471 Bacteria 3398
287 Ga0395905_0098406 3300037471 Bacteria 2747
288 Ga0395905_0142931 3300037471 Bacteria 2251
289 Ga0395905_0190416 3300037471 Bacteria 1924
290 Ga0436364_0077336 3300037853 Bacteria 5759
291 Ga0436364_0240030 3300037853 Bacteria 11501
292 Ga0436364_0353090 3300037853 Bacteria 7514
293 Ga0436364_0586291 3300037853 Bacteria 97560
294 Ga0436364_0708881 3300037853 Bacteria 35067
295 Ga0395901_0002327 3300038443 Bacteria 19364
296 Ga0395901_0007696 3300038443 Bacteria 10869
297 Ga0395901_0044877 3300038443 Bacteria 4584
298 Ga0436365_0051833 3300039437 Bacteria 32975
299 Ga0436365_0119251 3300039437 Bacteria 7728
300 Ga0436365_0275035 3300039437 Bacteria 2271
301 Ga0436365_1204615 3300039437 Bacteria 2958
302 Ga0436365_1291084 3300039437 Bacteria 167262
303 Ga0436365_1850675 3300039437 Bacteria 16914
304 Ga0436360_1255064 3300039438 Bacteria 3093
305 Ga0436361_0209567 3300039447 Bacteria 27123
306 Ga0436361_1119569 3300039447 Bacteria 7900
307 Ga0436362_0829594 3300039453 Bacteria 6411
308 Ga0466969_0005483 3300044656 Bacteria 6748
309 Ga0466969_0005964 3300044656 Bacteria 6482
310 Ga0466969_0006983 3300044656 Bacteria 6008
311 Ga0466969_0008783 3300044656 Bacteria 5356
312 Ga0453683_0056769 3300044673 Bacteria 2450
313 Ga0466965_0008080 3300044683 Bacteria 4860
314 Ga0466966_0017733 3300044684 Bacteria 4700
315 Ga0466966_0037904 3300044684 Bacteria 3106
316 Ga0466961_0000451 3300044693 Bacteria 26138
317 Ga0466964_0004100 3300044706 Bacteria 5363
318 Ga0453684_0000671 3300044712 Bacteria 122605
319 Ga0466968_0001610 3300044735 Bacteria 8153
320 Ga0466970_0002696 3300044765 Bacteria 8575
321 Ga0466957_0049862 3300044842 Bacteria 2546
322 Ga0466959_0008263 3300045049 Bacteria 7350
323 Ga0466959_0057045 3300045049 Bacteria 2848
324 Ga0466958_0003110 3300045836 Bacteria 8526
325 Ga0466958_0014733 3300045836 Bacteria 4466
326 Ga0466967_0026456 3300045976 Bacteria 4806
327 Ga0466967_0158500 3300045976 Bacteria 2123
328 Ga0466967_0188633 3300045976 Bacteria 1948
329 Ga0466967_0219436 3300045976 Bacteria 1806
330 Ga0495639_0013094 3300046475 Bacteria 3580
331 Ga0495607_0000060 3300046501 Bacteria 108449
332 Ga0495606_0002102 3300046507 Bacteria 24240
333 Ga0495686_0006031 3300047472 Bacteria 9407
334 Ga0496101_0009883 3300048904 Bacteria 6286
335 Ga0496102_0004215 3300048905 Bacteria 12156
336 Ga0496102_0174776 3300048905 Bacteria 2022
337 Ga0496106_0002322 3300048909 Bacteria 14177
338 Ga0496106_0072206 3300048909 Bacteria 2639
339 Ga0496107_0067331 3300048910 Bacteria 2598
340 Ga0496108_0000037 3300048911 Bacteria 149614
341 Ga0496108_0001632 3300048911 Bacteria 17771
342 Ga0496109_0003738 3300048912 Bacteria 12720
343 Ga0496110_0007578 3300048913 Bacteria 8671
344 Ga0496110_0008560 3300048913 Bacteria 8236
345 Ga0496111_0016726 3300048914 Bacteria 5059
346 Ga0496111_0037396 3300048914 Bacteria 3474
347 Ga0496112_0022022 3300048915 Bacteria 6067
348 Ga0496112_0183979 3300048915 Bacteria 2053
349 Ga0496115_0045621 3300048918 Bacteria 3500
350 Ga0496116_0002394 3300048919 Bacteria 19766
351 Ga0496118_0007103 3300048921 Bacteria 12020
352 Ga0496121_0022044 3300048924 Bacteria 6202
353 Ga0496125_0000331 3300048928 Bacteria 90719
354 Ga0496126_0079201 3300048929 Bacteria 2909
355 Ga0501031_0003951 3300049568 Bacteria 9549
356 Ga0501031_0073893 3300049568 Bacteria 2220
357 Ga0501032_0000055 3300049569 Bacteria 99207
358 Ga0501032_0001930 3300049569 Bacteria 16331
359 Ga0501032_0002690 3300049569 Bacteria 13856
360 Ga0501033_0000163 3300049570 Bacteria 63913
361 Ga0501033_0000960 3300049570 Bacteria 26179
362 Ga0501033_0002886 3300049570 Bacteria 14393
363 Ga0501033_0009215 3300049570 Bacteria 7601
364 Ga0501034_0001317 3300049571 Bacteria 33620
365 Ga0501034_0008452 3300049571 Bacteria 10873
366 Ga0501034_0021771 3300049571 Bacteria 6531
367 Ga0501034_0027830 3300049571 Bacteria 5749
368 Ga0501036_0000021 3300049572 Bacteria 114136
369 Ga0501036_0000363 3300049572 Bacteria 31929
370 Ga0501036_0005434 3300049572 Bacteria 10327
371 Ga0501036_0181117 3300049572 Bacteria 1774
372 Ga0501037_0000193 3300049573 Bacteria 56422
373 Ga0501037_0000314 3300049573 Bacteria 41093
374 Ga0501037_0011253 3300049573 Bacteria 6587
375 Ga0501037_0013195 3300049573 Bacteria 6090
376 Ga0501037_0038941 3300049573 Bacteria 3501
377 Ga0501038_0000070 3300049574 Bacteria 84371
378 Ga0501038_0003569 3300049574 Bacteria 14470
379 Ga0501038_0012897 3300049574 Bacteria 7624
380 Ga0501038_0127220 3300049574 Bacteria 2096
381 Ga0501039_0000213 3300049575 Bacteria 42565
382 Ga0501043_0000297 3300049579 Bacteria 44905
383 Ga0501043_0000528 3300049579 Bacteria 34344
384 Ga0501043_0003051 3300049579 Bacteria 13907
385 Ga0501046_0000354 3300049580 Bacteria 46165
386 Ga0501046_0000723 3300049580 Bacteria 31896
387 Ga0501047_0000136 3300049581 Bacteria 89236
388 Ga0501047_0000232 3300049581 Bacteria 66245
389 Ga0501047_0011817 3300049581 Bacteria 8258
390 Ga0501047_0014029 3300049581 Bacteria 7614
391 Ga0501047_0016466 3300049581 Bacteria 7058
392 Ga0501047_0024045 3300049581 Bacteria 5851
393 Ga0501047_0030751 3300049581 Bacteria 5175
394 Ga0501047_0150909 3300049581 Bacteria 2200
395 Ga0501047_0185455 3300049581 Bacteria 1946
396 Ga0501048_0000549 3300049582 Bacteria 26486
397 Ga0501048_0001340 3300049582 Bacteria 18669
398 Ga0501048_0061095 3300049582 Bacteria 2669
399 Ga0501067_0000177 3300049583 Bacteria 35936
400 Ga0501067_0006328 3300049583 Bacteria 6565
401 Ga0501068_0001111 3300049584 Bacteria 14242
402 Ga0501068_0021396 3300049584 Bacteria 3776
403 Ga0501069_0000053 3300049585 Bacteria 69525
404 Ga0501069_0001057 3300049585 Bacteria 13186
405 Ga0501069_0003421 3300049585 Bacteria 8151
406 Ga0501069_0058936 3300049585 Bacteria 2142
407 Ga0501070_0000584 3300049586 Bacteria 33258
408 Ga0501070_0000809 3300049586 Bacteria 28427
409 Ga0501070_0009108 3300049586 Bacteria 8394
410 Ga0501070_0010492 3300049586 Bacteria 7834
411 Ga0501070_0016165 3300049586 Bacteria 6271
412 Ga0501070_0017520 3300049586 Bacteria 6013
413 Ga0501070_0024007 3300049586 Bacteria 5113
414 Ga0501070_0056726 3300049586 Bacteria 3247
415 Ga0501071_0101661 3300049587 Bacteria 2119
416 Ga0501072_0038522 3300049588 Bacteria 3752
417 Ga0501073_0007452 3300049589 Bacteria 8135
418 Ga0501073_0029134 3300049589 Bacteria 3945
419 Ga0501074_0000290 3300049590 Bacteria 29108
420 Ga0501074_0004851 3300049590 Bacteria 9645
421 Ga0501074_0010550 3300049590 Bacteria 6704
422 Ga0501077_0008756 3300049593 Bacteria 6279
423 Ga0501079_0002529 3300049741 Bacteria 13273
424 Ga0501080_0000022 3300049742 Bacteria 90630
425 Ga0501080_0001079 3300049742 Bacteria 22484
426 Ga0501080_0004288 3300049742 Bacteria 12657
427 Ga0501080_0007875 3300049742 Bacteria 9643
428 Ga0501080_0019442 3300049742 Bacteria 6291
429 Ga0501083_0000300 3300049744 Bacteria 31205
430 Ga0501083_0000385 3300049744 Bacteria 28012
431 Ga0501083_0000780 3300049744 Bacteria 20915
432 Ga0501083_0010807 3300049744 Bacteria 6419
433 Ga0501083_0028354 3300049744 Bacteria 3859
434 Ga0501083_0028424 3300049744 Bacteria 3853
435 Ga0501035_0000120 3300049822 Bacteria 94532
436 Ga0501035_0000867 3300049822 Bacteria 32271
437 Ga0501035_0002746 3300049822 Bacteria 17074
438 Ga0501035_0018243 3300049822 Bacteria 6464
439 Ga0501035_0042818 3300049822 Bacteria 4082
440 Ga0501035_0084501 3300049822 Bacteria 2799
441 Ga0501044_0000179 3300049823 Bacteria 78633
442 Ga0501044_0006502 3300049823 Bacteria 12911
443 Ga0501044_0011041 3300049823 Bacteria 9799
444 Ga0501044_0011281 3300049823 Bacteria 9683
445 Ga0501044_0011930 3300049823 Bacteria 9417
446 Ga0501044_0019140 3300049823 Bacteria 7329
447 Ga0501044_0025115 3300049823 Bacteria 6318
448 Ga0501044_0025681 3300049823 Bacteria 6245
449 Ga0501044_0060163 3300049823 Bacteria 3890
450 Ga0501044_0114503 3300049823 Bacteria 2702
451 Ga0501044_0169582 3300049823 Bacteria 2155
452 nmdc:mga07m45_3561_c2 3300050496 Bacteria 7086
453 nmdc:mga08y16_3948_c1 3300050511 Bacteria 15438
454 nmdc:mga0n895_647_c1 3300050512 Bacteria 24303
455 nmdc:mga0rr50_15629_c1 3300050513 Bacteria 5015
456 nmdc:mga0a205_123_c1 3300050515 Bacteria 47084
457 nmdc:mga0a205_1705_c1 3300050515 Bacteria 18968
458 Ga0500578_0053937 3300053086 Bacteria 2574
459 Ga0501084_0043135 3300054114 Bacteria 3774
460 Ga0501082_0007236 3300060353 Bacteria 9570
461 Ga0501082_0007332 3300060353 Bacteria 9520
462 2513661407 2513237096 Bacteria 8722461
463 2513862478 2513237137 Bacteria 9558895
464 2513923104 2513237145 Bacteria 8979722
465 2643894522 2643221577 Bacteria 3710843
466 2671694781 2671180139 Bacteria 4196045
467 2861693002 2861691609 Bacteria 5628931
468 2879105108 2879099564 Bacteria 10442239
469 2894821665 2894817345 Bacteria 4892941
470 2902331476 2902330777 Bacteria 6395352
471 2932800235 2932794094 Bacteria 7915132
472 2932826799 2932818245 Bacteria 9955613
473 2935775992 2935769743 Bacteria 7878163
474 2935791604 2935785616 Bacteria 7962367
475 2935799916 2935793552 Bacteria 8012592
476 2941534631 2941531003 Bacteria 7653939
477 3005478011 3005474847 Bacteria 9259049
478 3005597734 3005594810 Bacteria 8716512
479 641336548 641228493 Bacteria 3999591
480 643390356 643348555 Bacteria 3914947
481 643604440 643348564 Bacteria 8839022
482 8016629854 8016622563 Bacteria 7999408
483 8019541513 8019538911 Bacteria 7872763
484 8019548793 8019547302 Bacteria 7996444
485 8055272396 8055266321 Bacteria 7999742
486 Ga0070713_100095912
487 JGI24741J21665_1000710
488 JGI24741J21665_1003173
489 JGI24740J21852_10000530
490 rootH2_10005673
491 Ga0070658_10061098
492 Ga0070683_100002621
493 Ga0070683_100008096
494 Ga0070680_100001047
495 Ga0070680_100001917
496 Ga0070680_100018556
497 Ga0070680_100031189
498 Ga0070680_100087291
499 Ga0070660_100020786
500 Ga0070660_100056689
501 Ga0070691_10011271
502 Ga0070661_100009562
503 Ga0070661_100014162
504 Ga0070661_100068904
505 Ga0070692_10005557
506 Ga0070659_100008389
507 Ga0070659_100010358
508 Ga0070659_100080754
509 Ga0070709_10005767
510 Ga0070709_10032493
511 Ga0070714_100002593
512 Ga0070714_100012582
513 Ga0070714_100044066
514 Ga0070714_100066037
515 Ga0070714_100077470
516 Ga0070713_100005477
517 Ga0070713_100149240
518 Ga0070710_10013170
519 Ga0070711_100076363
520 Ga0070705_100003804
521 Ga0070708_100029679
522 Ga0070662_100009722
523 Ga0070681_10000202
524 Ga0070681_10000234
525 Ga0070681_10004464
526 Ga0070681_10005439
527 Ga0070681_10030381
528 Ga0070681_10126945
529 Ga0070699_100008679
530 Ga0070699_100013482
531 Ga0070679_100000275
532 Ga0070679_100002568
533 Ga0070679_100002970
534 Ga0070679_100005452
535 Ga0070679_100018122
536 Ga0070679_100069550
537 Ga0070679_100207023
538 Ga0070684_100002661
539 Ga0070684_100010629
540 Ga0070684_100067861
541 Ga0070684_100171416
542 Ga0070697_100006461
543 Ga0068853_100012863
544 Ga0068853_100022095
545 Ga0068853_100026181
546 Ga0068853_100129403
547 Ga0070695_100003972
548 Ga0070696_100001519
549 Ga0070696_100007114
550 Ga0070696_100031102
551 Ga0070693_100003227
552 Ga0070665_100002567
553 Ga0070704_100008877
554 Ga0068855_100001412
555 Ga0068855_100005963
556 Ga0068855_100009359
557 Ga0068855_100012095
558 Ga0068855_100014475
559 Ga0070664_100154712
560 Ga0068854_100002315
561 Ga0068854_100023399
562 Ga0068854_100037276
563 Ga0068854_100109414
564 Ga0068856_100023207
565 Ga0068856_100056925
566 Ga0068856_100066027
567 Ga0068856_100070928
568 Ga0068852_100006998
569 Ga0068858_100001933
570 Ga0081538_10020681
571 Ga0070717_10024487
572 Ga0070712_100024983
573 Ga0075370_10019576
574 Ga0068871_100139736
575 Ga0075428_100002399
576 Ga0075431_100011682
577 Ga0075434_100000071
578 Ga0075435_100000877
579 Ga0105240_10005952
580 Ga0105240_10007031
581 Ga0105240_10011318
582 Ga0105240_10034327
583 Ga0105240_10073189
584 Ga0105240_10149314
585 Ga0105240_10179448
586 Ga0105240_10253989
587 Ga0105240_10282679
588 Ga0111539_10006154
589 Ga0105245_10036534
590 Ga0105241_10002586
591 Ga0105241_10003016
592 Ga0105237_10002921
593 Ga0105237_10013417
594 Ga0105237_10066214
595 Ga0105238_10005698
596 Ga0105238_10021258
597 Ga0105238_10021265
598 Ga0105238_10093450
599 Ga0105238_10199153
600 Ga0105239_10003553
601 Ga0105239_10004794
602 Ga0105239_10005794
603 Ga0105239_10041495
604 Ga0105239_10071296
605 Ga0105239_10132776
606 Ga0105239_10137239
607 Ga0105239_10194734
608 Ga0157373_10002168
609 Ga0157373_10019273
610 Ga0157373_10030920
611 Ga0157371_10000551
612 Ga0157370_10003631
613 Ga0157370_10010625
614 Ga0157370_10014793
615 Ga0157370_10057231
616 Ga0157370_10081727
617 Ga0157369_10001218
618 Ga0157369_10011586
619 Ga0157369_10030061
620 Ga0157369_10061775
621 Ga0157369_10072673
622 Ga0157369_10211392
623 Ga0157372_10000668
624 Ga0157372_10004449
625 Ga0157372_10015447
626 Ga0157372_10043384
627 Ga0157372_10050958
628 Ga0157372_10058216
629 Ga0157372_10186131
630 Ga0182008_10021032
631 Ga0182007_10001621
632 Ga0213872_10059020
633 Ga0213876_10000110
634 Ga0209677_101747
635 Ga0209233_1000654
636 Ga0209455_1001581
637 Ga0207692_10012534
638 Ga0207647_10000240
639 Ga0207699_10001446
640 Ga0207705_10004651
641 Ga0207705_10006310
642 Ga0207705_10006671
643 Ga0207684_10046438
644 Ga0207654_10000888
645 Ga0207707_10000177
646 Ga0207707_10000295
647 Ga0207707_10000438
648 Ga0207707_10000480
649 Ga0207707_10000629
650 Ga0207707_10001999
651 Ga0207707_10004566
652 Ga0207707_10008006
653 Ga0207707_10023351
654 Ga0207695_10002355
655 Ga0207695_10003043
656 Ga0207695_10008100
657 Ga0207695_10012643
658 Ga0207695_10019247
659 Ga0207695_10022460
660 Ga0207695_10039567
661 Ga0207695_10051885
662 Ga0207695_10122911
663 Ga0207695_10138694
664 Ga0207695_10159939
665 Ga0207671_10002597
666 Ga0207671_10011995
667 Ga0207671_10062668
668 Ga0207693_10023681
669 Ga0207693_10033398
670 Ga0207693_10109459
671 Ga0207663_10052029
672 Ga0207660_10001343
673 Ga0207660_10003909
674 Ga0207660_10005892
675 Ga0207660_10017846
676 Ga0207660_10019175
677 Ga0207660_10028499
678 Ga0207660_10051357
679 Ga0207660_10091193
680 Ga0207657_10004715
681 Ga0207657_10018774
682 Ga0207657_10019277
683 Ga0207657_10031611
684 Ga0207649_10003380
685 Ga0207649_10003782
686 Ga0207649_10010448
687 Ga0207649_10017840
688 Ga0207652_10000148
689 Ga0207652_10000438
690 Ga0207652_10002234
691 Ga0207652_10002454
692 Ga0207652_10003966
693 Ga0207652_10005126
694 Ga0207652_10009861
695 Ga0207652_10013975
696 Ga0207652_10061343
697 Ga0207694_10012808
698 Ga0207694_10037613
699 Ga0207694_10040591
700 Ga0207700_10005369
701 Ga0207700_10031593
702 Ga0207700_10118809
703 Ga0207664_10001750
704 Ga0207664_10024731
705 Ga0207690_10004416
706 Ga0207690_10018534
707 Ga0207690_10059988
708 Ga0207706_10164921
709 Ga0207670_10023061
710 Ga0207665_10002969
711 Ga0207661_10054390
712 Ga0207661_10055604
713 Ga0207679_10027707
714 Ga0207667_10001466
715 Ga0207667_10005158
716 Ga0207667_10006044
717 Ga0207667_10006663
718 Ga0207667_10006791
719 Ga0207667_10009324
720 Ga0207667_10015302
721 Ga0207667_10075633
722 Ga0207667_10182214
723 Ga0207640_10001189
724 Ga0207640_10018675
725 Ga0207640_10028063
726 Ga0207703_10000763
727 Ga0207639_10003701
728 Ga0207639_10019200
729 Ga0207639_10022235
730 Ga0207678_10000650
731 Ga0207678_10003106
732 Ga0207702_10011536
733 Ga0207702_10030222
734 Ga0207702_10038373
735 Ga0207702_10087573
736 Ga0207674_10003058
737 Ga0207674_10050822
738 Ga0207674_10090584
739 Ga0207674_10101154
740 Ga0207698_10006713
741 Ga0207698_10069071
742 Ga0207698_10116633
743 Ga0265334_10001829
744 Ga0265338_10000029
745 Ga0265324_10017325
746 Ga0265325_10001061
747 Ga0307416_100047337
748 Ga0307510_10000705
749 Ga0373943_0000387
750 Ga0373933_0021321
751 Ga0373947_0000965
752 Ga0373937_0019321
753 Ga0395899_0002359
754 Ga0395899_0002689
755 Ga0395899_0005914
756 Ga0395900_0002500
757 Ga0395900_0005675
758 Ga0395900_0070489
759 Ga0395900_0081492
760 Ga0395900_0132922
761 Ga0395900_0134147
762 Ga0395900_0151169
763 Ga0395898_0004355
764 Ga0395898_0012143
765 Ga0395898_0031690
766 Ga0395898_0094923
767 Ga0395898_0124923
768 Ga0395898_0302195
769 Ga0395905_0000747
770 Ga0395905_0007499
771 Ga0395905_0065625
772 Ga0395905_0098406
773 Ga0395905_0142931
774 Ga0395905_0190416
775 Ga0436364_0077336
776 Ga0436364_0240030
777 Ga0436364_0353090
778 Ga0436364_0586291
779 Ga0436364_0708881
780 Ga0395901_0002327
781 Ga0395901_0007696
782 Ga0395901_0044877
783 Ga0436365_0051833
784 Ga0436365_0119251
785 Ga0436365_0275035
786 Ga0436365_1204615
787 Ga0436365_1291084
788 Ga0436365_1850675
789 Ga0436360_1255064
790 Ga0436361_0209567
791 Ga0436361_1119569
792 Ga0436362_0829594
793 Ga0466969_0005483
794 Ga0466969_0005964
795 Ga0466969_0006983
796 Ga0466969_0008783
797 Ga0453683_0056769
798 Ga0466965_0008080
799 Ga0466966_0017733
800 Ga0466966_0037904
801 Ga0466961_0000451
802 Ga0466964_0004100
803 Ga0453684_0000671
804 Ga0466968_0001610
805 Ga0466970_0002696
806 Ga0466957_0049862
807 Ga0466959_0008263
808 Ga0466959_0057045
809 Ga0466958_0003110
810 Ga0466958_0014733
811 Ga0466967_0026456
812 Ga0466967_0158500
813 Ga0466967_0188633
814 Ga0466967_0219436
815 Ga0495639_0013094
816 Ga0495607_0000060
817 Ga0495606_0002102
818 Ga0495686_0006031
819 Ga0496101_0009883
820 Ga0496102_0004215
821 Ga0496102_0174776
822 Ga0496106_0002322
823 Ga0496106_0072206
824 Ga0496107_0067331
825 Ga0496108_0000037
826 Ga0496108_0001632
827 Ga0496109_0003738
828 Ga0496110_0007578
829 Ga0496110_0008560
830 Ga0496111_0016726
831 Ga0496111_0037396
832 Ga0496112_0022022
833 Ga0496112_0183979
834 Ga0496115_0045621
835 Ga0496116_0002394
836 Ga0496118_0007103
837 Ga0496121_0022044
838 Ga0496125_0000331
839 Ga0496126_0079201
840 Ga0501031_0003951
841 Ga0501031_0073893
842 Ga0501032_0000055
843 Ga0501032_0001930
844 Ga0501032_0002690
845 Ga0501033_0000163
846 Ga0501033_0000960
847 Ga0501033_0002886
848 Ga0501033_0009215
849 Ga0501034_0001317
850 Ga0501034_0008452
851 Ga0501034_0021771
852 Ga0501034_0027830
853 Ga0501036_0000021
854 Ga0501036_0000363
855 Ga0501036_0005434
856 Ga0501036_0181117
857 Ga0501037_0000193
858 Ga0501037_0000314
859 Ga0501037_0011253
860 Ga0501037_0013195
861 Ga0501037_0038941
862 Ga0501038_0000070
863 Ga0501038_0003569
864 Ga0501038_0012897
865 Ga0501038_0127220
866 Ga0501039_0000213
867 Ga0501043_0000297
868 Ga0501043_0000528
869 Ga0501043_0003051
870 Ga0501046_0000354
871 Ga0501046_0000723
872 Ga0501047_0000136
873 Ga0501047_0000232
874 Ga0501047_0011817
875 Ga0501047_0014029
876 Ga0501047_0016466
877 Ga0501047_0024045
878 Ga0501047_0030751
879 Ga0501047_0150909
880 Ga0501047_0185455
881 Ga0501048_0000549
882 Ga0501048_0001340
883 Ga0501048_0061095
884 Ga0501067_0000177
885 Ga0501067_0006328
886 Ga0501068_0001111
887 Ga0501068_0021396
888 Ga0501069_0000053
889 Ga0501069_0001057
890 Ga0501069_0003421
891 Ga0501069_0058936
892 Ga0501070_0000584
893 Ga0501070_0000809
894 Ga0501070_0009108
895 Ga0501070_0010492
896 Ga0501070_0016165
897 Ga0501070_0017520
898 Ga0501070_0024007
899 Ga0501070_0056726
900 Ga0501071_0101661
901 Ga0501072_0038522
902 Ga0501073_0007452
903 Ga0501073_0029134
904 Ga0501074_0000290
905 Ga0501074_0004851
906 Ga0501074_0010550
907 Ga0501077_0008756
908 Ga0501079_0002529
909 Ga0501080_0000022
910 Ga0501080_0001079
911 Ga0501080_0004288
912 Ga0501080_0007875
913 Ga0501080_0019442
914 Ga0501083_0000300
915 Ga0501083_0000385
916 Ga0501083_0000780
917 Ga0501083_0010807
918 Ga0501083_0028354
919 Ga0501083_0028424
920 Ga0501035_0000120
921 Ga0501035_0000867
922 Ga0501035_0002746
923 Ga0501035_0018243
924 Ga0501035_0042818
925 Ga0501035_0084501
926 Ga0501044_0000179
927 Ga0501044_0006502
928 Ga0501044_0011041
929 Ga0501044_0011281
930 Ga0501044_0011930
931 Ga0501044_0019140
932 Ga0501044_0025115
933 Ga0501044_0025681
934 Ga0501044_0060163
935 Ga0501044_0114503
936 Ga0501044_0169582
937 nmdc:mga07m45_3561_c2
938 nmdc:mga08y16_3948_c1
939 nmdc:mga0n895_647_c1
940 nmdc:mga0rr50_15629_c1
941 nmdc:mga0a205_123_c1
942 nmdc:mga0a205_1705_c1
943 Ga0500578_0053937
944 Ga0501084_0043135
945 Ga0501082_0007236
946 Ga0501082_0007332
947 2513661407
948 2513862478
949 2513923104
950 2643894522
951 2671694781
952 2861693002
953 2879105108
954 2894821665
955 2902331476
956 2932800235
957 2932826799
958 2935775992
959 2935791604
960 2935799916
961 2941534631
962 3005478011
963 3005597734
964 641336548
965 643390356
966 643604440
967 8016629854
968 8019541513
969 8019548793
970 8055272396

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

43

485

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m57-assembly2.cif.gz_G structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant)) 0.9244 24 513
3oma-assembly2.cif.gz_C catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation 0.9208 29 504
3omi-assembly2.cif.gz_C catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation 0.9206 29 504
8d4t-assembly1.cif.gz_N mammalian civ with gdn bound 0.9192 27 515
8c8q-assembly1.cif.gz_A cytochrome c oxidase from schizosaccharomyces pombe 0.9175 29 515
ID Description Score Start End Superfamily
af_Q2FZK0_30_556_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9215 27 512 1.20.210.10
af_P9WP71_20_544_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9126 22 518 1.20.210.10
af_Q7HP04_41_512_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9106 27 470 1.20.210.10
af_O21042_10_509_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9006 28 480 1.20.210.10
2yevD01 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8985 30 522 1.20.210.10
ID Description Score Start End GO Terms
AF-A0A422QD25-F1-model_v4 Cytochrome oxidase subunit I 0.9926 242 431 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-A0A3D2M157-F1-model_v4 Cytochrome c oxidase subunit I 0.9916 248 514 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-G4Y993-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.9913 242 478 GO:0004129
GO:0005743
GO:0006123
GO:0015990
GO:0020037
GO:0046872
AF-B7XCS5-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.9909 237 398 GO:0004129
GO:0005743
GO:0006123
GO:0015990
GO:0020037
GO:0046872
AF-A0A0A1I5H3-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.9906 229 434 GO:0004129
GO:0005743
GO:0006123
GO:0015990
GO:0020037
GO:0046872

Map