F453057

General Info

Members Datasets Scaffolds Average Seq Length
485 220 485 171

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100360233|Ga0070713_1003602332
Length 189
Sequence MTLIDRRGSLHYRGTMLSKNSRIIRHLSLFCLAAAAIPAFAQTDMKTIVLKHLKTSRDFSLKVAGQMPEASYNFKLTPPQMSFAEQMVHISQSMAAILAPFSNSKPNMAKPASMDKKDVIAFMQKSYDGAIDQISKLTPDQLSKTYSGGEGTMSGMEILMFVLDHSTHHRASAEMYLRAKGITPTEYEF

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.82
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 4.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5472176 2162886012 Unclassified 848
2 JGI24035J26624_1027838 3300002126 Unclassified 610
3 Ga0065715_10076238 3300005293 Unclassified 565
4 Ga0065715_10121950 3300005293 Bacteria 2217
5 Ga0065715_10228854 3300005293 Bacteria 1241
6 Ga0065707_10180299 3300005295 Bacteria 1423
7 Ga0065707_10269189 3300005295 Bacteria 1076
8 Ga0070658_10455692 3300005327 Bacteria 1102
9 Ga0070676_10070374 3300005328 Bacteria 2098
10 Ga0070683_100017554 3300005329 Bacteria 6326
11 Ga0070683_100021932 3300005329 Bacteria 5701
12 Ga0070690_100008464 3300005330 Bacteria 5926
13 Ga0070690_100108227 3300005330 Bacteria 1851
14 Ga0070670_100137019 3300005331 Unclassified 2115
15 Ga0070670_100666922 3300005331 Bacteria 934
16 Ga0070677_10010305 3300005333 Unclassified 3193
17 Ga0068869_100054590 3300005334 Bacteria 2909
18 Ga0068869_100362961 3300005334 Unclassified 1183
19 Ga0070680_100011921 3300005336 Bacteria 6744
20 Ga0068868_100013570 3300005338 Bacteria 5979
21 Ga0070660_100102276 3300005339 Bacteria 2271
22 Ga0070660_100853645 3300005339 Unclassified 767
23 Ga0070689_100039754 3300005340 Bacteria 3603
24 Ga0070689_100092201 3300005340 Unclassified 2389
25 Ga0070689_100099307 3300005340 Bacteria 2303
26 Ga0070691_10019853 3300005341 Bacteria 3102
27 Ga0070687_100011530 3300005343 Bacteria 3869
28 Ga0070661_100055814 3300005344 Bacteria 2892
29 Ga0070661_100125848 3300005344 Unclassified 1922
30 Ga0070692_10282613 3300005345 Unclassified 1006
31 Ga0070692_10534979 3300005345 Bacteria 765
32 Ga0070669_100024198 3300005353 Bacteria 4353
33 Ga0070669_100132099 3300005353 Bacteria 1916
34 Ga0070675_100182212 3300005354 Bacteria 1816
35 Ga0070675_100231384 3300005354 Bacteria 1612
36 Ga0070675_100539117 3300005354 Unclassified 1054
37 Ga0070675_101383096 3300005354 Bacteria 649
38 Ga0070671_100037828 3300005355 Bacteria 4004
39 Ga0070671_100578952 3300005355 Unclassified 969
40 Ga0070674_100016860 3300005356 Bacteria 4583
41 Ga0070673_100288118 3300005364 Bacteria 1442
42 Ga0070673_100378447 3300005364 Bacteria 1262
43 Ga0070673_100540653 3300005364 Unclassified 1057
44 Ga0070673_101075030 3300005364 Bacteria 751
45 Ga0070688_100299274 3300005365 Unclassified 1162
46 Ga0070688_100390031 3300005365 Unclassified 1028
47 Ga0070709_10747581 3300005434 Bacteria 764
48 Ga0070713_100094484 3300005436 Unclassified 2578
49 Ga0070713_100111442 3300005436 Bacteria 2386
50 Ga0070713_100240018 3300005436 Unclassified 1650
51 Ga0070713_100360233 3300005436 Bacteria 1351
52 Ga0070713_100561117 3300005436 Unclassified 1082
53 Ga0070701_10012185 3300005438 Bacteria 3870
54 Ga0070711_100408150 3300005439 Bacteria 1104
55 Ga0070705_100201155 3300005440 Bacteria 1366
56 Ga0070700_100353716 3300005441 Unclassified 1090
57 Ga0070694_100019037 3300005444 Bacteria 4363
58 Ga0070678_100021982 3300005456 Bacteria 4216
59 Ga0070678_100085672 3300005456 Unclassified 2401
60 Ga0070678_100490673 3300005456 Unclassified 1082
61 Ga0070662_100200974 3300005457 Bacteria 1581
62 Ga0070681_10019443 3300005458 Bacteria 6798
63 Ga0068867_100006098 3300005459 Bacteria 8533
64 Ga0068867_101470584 3300005459 Unclassified 634
65 Ga0068867_101729858 3300005459 Unclassified 587
66 Ga0070707_100996142 3300005468 Unclassified 803
67 Ga0070699_100269686 3300005518 Bacteria 1523
68 Ga0070679_100006875 3300005530 Bacteria 10609
69 Ga0070684_100000896 3300005535 Bacteria 21078
70 Ga0070684_100028774 3300005535 Bacteria 4702
71 Ga0070684_100032657 3300005535 Bacteria 4438
72 Ga0070684_100061590 3300005535 Unclassified 3284
73 Ga0068853_100005709 3300005539 Bacteria 9789
74 Ga0070672_100035087 3300005543 Bacteria 3810
75 Ga0070672_100044958 3300005543 Unclassified 3413
76 Ga0070686_100004785 3300005544 Bacteria 7475
77 Ga0070686_100806565 3300005544 Unclassified 757
78 Ga0070686_100961653 3300005544 Unclassified 698
79 Ga0070693_100329734 3300005547 Bacteria 1038
80 Ga0070693_100801340 3300005547 Bacteria 698
81 Ga0070665_100035780 3300005548 Bacteria 4995
82 Ga0070665_101004946 3300005548 Unclassified 846
83 Ga0070704_100324120 3300005549 Bacteria 1292
84 Ga0068855_100002190 3300005563 Bacteria 24156
85 Ga0068855_100007763 3300005563 Bacteria 12956
86 Ga0068855_100131963 3300005563 Bacteria 2852
87 Ga0070664_100245929 3300005564 Bacteria 1607
88 Ga0070664_101156999 3300005564 Bacteria 729
89 Ga0068857_100004374 3300005577 Bacteria 11938
90 Ga0068857_101368084 3300005577 Unclassified 688
91 Ga0068854_100461358 3300005578 Unclassified 1063
92 Ga0068854_101324437 3300005578 Unclassified 649
93 Ga0068856_100001477 3300005614 Bacteria 24623
94 Ga0068856_100005705 3300005614 Bacteria 12261
95 Ga0068856_100067787 3300005614 Bacteria 3527
96 Ga0068856_100145479 3300005614 Bacteria 2378
97 Ga0068856_100324535 3300005614 Bacteria 1557
98 Ga0068856_100552891 3300005614 Unclassified 1172
99 Ga0070702_100206336 3300005615 Bacteria 1305
100 Ga0070702_100471460 3300005615 Bacteria 915
101 Ga0068852_100023869 3300005616 Bacteria 4932
102 Ga0068852_100955744 3300005616 Unclassified 875
103 Ga0068859_100049199 3300005617 Bacteria 4234
104 Ga0068859_100270693 3300005617 Bacteria 1791
105 Ga0068859_100433726 3300005617 Unclassified 1410
106 Ga0068859_101248346 3300005617 Unclassified 819
107 Ga0068864_100088960 3300005618 Bacteria 2720
108 Ga0068864_100555227 3300005618 Bacteria 1110
109 Ga0068866_10097528 3300005718 Bacteria 1615
110 Ga0068861_100207513 3300005719 Unclassified 1648
111 Ga0068851_10861438 3300005834 Unclassified 566
112 Ga0068870_10042381 3300005840 Unclassified 2370
113 Ga0068870_10073317 3300005840 Bacteria 1872
114 Ga0068863_100014694 3300005841 Bacteria 7536
115 Ga0068863_100658546 3300005841 Bacteria 1039
116 Ga0068858_100018531 3300005842 Bacteria 6517
117 Ga0068858_100126346 3300005842 Bacteria 2395
118 Ga0068858_100189374 3300005842 Bacteria 1944
119 Ga0068858_100423782 3300005842 Unclassified 1280
120 Ga0068860_100022201 3300005843 Bacteria 6144
121 Ga0068860_101333395 3300005843 Unclassified 738
122 Ga0068862_100001318 3300005844 Bacteria 23064
123 Ga0068862_100440943 3300005844 Unclassified 1226
124 Ga0075432_10327226 3300006058 Unclassified 643
125 Ga0070715_10257871 3300006163 Bacteria 914
126 Ga0097621_100007227 3300006237 Bacteria 7927
127 Ga0097621_100014049 3300006237 Bacteria 5983
128 Ga0097621_100061328 3300006237 Bacteria 3084
129 Ga0097621_100064455 3300006237 Bacteria 3013
130 Ga0097621_100101640 3300006237 Bacteria 2419
131 Ga0097621_100128952 3300006237 Unclassified 2151
132 Ga0097621_100140375 3300006237 Bacteria 2064
133 Ga0097621_100222343 3300006237 Unclassified 1646
134 Ga0097621_101801471 3300006237 Unclassified 584
135 Ga0068871_100001795 3300006358 Bacteria 14473
136 Ga0068871_100033597 3300006358 Unclassified 4064
137 Ga0068871_100081480 3300006358 Bacteria 2681
138 Ga0068871_100161447 3300006358 Unclassified 1917
139 Ga0068871_100208666 3300006358 Unclassified 1689
140 Ga0068871_100314543 3300006358 Bacteria 1377
141 Ga0068871_100445087 3300006358 Bacteria 1160
142 Ga0068871_100973119 3300006358 Unclassified 789
143 Ga0068871_101393545 3300006358 Unclassified 661
144 Ga0075430_100146025 3300006846 Bacteria 1970
145 Ga0075431_100874420 3300006847 Unclassified 869
146 Ga0075433_10004312 3300006852 Bacteria 11044
147 Ga0075434_100007944 3300006871 Bacteria 9834
148 Ga0075434_100496098 3300006871 Bacteria 1242
149 Ga0075429_100053142 3300006880 Bacteria 3525
150 Ga0068865_100092377 3300006881 Unclassified 2198
151 Ga0068865_100180649 3300006881 Unclassified 1625
152 Ga0097620_100049195 3300006931 Bacteria 4234
153 Ga0097620_100270670 3300006931 Bacteria 1791
154 Ga0097620_100433730 3300006931 Unclassified 1410
155 Ga0097620_101248310 3300006931 Unclassified 819
156 Ga0075435_100061515 3300007076 Bacteria 3046
157 Ga0075435_100077382 3300007076 Unclassified 2727
158 Ga0105240_10008912 3300009093 Bacteria 14272
159 Ga0105240_10052766 3300009093 Bacteria 5109
160 Ga0105240_10143930 3300009093 Bacteria 2847
161 Ga0105240_10355282 3300009093 Bacteria 1661
162 Ga0111539_10009213 3300009094 Bacteria 12476
163 Ga0111539_10494485 3300009094 Unclassified 1425
164 Ga0111539_11268853 3300009094 Bacteria 855
165 Ga0105245_10005015 3300009098 Bacteria 11637
166 Ga0105245_10011107 3300009098 Bacteria 7839
167 Ga0105245_10022023 3300009098 Bacteria 5593
168 Ga0105245_10050393 3300009098 Bacteria 3732
169 Ga0105245_10097060 3300009098 Bacteria 2721
170 Ga0105245_10171413 3300009098 Bacteria 2067
171 Ga0105245_10537369 3300009098 Bacteria 1190
172 Ga0105245_11108302 3300009098 Bacteria 838
173 Ga0105245_12016510 3300009098 Bacteria 630
174 Ga0105247_10050586 3300009101 Bacteria 2557
175 Ga0105243_10195513 3300009148 Bacteria 1770
176 Ga0105241_10023381 3300009174 Bacteria 4583
177 Ga0105241_10034007 3300009174 Bacteria 3828
178 Ga0105241_10062756 3300009174 Bacteria 2865
179 Ga0105241_10065179 3300009174 Unclassified 2814
180 Ga0105242_10031057 3300009176 Bacteria 4265
181 Ga0105242_10035503 3300009176 Unclassified 3997
182 Ga0105242_10086836 3300009176 Bacteria 2626
183 Ga0105242_10199013 3300009176 Unclassified 1778
184 Ga0105242_10256125 3300009176 Bacteria 1579
185 Ga0105248_10002427 3300009177 Bacteria 20684
186 Ga0105248_10015004 3300009177 Bacteria 8530
187 Ga0105248_10019966 3300009177 Bacteria 7418
188 Ga0105248_10068096 3300009177 Bacteria 3997
189 Ga0105237_10001317 3300009545 Bacteria 32923
190 Ga0105237_10024993 3300009545 Bacteria 6111
191 Ga0105237_10083555 3300009545 Bacteria 3184
192 Ga0105237_10374186 3300009545 Bacteria 1429
193 Ga0105237_10416404 3300009545 Unclassified 1349
194 Ga0105237_10551787 3300009545 Bacteria 1159
195 Ga0105237_11144067 3300009545 Unclassified 785
196 Ga0105237_11450651 3300009545 Unclassified 693
197 Ga0105238_10008673 3300009551 Bacteria 10171
198 Ga0105238_10052385 3300009551 Bacteria 4102
199 Ga0105238_10096540 3300009551 Unclassified 2942
200 Ga0105238_10104379 3300009551 Bacteria 2815
201 Ga0105238_10116351 3300009551 Bacteria 2653
202 Ga0105249_10013555 3300009553 Bacteria 7200
203 Ga0105239_10003048 3300010375 Bacteria 20831
204 Ga0105239_10042185 3300010375 Bacteria 4999
205 Ga0105239_10053806 3300010375 Bacteria 4414
206 Ga0105239_10226984 3300010375 Unclassified 2095
207 Ga0105239_10371442 3300010375 Bacteria 1616
208 Ga0105239_10476470 3300010375 Unclassified 1418
209 Ga0105246_10003902 3300011119 Bacteria 9033
210 Ga0105246_10027514 3300011119 Bacteria 3727
211 Ga0157370_10028274 3300013104 Bacteria 5518
212 Ga0157370_10070296 3300013104 Bacteria 3304
213 Ga0157369_10002275 3300013105 Bacteria 23100
214 Ga0157369_10002738 3300013105 Bacteria 21047
215 Ga0157369_10508078 3300013105 Bacteria 1247
216 Ga0157374_10024250 3300013296 Bacteria 5435
217 Ga0157374_10148513 3300013296 Bacteria 2278
218 Ga0157374_10354553 3300013296 Unclassified 1458
219 Ga0157374_10541776 3300013296 Unclassified 1171
220 Ga0157374_10895315 3300013296 Unclassified 905
221 Ga0157374_11087457 3300013296 Unclassified 820
222 Ga0157374_11718928 3300013296 Unclassified 652
223 Ga0157378_10003262 3300013297 Bacteria 14422
224 Ga0157378_10006667 3300013297 Bacteria 10088
225 Ga0157378_10328613 3300013297 Unclassified 1487
226 Ga0157378_10480826 3300013297 Unclassified 1237
227 Ga0157378_10644965 3300013297 Bacteria 1074
228 Ga0163162_10081630 3300013306 Bacteria 3304
229 Ga0163162_10359235 3300013306 Bacteria 1589
230 Ga0163162_10498238 3300013306 Bacteria 1349
231 Ga0163162_11382532 3300013306 Bacteria 801
232 Ga0163162_11770542 3300013306 Unclassified 706
233 Ga0157372_10019605 3300013307 Bacteria 7289
234 Ga0157372_10037835 3300013307 Bacteria 5323
235 Ga0157372_10072918 3300013307 Bacteria 3869
236 Ga0157375_10008895 3300013308 Bacteria 8789
237 Ga0157375_10082062 3300013308 Bacteria 3265
238 Ga0157375_10148700 3300013308 Unclassified 2476
239 Ga0157375_10233136 3300013308 Bacteria 2000
240 Ga0157375_10430976 3300013308 Bacteria 1484
241 Ga0157375_10471476 3300013308 Unclassified 1421
242 Ga0157375_10917120 3300013308 Unclassified 1019
243 Ga0157375_10976983 3300013308 Bacteria 987
244 Ga0163163_10008800 3300014325 Bacteria 8985
245 Ga0163163_10132012 3300014325 Unclassified 2538
246 Ga0163163_11029670 3300014325 Bacteria 887
247 Ga0157380_10037008 3300014326 Bacteria 3780
248 Ga0157380_11405975 3300014326 Unclassified 748
249 Ga0157377_10013748 3300014745 Bacteria 4103
250 Ga0157377_10502560 3300014745 Unclassified 847
251 Ga0157379_10003010 3300014968 Bacteria 14229
252 Ga0157379_10124281 3300014968 Unclassified 2321
253 Ga0157379_10340403 3300014968 Bacteria 1372
254 Ga0157379_10474989 3300014968 Bacteria 1157
255 Ga0157379_10628568 3300014968 Bacteria 1004
256 Ga0157376_10059103 3300014969 Bacteria 3214
257 Ga0157376_10117041 3300014969 Unclassified 2356
258 Ga0157376_10229756 3300014969 Bacteria 1723
259 Ga0157376_11055199 3300014969 Bacteria 837
260 Ga0163161_10033476 3300017792 Bacteria 3673
261 Ga0213873_10043524 3300021358 Unclassified 1165
262 Ga0213873_10076430 3300021358 Unclassified 930
263 Ga0213872_10000315 3300021361 Bacteria 41197
264 Ga0213874_10001369 3300021377 Bacteria 5039
265 Ga0213876_10022361 3300021384 Bacteria 3344
266 Ga0213875_10012264 3300021388 Bacteria 4239
267 Ga0213875_10013435 3300021388 Bacteria 4021
268 Ga0213875_10065073 3300021388 Bacteria 1704
269 Ga0213875_10080246 3300021388 Bacteria 1522
270 Ga0213875_10092653 3300021388 Bacteria 1409
271 Ga0213875_10165862 3300021388 Bacteria 1037
272 Ga0213871_10003092 3300021441 Bacteria 3163
273 Ga0207697_10012850 3300025315 Bacteria 3502
274 Ga0207697_10063443 3300025315 Unclassified 1540
275 Ga0207682_10000492 3300025893 Bacteria 18262
276 Ga0207682_10025077 3300025893 Unclassified 2364
277 Ga0207710_10069243 3300025900 Bacteria 1615
278 Ga0207688_10000727 3300025901 Bacteria 16326
279 Ga0207688_10075107 3300025901 Bacteria 1923
280 Ga0207647_10074245 3300025904 Unclassified 2048
281 Ga0207699_10581063 3300025906 Bacteria 815
282 Ga0207645_10002485 3300025907 Bacteria 14467
283 Ga0207643_10001159 3300025908 Bacteria 15659
284 Ga0207643_10053992 3300025908 Unclassified 2283
285 Ga0207705_10258666 3300025909 Bacteria 1329
286 Ga0207654_10033389 3300025911 Bacteria 2852
287 Ga0207654_10062076 3300025911 Unclassified 2188
288 Ga0207654_10117761 3300025911 Bacteria 1663
289 Ga0207654_10487297 3300025911 Unclassified 869
290 Ga0207654_11063634 3300025911 Unclassified 589
291 Ga0207707_10000761 3300025912 Bacteria 31771
292 Ga0207707_10015549 3300025912 Bacteria 6628
293 Ga0207707_10235519 3300025912 Bacteria 1593
294 Ga0207695_10002495 3300025913 Bacteria 27107
295 Ga0207695_10004086 3300025913 Bacteria 20051
296 Ga0207695_10102945 3300025913 Bacteria 2847
297 Ga0207695_10159457 3300025913 Bacteria 2188
298 Ga0207671_10267636 3300025914 Unclassified 1346
299 Ga0207671_10494273 3300025914 Unclassified 975
300 Ga0207663_10049978 3300025916 Bacteria 2597
301 Ga0207660_10131885 3300025917 Bacteria 1903
302 Ga0207662_10068160 3300025918 Bacteria 2148
303 Ga0207657_10100390 3300025919 Bacteria 2403
304 Ga0207657_10452936 3300025919 Unclassified 1007
305 Ga0207649_10148675 3300025920 Bacteria 1611
306 Ga0207649_10517591 3300025920 Unclassified 909
307 Ga0207649_11159935 3300025920 Unclassified 610
308 Ga0207652_10001347 3300025921 Bacteria 21814
309 Ga0207646_10767984 3300025922 Unclassified 860
310 Ga0207681_10007135 3300025923 Bacteria 6851
311 Ga0207681_10227075 3300025923 Unclassified 1447
312 Ga0207681_10334468 3300025923 Bacteria 1208
313 Ga0207681_10528903 3300025923 Bacteria 968
314 Ga0207681_10675451 3300025923 Unclassified 857
315 Ga0207694_10000953 3300025924 Bacteria 25560
316 Ga0207694_10013230 3300025924 Bacteria 6212
317 Ga0207694_10062148 3300025924 Unclassified 2907
318 Ga0207694_10155737 3300025924 Bacteria 1843
319 Ga0207650_10122169 3300025925 Bacteria 2029
320 Ga0207650_11064513 3300025925 Unclassified 688
321 Ga0207659_10405375 3300025926 Unclassified 1141
322 Ga0207659_11086842 3300025926 Unclassified 688
323 Ga0207687_10004364 3300025927 Bacteria 9437
324 Ga0207687_10010285 3300025927 Bacteria 6113
325 Ga0207687_10027930 3300025927 Bacteria 3788
326 Ga0207687_10252973 3300025927 Bacteria 1401
327 Ga0207687_10736054 3300025927 Bacteria 838
328 Ga0207700_10227045 3300025928 Bacteria 1586
329 Ga0207700_10299797 3300025928 Bacteria 1388
330 Ga0207700_10682665 3300025928 Bacteria 916
331 Ga0207664_10357534 3300025929 Bacteria 1293
332 Ga0207664_10851762 3300025929 Unclassified 819
333 Ga0207644_10502800 3300025931 Unclassified 1000
334 Ga0207706_10023960 3300025933 Bacteria 5476
335 Ga0207706_10115626 3300025933 Bacteria 2359
336 Ga0207706_10283334 3300025933 Bacteria 1445
337 Ga0207686_10009467 3300025934 Bacteria 5287
338 Ga0207709_10079185 3300025935 Bacteria 2112
339 Ga0207709_10210587 3300025935 Unclassified 1395
340 Ga0207670_10092503 3300025936 Bacteria 2140
341 Ga0207704_10164923 3300025938 Unclassified 1581
342 Ga0207691_10006460 3300025940 Bacteria 11327
343 Ga0207691_10040401 3300025940 Bacteria 4310
344 Ga0207711_10006203 3300025941 Bacteria 10101
345 Ga0207711_10006402 3300025941 Bacteria 9925
346 Ga0207711_10064739 3300025941 Bacteria 3158
347 Ga0207711_11621991 3300025941 Unclassified 590
348 Ga0207711_11726501 3300025941 Unclassified 569
349 Ga0207689_10001107 3300025942 Bacteria 25998
350 Ga0207689_10348386 3300025942 Bacteria 1231
351 Ga0207689_10367121 3300025942 Unclassified 1197
352 Ga0207661_10009833 3300025944 Bacteria 6869
353 Ga0207661_10129499 3300025944 Bacteria 2159
354 Ga0207661_10143682 3300025944 Bacteria 2056
355 Ga0207661_11224887 3300025944 Unclassified 690
356 Ga0207679_10009412 3300025945 Bacteria 6260
357 Ga0207679_10623065 3300025945 Bacteria 974
358 Ga0207667_10001913 3300025949 Bacteria 26146
359 Ga0207667_10016994 3300025949 Bacteria 8207
360 Ga0207667_10018865 3300025949 Bacteria 7718
361 Ga0207651_10065694 3300025960 Bacteria 2545
362 Ga0207651_10571486 3300025960 Bacteria 985
363 Ga0207712_10049499 3300025961 Unclassified 2928
364 Ga0207668_10034287 3300025972 Bacteria 3370
365 Ga0207677_10205459 3300026023 Bacteria 1569
366 Ga0207703_10197347 3300026035 Bacteria 1786
367 Ga0207703_10636286 3300026035 Unclassified 1011
368 Ga0207703_11363004 3300026035 Unclassified 682
369 Ga0207639_10006562 3300026041 Bacteria 7912
370 Ga0207639_10082096 3300026041 Bacteria 2555
371 Ga0207678_10309550 3300026067 Bacteria 1358
372 Ga0207708_10032354 3300026075 Bacteria 3972
373 Ga0207702_10011734 3300026078 Bacteria 7298
374 Ga0207702_10069131 3300026078 Bacteria 3036
375 Ga0207702_11602276 3300026078 Unclassified 644
376 Ga0207641_10111676 3300026088 Bacteria 2424
377 Ga0207641_10671291 3300026088 Bacteria 1019
378 Ga0207648_10008815 3300026089 Bacteria 9715
379 Ga0207648_10241976 3300026089 Bacteria 1607
380 Ga0207676_10513819 3300026095 Unclassified 1139
381 Ga0207674_10000682 3300026116 Bacteria 44093
382 Ga0207674_10353086 3300026116 Bacteria 1421
383 Ga0207674_10375111 3300026116 Unclassified 1375
384 Ga0207674_11075571 3300026116 Unclassified 774
385 Ga0207675_100012882 3300026118 Bacteria 7813
386 Ga0207675_100090401 3300026118 Unclassified 2879
387 Ga0207675_100456484 3300026118 Bacteria 1267
388 Ga0207683_10069132 3300026121 Unclassified 3119
389 Ga0207683_10078602 3300026121 Bacteria 2924
390 Ga0207698_10008302 3300026142 Bacteria 6558
391 Ga0209998_10055246 3300027717 Unclassified 926
392 Ga0207428_10003783 3300027907 Bacteria 14518
393 Ga0268266_10015171 3300028379 Bacteria 6615
394 Ga0268265_10096287 3300028380 Bacteria 2378
395 Ga0268265_10209403 3300028380 Bacteria 1698
396 Ga0268264_10283549 3300028381 Unclassified 1553
397 Ga0268264_10456349 3300028381 Unclassified 1239
398 Ga0265338_10196857 3300028800 Bacteria 1523
399 Ga0265332_10022601 3300031238 Unclassified 2775
400 Ga0265340_10039360 3300031247 Bacteria 2334
401 Ga0265316_10129500 3300031344 Unclassified 1902
402 Ga0265314_10001232 3300031711 Bacteria 29204
403 Ga0265314_10127373 3300031711 Unclassified 1593
404 Ga0373934_0000928 3300035086 Bacteria 10605
405 Ga0373934_0028387 3300035086 Bacteria 2180
406 Ga0373934_0193611 3300035086 Bacteria 836
407 Ga0373923_0283241 3300035111 Unclassified 781
408 Ga0373939_0259658 3300035114 Unclassified 679
409 Ga0373953_0136644 3300035117 Bacteria 1047
410 Ga0373954_0002995 3300035118 Bacteria 7123
411 Ga0373956_0047313 3300035119 Bacteria 1924
412 Ga0373957_0306447 3300035120 Bacteria 674
413 Ga0373955_0220747 3300035172 Bacteria 1132
414 Ga0373955_0230902 3300035172 Bacteria 1107
415 Ga0373955_0234677 3300035172 Unclassified 1098
416 Ga0373924_0113821 3300035410 Bacteria 1171
417 Ga0373935_0272219 3300035692 Bacteria 1190
418 Ga0373927_0172962 3300035695 Bacteria 1416
419 Ga0373933_0026618 3300035724 Bacteria 3323
420 Ga0373933_0036882 3300035724 Unclassified 2865
421 Ga0373937_0019522 3300036401 Bacteria 6065
422 Ga0373937_0168218 3300036401 Bacteria 2056
423 Ga0373937_0179754 3300036401 Bacteria 1986
424 Ga0373937_0582893 3300036401 Unclassified 1062
425 Ga0373937_1127402 3300036401 Unclassified 733
426 Ga0373925_0070171 3300037068 Bacteria 2648
427 Ga0373925_0322254 3300037068 Viruses 1251
428 Ga0436364_0356229 3300037853 Bacteria 15943
429 Ga0436364_0713301 3300037853 Bacteria 1487
430 Ga0436364_0755318 3300037853 Bacteria 1037
431 Ga0436364_0787827 3300037853 Bacteria 12605
432 Ga0436364_1128605 3300037853 Bacteria 48889
433 Ga0436364_1455492 3300037853 Bacteria 2392
434 Ga0436365_0230171 3300039437 Bacteria 2318
435 Ga0436365_0522788 3300039437 Bacteria 3540
436 Ga0436365_0912888 3300039437 Bacteria 3251
437 Ga0436365_1041088 3300039437 Unclassified 876
438 Ga0436360_0437733 3300039438 Bacteria 8911
439 Ga0436361_1020706 3300039447 Bacteria 66534
440 Ga0436363_0033107 3300039450 Bacteria 1886
441 Ga0436363_0046554 3300039450 Bacteria 872
442 Ga0436363_1596932 3300039450 Bacteria 4514
443 Ga0436362_0055550 3300039453 Unclassified 697
444 Ga0436362_0389385 3300039453 Unclassified 1294
445 Ga0436362_0660779 3300039453 Bacteria 5300
446 Ga0436362_0701711 3300039453 Bacteria 787
447 Ga0439464_0168004 3300042439 Unclassified 691
448 Ga0466969_0262237 3300044656 Unclassified 783
449 Ga0451576_0201874 3300045051 Bacteria 2076
450 Ga0495651_0169594 3300046462 Bacteria 1556
451 Ga0495651_0225858 3300046462 Bacteria 1293
452 Ga0495651_0325000 3300046462 Bacteria 1024
453 Ga0495580_0016895 3300046472 Bacteria 5470
454 Ga0495580_0045433 3300046472 Bacteria 3120
455 Ga0495580_0224980 3300046472 Bacteria 1289
456 Ga0495580_0821056 3300046472 Unclassified 602
457 Ga0495582_0275556 3300046473 Bacteria 966
458 Ga0495594_0520666 3300046499 Unclassified 675
459 Ga0495608_0093545 3300046511 Bacteria 1942
460 Ga0495652_0198666 3300046529 Bacteria 1524
461 Ga0495587_0001707 3300046536 Bacteria 14667
462 Ga0495587_0055334 3300046536 Unclassified 2337
463 Ga0495587_0212242 3300046536 Unclassified 1093
464 Ga0495645_0067700 3300046543 Bacteria 2579
465 Ga0495635_0277999 3300046663 Bacteria 1125
466 Ga0495647_0119520 3300046681 Bacteria 1107
467 Ga0495669_0074951 3300046684 Bacteria 1547
468 Ga0495674_0184087 3300047319 Bacteria 1738
469 Ga0495680_0208093 3300047322 Bacteria 1401
470 Ga0495602_0120617 3300048088 Bacteria 2110
471 Ga0495602_0482909 3300048088 Bacteria 869
472 Ga0496104_0427801 3300048907 Bacteria 1236
473 Ga0496109_0080023 3300048912 Bacteria 3011
474 Ga0496114_0639038 3300048917 Unclassified 937
475 Ga0496115_0183658 3300048918 Unclassified 1728
476 nmdc:mga06r32_327045_c1 3300050510 Bacteria 1518
477 nmdc:mga08y16_78588_c1 3300050511 Bacteria 3440
478 nmdc:mga0n895_325264_c1 3300050512 Bacteria 1558
479 nmdc:mga0n895_5514_c1 3300050512 Bacteria 10593
480 nmdc:mga0rr50_54732_c1 3300050513 Bacteria 2974
481 nmdc:mga0rr50_99720_c1 3300050513 Bacteria 2279
482 nmdc:mga08x19_158678_c1 3300050514 Unclassified 1535
483 nmdc:mga08x19_277684_c1 3300050514 Bacteria 1160
484 nmdc:mga0a205_550_c1 3300050515 Bacteria 24226
485 Ga0466962_0181867 3300061719 Bacteria 1025

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10116351 Ga0105238_101163512 150
2 3300009545 Ga0105237_10083555 Ga0105237_100835552 152
3 3300010375 Ga0105239_10371442 Ga0105239_103714422 152
4 3300013308 Ga0157375_10976983 Ga0157375_109769831 155
5 3300014968 Ga0157379_10628568 Ga0157379_106285681 155
6 3300014969 Ga0157376_10229756 Ga0157376_102297562 155
7 3300009094 Ga0111539_11268853 Ga0111539_112688532 156
8 3300009545 Ga0105237_11144067 Ga0105237_111440671 157
9 3300013297 Ga0157378_10480826 Ga0157378_104808262 157
10 3300014325 Ga0163163_10008800 Ga0163163_100088002 157
11 3300039437 Ga0436365_1041088 Ga0436365_1041088_353_847 157
12 3300039453 Ga0436362_0701711 Ga0436362_0701711_248_724 157
13 3300025900 Ga0207710_10069243 Ga0207710_100692433 159
14 3300013297 Ga0157378_10644965 Ga0157378_106449652 160
15 3300009098 Ga0105245_10537369 Ga0105245_105373691 161
16 3300009148 Ga0105243_10195513 Ga0105243_101955134 161
17 3300009176 Ga0105242_10086836 Ga0105242_100868364 161
18 3300013296 Ga0157374_10024250 Ga0157374_100242504 161
19 3300013306 Ga0163162_11382532 Ga0163162_113825322 161
20 3300013308 Ga0157375_10082062 Ga0157375_100820623 161
21 3300014968 Ga0157379_10474989 Ga0157379_104749892 161
22 3300014969 Ga0157376_11055199 Ga0157376_110551992 161
23 3300039450 Ga0436363_0046554 Ga0436363_0046554_293_787 161
24 3300046472 Ga0495580_0821056 Ga0495580_0821056_81_569 161
25 3300050514 nmdc:mga08x19_158678_c1 nmdc:mga08x19_158678_c1_675_1163 161
26 3300009098 Ga0105245_10050393 Ga0105245_100503934 162
27 3300025912 Ga0207707_10235519 Ga0207707_102355194 163
28 3300013296 Ga0157374_10895315 Ga0157374_108953151 164
29 3300021388 Ga0213875_10165862 Ga0213875_101658622 164
30 3300035172 Ga0373955_0220747 Ga0373955_0220747_140_646 164
31 3300035692 Ga0373935_0272219 Ga0373935_0272219_538_1044 164
32 3300037068 Ga0373925_0070171 Ga0373925_0070171_49_555 164
33 3300037853 Ga0436364_0755318 Ga0436364_0755318_455_958 164
34 3300039437 Ga0436365_0230171 Ga0436365_0230171_1495_1998 164
35 3300044656 Ga0466969_0262237 Ga0466969_0262237_158_664 164
36 3300061719 Ga0466962_0181867 Ga0466962_0181867_265_771 164
37 3300013296 Ga0157374_11087457 Ga0157374_110874572 165
38 3300021358 Ga0213873_10043524 Ga0213873_100435242 165
39 3300021358 Ga0213873_10076430 Ga0213873_100764302 165
40 3300021361 Ga0213872_10000315 Ga0213872_1000031527 165
41 3300021377 Ga0213874_10001369 Ga0213874_100013693 165
42 3300021384 Ga0213876_10022361 Ga0213876_100223612 165
43 3300021388 Ga0213875_10012264 Ga0213875_100122644 165
44 3300021388 Ga0213875_10065073 Ga0213875_100650731 165
45 3300021388 Ga0213875_10080246 Ga0213875_100802462 165
46 3300021388 Ga0213875_10092653 Ga0213875_100926532 165
47 3300021441 Ga0213871_10003092 Ga0213871_100030923 165
48 3300025923 Ga0207681_10528903 Ga0207681_105289032 165
49 3300025929 Ga0207664_10357534 Ga0207664_103575342 165
50 3300028380 Ga0268265_10209403 Ga0268265_102094032 165
51 3300037853 Ga0436364_0356229 Ga0436364_0356229_12817_13323 165
52 3300037853 Ga0436364_0713301 Ga0436364_0713301_444_950 165
53 3300037853 Ga0436364_1128605 Ga0436364_1128605_33538_34044 165
54 3300037853 Ga0436364_1455492 Ga0436364_1455492_1845_2366 165
55 3300039437 Ga0436365_0912888 Ga0436365_0912888_1465_1971 165
56 3300039438 Ga0436360_0437733 Ga0436360_0437733_1673_2176 165
57 3300039447 Ga0436361_1020706 Ga0436361_1020706_27454_27957 165
58 3300039450 Ga0436363_0033107 Ga0436363_0033107_502_1017 165
59 3300039450 Ga0436363_1596932 Ga0436363_1596932_3827_4351 165
60 3300039453 Ga0436362_0055550 Ga0436362_0055550_76_582 165
61 3300039453 Ga0436362_0389385 Ga0436362_0389385_348_851 165
62 3300039453 Ga0436362_0660779 Ga0436362_0660779_1196_1717 165
63 3300009545 Ga0105237_10551787 Ga0105237_105517872 166
64 3300025912 Ga0207707_10015549 Ga0207707_100155496 166
65 3300005364 Ga0070673_101075030 Ga0070673_1010750302 167
66 3300028381 Ga0268264_10283549 Ga0268264_102835493 167
67 3300005334 Ga0068869_100362961 Ga0068869_1003629612 168
68 3300005436 Ga0070713_100111442 Ga0070713_1001114422 168
69 3300005459 Ga0068867_101470584 Ga0068867_1014705841 168
70 3300006237 Ga0097621_100061328 Ga0097621_1000613284 168
71 3300006358 Ga0068871_100161447 Ga0068871_1001614472 168
72 3300009098 Ga0105245_10005015 Ga0105245_100050159 168
73 3300009098 Ga0105245_10097060 Ga0105245_100970602 168
74 3300009101 Ga0105247_10050586 Ga0105247_100505863 168
75 3300009174 Ga0105241_10062756 Ga0105241_100627563 168
76 3300011119 Ga0105246_10027514 Ga0105246_100275141 168
77 3300013297 Ga0157378_10003262 Ga0157378_100032627 168
78 3300013306 Ga0163162_10498238 Ga0163162_104982382 168
79 3300025911 Ga0207654_10062076 Ga0207654_100620763 168
80 3300025927 Ga0207687_10010285 Ga0207687_100102855 168
81 3300025927 Ga0207687_10252973 Ga0207687_102529732 168
82 3300025928 Ga0207700_10227045 Ga0207700_102270452 168
83 3300025935 Ga0207709_10079185 Ga0207709_100791852 168
84 3300025942 Ga0207689_10367121 Ga0207689_103671212 168
85 3300026088 Ga0207641_10111676 Ga0207641_101116764 168
86 3300026095 Ga0207676_10513819 Ga0207676_105138192 168
87 3300036401 Ga0373937_1127402 Ga0373937_1127402_164_673 168
88 3300046543 Ga0495645_0067700 Ga0495645_0067700_335_850 168
89 3300002126 JGI24035J26624_1027838 JGI24035J26624_10278381 169
90 3300005434 Ga0070709_10747581 Ga0070709_107475812 169
91 3300005436 Ga0070713_100240018 Ga0070713_1002400182 169
92 3300006237 Ga0097621_100007227 Ga0097621_1000072276 169
93 3300006358 Ga0068871_100033597 Ga0068871_1000335974 169
94 3300009176 Ga0105242_10199013 Ga0105242_101990132 169
95 3300009545 Ga0105237_10416404 Ga0105237_104164043 169
96 3300009551 Ga0105238_10096540 Ga0105238_100965403 169
97 3300010375 Ga0105239_10476470 Ga0105239_104764701 169
98 3300013296 Ga0157374_10354553 Ga0157374_103545532 169
99 3300013297 Ga0157378_10006667 Ga0157378_100066679 169
100 3300025906 Ga0207699_10581063 Ga0207699_105810632 169
101 3300025911 Ga0207654_10487297 Ga0207654_104872972 169
102 3300025914 Ga0207671_10267636 Ga0207671_102676363 169
103 3300025924 Ga0207694_10062148 Ga0207694_100621483 169
104 3300025929 Ga0207664_10851762 Ga0207664_108517621 169
105 3300046684 Ga0495669_0074951 Ga0495669_0074951_512_1021 169
106 3300005328 Ga0070676_10070374 Ga0070676_100703742 170
107 3300005329 Ga0070683_100017554 Ga0070683_1000175542 170
108 3300005535 Ga0070684_100061590 Ga0070684_1000615902 170
109 3300006237 Ga0097621_100014049 Ga0097621_1000140492 170
110 3300006237 Ga0097621_100064455 Ga0097621_1000644555 170
111 3300006358 Ga0068871_100001795 Ga0068871_1000017952 170
112 3300006358 Ga0068871_100208666 Ga0068871_1002086663 170
113 3300006871 Ga0075434_100496098 Ga0075434_1004960982 170
114 3300007076 Ga0075435_100077382 Ga0075435_1000773824 170
115 3300014325 Ga0163163_11029670 Ga0163163_110296702 170
116 3300014969 Ga0157376_10117041 Ga0157376_101170411 170
117 3300025944 Ga0207661_10009833 Ga0207661_100098338 170
118 3300035086 Ga0373934_0000928 Ga0373934_0000928_206_721 170
119 3300035114 Ga0373939_0259658 Ga0373939_0259658_30_545 170
120 3300035118 Ga0373954_0002995 Ga0373954_0002995_5548_6063 170
121 3300035410 Ga0373924_0113821 Ga0373924_0113821_419_934 170
122 3300036401 Ga0373937_0168218 Ga0373937_0168218_336_851 170
123 3300037068 Ga0373925_0322254 Ga0373925_0322254_611_1126 170
124 3300046462 Ga0495651_0225858 Ga0495651_0225858_215_730 170
125 3300046499 Ga0495594_0520666 Ga0495594_0520666_115_648 170
126 3300046536 Ga0495587_0212242 Ga0495587_0212242_146_661 170
127 3300048088 Ga0495602_0482909 Ga0495602_0482909_320_835 170
128 3300050512 nmdc:mga0n895_325264_c1 nmdc:mga0n895_325264_c1_591_1103 170
129 3300050513 nmdc:mga0rr50_54732_c1 nmdc:mga0rr50_54732_c1_1555_2067 170
130 3300050514 nmdc:mga08x19_277684_c1 nmdc:mga08x19_277684_c1_275_787 170
131 2162886012 MBSR1b_contig_5472176 MBSR1b_0837.00002040 171
132 3300005293 Ga0065715_10076238 Ga0065715_100762381 171
133 3300005293 Ga0065715_10121950 Ga0065715_101219502 171
134 3300005293 Ga0065715_10228854 Ga0065715_102288541 171
135 3300005295 Ga0065707_10180299 Ga0065707_101802992 171
136 3300005295 Ga0065707_10269189 Ga0065707_102691892 171
137 3300005327 Ga0070658_10455692 Ga0070658_104556922 171
138 3300005329 Ga0070683_100021932 Ga0070683_1000219326 171
139 3300005330 Ga0070690_100008464 Ga0070690_1000084641 171
140 3300005330 Ga0070690_100108227 Ga0070690_1001082272 171
141 3300005331 Ga0070670_100137019 Ga0070670_1001370192 171
142 3300005331 Ga0070670_100666922 Ga0070670_1006669221 171
143 3300005333 Ga0070677_10010305 Ga0070677_100103052 171
144 3300005334 Ga0068869_100054590 Ga0068869_1000545901 171
145 3300005336 Ga0070680_100011921 Ga0070680_1000119211 171
146 3300005338 Ga0068868_100013570 Ga0068868_1000135707 171
147 3300005339 Ga0070660_100102276 Ga0070660_1001022762 171
148 3300005339 Ga0070660_100853645 Ga0070660_1008536451 171
149 3300005340 Ga0070689_100039754 Ga0070689_1000397543 171
150 3300005340 Ga0070689_100092201 Ga0070689_1000922013 171
151 3300005340 Ga0070689_100099307 Ga0070689_1000993072 171
152 3300005341 Ga0070691_10019853 Ga0070691_100198533 171
153 3300005343 Ga0070687_100011530 Ga0070687_1000115302 171
154 3300005344 Ga0070661_100055814 Ga0070661_1000558142 171
155 3300005344 Ga0070661_100125848 Ga0070661_1001258481 171
156 3300005345 Ga0070692_10282613 Ga0070692_102826132 171
157 3300005345 Ga0070692_10534979 Ga0070692_105349791 171
158 3300005353 Ga0070669_100024198 Ga0070669_1000241982 171
159 3300005353 Ga0070669_100132099 Ga0070669_1001320992 171
160 3300005354 Ga0070675_100182212 Ga0070675_1001822122 171
161 3300005354 Ga0070675_100231384 Ga0070675_1002313842 171
162 3300005354 Ga0070675_100539117 Ga0070675_1005391172 171
163 3300005354 Ga0070675_101383096 Ga0070675_1013830961 171
164 3300005355 Ga0070671_100037828 Ga0070671_1000378282 171
165 3300005355 Ga0070671_100578952 Ga0070671_1005789522 171
166 3300005356 Ga0070674_100016860 Ga0070674_1000168603 171
167 3300005364 Ga0070673_100288118 Ga0070673_1002881181 171
168 3300005364 Ga0070673_100378447 Ga0070673_1003784472 171
169 3300005364 Ga0070673_100540653 Ga0070673_1005406531 171
170 3300005365 Ga0070688_100299274 Ga0070688_1002992742 171
171 3300005365 Ga0070688_100390031 Ga0070688_1003900311 171
172 3300005436 Ga0070713_100094484 Ga0070713_1000944842 171
173 3300005436 Ga0070713_100360233 Ga0070713_1003602332 171
174 3300005436 Ga0070713_100561117 Ga0070713_1005611172 171
175 3300005438 Ga0070701_10012185 Ga0070701_100121854 171
176 3300005439 Ga0070711_100408150 Ga0070711_1004081502 171
177 3300005440 Ga0070705_100201155 Ga0070705_1002011552 171
178 3300005441 Ga0070700_100353716 Ga0070700_1003537161 171
179 3300005444 Ga0070694_100019037 Ga0070694_1000190374 171
180 3300005456 Ga0070678_100021982 Ga0070678_1000219823 171
181 3300005456 Ga0070678_100085672 Ga0070678_1000856723 171
182 3300005456 Ga0070678_100490673 Ga0070678_1004906731 171
183 3300005457 Ga0070662_100200974 Ga0070662_1002009742 171
184 3300005458 Ga0070681_10019443 Ga0070681_100194437 171
185 3300005459 Ga0068867_100006098 Ga0068867_1000060983 171
186 3300005459 Ga0068867_101729858 Ga0068867_1017298581 171
187 3300005468 Ga0070707_100996142 Ga0070707_1009961422 171
188 3300005518 Ga0070699_100269686 Ga0070699_1002696861 171
189 3300005530 Ga0070679_100006875 Ga0070679_1000068757 171
190 3300005535 Ga0070684_100000896 Ga0070684_1000008963 171
191 3300005535 Ga0070684_100028774 Ga0070684_1000287743 171
192 3300005535 Ga0070684_100032657 Ga0070684_1000326572 171
193 3300005539 Ga0068853_100005709 Ga0068853_1000057099 171
194 3300005543 Ga0070672_100035087 Ga0070672_1000350874 171
195 3300005543 Ga0070672_100044958 Ga0070672_1000449584 171
196 3300005544 Ga0070686_100004785 Ga0070686_1000047857 171
197 3300005544 Ga0070686_100806565 Ga0070686_1008065652 171
198 3300005544 Ga0070686_100961653 Ga0070686_1009616531 171
199 3300005547 Ga0070693_100329734 Ga0070693_1003297341 171
200 3300005547 Ga0070693_100801340 Ga0070693_1008013401 171
201 3300005548 Ga0070665_100035780 Ga0070665_1000357804 171
202 3300005548 Ga0070665_101004946 Ga0070665_1010049461 171
203 3300005549 Ga0070704_100324120 Ga0070704_1003241202 171
204 3300005563 Ga0068855_100002190 Ga0068855_10000219016 171
205 3300005563 Ga0068855_100007763 Ga0068855_1000077639 171
206 3300005563 Ga0068855_100131963 Ga0068855_1001319634 171
207 3300005564 Ga0070664_100245929 Ga0070664_1002459292 171
208 3300005564 Ga0070664_101156999 Ga0070664_1011569992 171
209 3300005577 Ga0068857_100004374 Ga0068857_1000043749 171
210 3300005577 Ga0068857_101368084 Ga0068857_1013680841 171
211 3300005578 Ga0068854_100461358 Ga0068854_1004613581 171
212 3300005578 Ga0068854_101324437 Ga0068854_1013244371 171
213 3300005614 Ga0068856_100001477 Ga0068856_1000014778 171
214 3300005614 Ga0068856_100005705 Ga0068856_10000570511 171
215 3300005614 Ga0068856_100067787 Ga0068856_1000677872 171
216 3300005614 Ga0068856_100145479 Ga0068856_1001454792 171
217 3300005614 Ga0068856_100324535 Ga0068856_1003245351 171
218 3300005614 Ga0068856_100552891 Ga0068856_1005528912 171
219 3300005615 Ga0070702_100206336 Ga0070702_1002063361 171
220 3300005615 Ga0070702_100471460 Ga0070702_1004714601 171
221 3300005616 Ga0068852_100023869 Ga0068852_1000238693 171
222 3300005616 Ga0068852_100955744 Ga0068852_1009557442 171
223 3300005617 Ga0068859_100049199 Ga0068859_1000491994 171
224 3300005617 Ga0068859_100270693 Ga0068859_1002706931 171
225 3300005617 Ga0068859_100433726 Ga0068859_1004337262 171
226 3300005617 Ga0068859_101248346 Ga0068859_1012483462 171
227 3300005618 Ga0068864_100088960 Ga0068864_1000889602 171
228 3300005618 Ga0068864_100555227 Ga0068864_1005552271 171
229 3300005718 Ga0068866_10097528 Ga0068866_100975282 171
230 3300005719 Ga0068861_100207513 Ga0068861_1002075133 171
231 3300005834 Ga0068851_10861438 Ga0068851_108614381 171
232 3300005840 Ga0068870_10042381 Ga0068870_100423811 171
233 3300005840 Ga0068870_10073317 Ga0068870_100733172 171
234 3300005841 Ga0068863_100014694 Ga0068863_1000146945 171
235 3300005841 Ga0068863_100658546 Ga0068863_1006585461 171
236 3300005842 Ga0068858_100018531 Ga0068858_1000185315 171
237 3300005842 Ga0068858_100126346 Ga0068858_1001263462 171
238 3300005842 Ga0068858_100189374 Ga0068858_1001893742 171
239 3300005842 Ga0068858_100423782 Ga0068858_1004237822 171
240 3300005843 Ga0068860_100022201 Ga0068860_1000222012 171
241 3300005843 Ga0068860_101333395 Ga0068860_1013333952 171
242 3300005844 Ga0068862_100001318 Ga0068862_1000013182 171
243 3300005844 Ga0068862_100440943 Ga0068862_1004409431 171
244 3300006058 Ga0075432_10327226 Ga0075432_103272261 171
245 3300006163 Ga0070715_10257871 Ga0070715_102578712 171
246 3300006237 Ga0097621_100101640 Ga0097621_1001016401 171
247 3300006237 Ga0097621_100128952 Ga0097621_1001289522 171
248 3300006237 Ga0097621_100140375 Ga0097621_1001403753 171
249 3300006237 Ga0097621_100222343 Ga0097621_1002223431 171
250 3300006237 Ga0097621_101801471 Ga0097621_1018014711 171
251 3300006358 Ga0068871_100081480 Ga0068871_1000814802 171
252 3300006358 Ga0068871_100314543 Ga0068871_1003145433 171
253 3300006358 Ga0068871_100445087 Ga0068871_1004450871 171
254 3300006358 Ga0068871_100973119 Ga0068871_1009731191 171
255 3300006358 Ga0068871_101393545 Ga0068871_1013935451 171
256 3300006846 Ga0075430_100146025 Ga0075430_1001460252 171
257 3300006847 Ga0075431_100874420 Ga0075431_1008744202 171
258 3300006852 Ga0075433_10004312 Ga0075433_100043121 171
259 3300006871 Ga0075434_100007944 Ga0075434_1000079445 171
260 3300006880 Ga0075429_100053142 Ga0075429_1000531423 171
261 3300006881 Ga0068865_100092377 Ga0068865_1000923771 171
262 3300006881 Ga0068865_100180649 Ga0068865_1001806492 171
263 3300006931 Ga0097620_100049195 Ga0097620_1000491954 171
264 3300006931 Ga0097620_100270670 Ga0097620_1002706702 171
265 3300006931 Ga0097620_100433730 Ga0097620_1004337302 171
266 3300006931 Ga0097620_101248310 Ga0097620_1012483102 171
267 3300007076 Ga0075435_100061515 Ga0075435_1000615154 171
268 3300009093 Ga0105240_10008912 Ga0105240_100089129 171
269 3300009093 Ga0105240_10052766 Ga0105240_100527664 171
270 3300009093 Ga0105240_10143930 Ga0105240_101439303 171
271 3300009093 Ga0105240_10355282 Ga0105240_103552822 171
272 3300009094 Ga0111539_10009213 Ga0111539_1000921312 171
273 3300009094 Ga0111539_10494485 Ga0111539_104944852 171
274 3300009098 Ga0105245_10011107 Ga0105245_100111073 171
275 3300009098 Ga0105245_10022023 Ga0105245_100220232 171
276 3300009098 Ga0105245_10171413 Ga0105245_101714133 171
277 3300009098 Ga0105245_11108302 Ga0105245_111083021 171
278 3300009098 Ga0105245_12016510 Ga0105245_120165101 171
279 3300009174 Ga0105241_10023381 Ga0105241_100233814 171
280 3300009174 Ga0105241_10034007 Ga0105241_100340075 171
281 3300009174 Ga0105241_10065179 Ga0105241_100651793 171
282 3300009176 Ga0105242_10031057 Ga0105242_100310573 171
283 3300009176 Ga0105242_10035503 Ga0105242_100355034 171
284 3300009176 Ga0105242_10256125 Ga0105242_102561251 171
285 3300009177 Ga0105248_10002427 Ga0105248_100024272 171
286 3300009177 Ga0105248_10015004 Ga0105248_100150044 171
287 3300009177 Ga0105248_10019966 Ga0105248_100199665 171
288 3300009177 Ga0105248_10068096 Ga0105248_100680963 171
289 3300009545 Ga0105237_10001317 Ga0105237_1000131714 171
290 3300009545 Ga0105237_10024993 Ga0105237_100249932 171
291 3300009545 Ga0105237_10374186 Ga0105237_103741862 171
292 3300009545 Ga0105237_11450651 Ga0105237_114506511 171
293 3300009551 Ga0105238_10008673 Ga0105238_100086735 171
294 3300009551 Ga0105238_10052385 Ga0105238_100523855 171
295 3300009551 Ga0105238_10104379 Ga0105238_101043792 171
296 3300009553 Ga0105249_10013555 Ga0105249_100135556 171
297 3300010375 Ga0105239_10003048 Ga0105239_1000304816 171
298 3300010375 Ga0105239_10042185 Ga0105239_100421852 171
299 3300010375 Ga0105239_10053806 Ga0105239_100538065 171
300 3300010375 Ga0105239_10226984 Ga0105239_102269842 171
301 3300011119 Ga0105246_10003902 Ga0105246_1000390210 171
302 3300013104 Ga0157370_10028274 Ga0157370_100282743 171
303 3300013104 Ga0157370_10070296 Ga0157370_100702963 171
304 3300013105 Ga0157369_10002275 Ga0157369_100022756 171
305 3300013105 Ga0157369_10002738 Ga0157369_1000273814 171
306 3300013105 Ga0157369_10508078 Ga0157369_105080782 171
307 3300013296 Ga0157374_10148513 Ga0157374_101485132 171
308 3300013296 Ga0157374_10541776 Ga0157374_105417762 171
309 3300013296 Ga0157374_11718928 Ga0157374_117189281 171
310 3300013297 Ga0157378_10328613 Ga0157378_103286132 171
311 3300013306 Ga0163162_10081630 Ga0163162_100816303 171
312 3300013306 Ga0163162_10359235 Ga0163162_103592352 171
313 3300013306 Ga0163162_11770542 Ga0163162_117705421 171
314 3300013307 Ga0157372_10019605 Ga0157372_100196053 171
315 3300013307 Ga0157372_10037835 Ga0157372_100378352 171
316 3300013307 Ga0157372_10072918 Ga0157372_100729185 171
317 3300013308 Ga0157375_10008895 Ga0157375_100088954 171
318 3300013308 Ga0157375_10148700 Ga0157375_101487001 171
319 3300013308 Ga0157375_10233136 Ga0157375_102331363 171
320 3300013308 Ga0157375_10430976 Ga0157375_104309761 171
321 3300013308 Ga0157375_10471476 Ga0157375_104714762 171
322 3300013308 Ga0157375_10917120 Ga0157375_109171202 171
323 3300014325 Ga0163163_10132012 Ga0163163_101320123 171
324 3300014326 Ga0157380_10037008 Ga0157380_100370082 171
325 3300014326 Ga0157380_11405975 Ga0157380_114059751 171
326 3300014745 Ga0157377_10013748 Ga0157377_100137483 171
327 3300014745 Ga0157377_10502560 Ga0157377_105025602 171
328 3300014968 Ga0157379_10003010 Ga0157379_1000301011 171
329 3300014968 Ga0157379_10124281 Ga0157379_101242813 171
330 3300014968 Ga0157379_10340403 Ga0157379_103404032 171
331 3300014969 Ga0157376_10059103 Ga0157376_100591032 171
332 3300017792 Ga0163161_10033476 Ga0163161_100334764 171
333 3300021388 Ga0213875_10013435 Ga0213875_100134354 171
334 3300025315 Ga0207697_10012850 Ga0207697_100128504 171
335 3300025315 Ga0207697_10063443 Ga0207697_100634432 171
336 3300025893 Ga0207682_10000492 Ga0207682_100004925 171
337 3300025893 Ga0207682_10025077 Ga0207682_100250771 171
338 3300025901 Ga0207688_10000727 Ga0207688_1000072712 171
339 3300025901 Ga0207688_10075107 Ga0207688_100751073 171
340 3300025904 Ga0207647_10074245 Ga0207647_100742451 171
341 3300025907 Ga0207645_10002485 Ga0207645_1000248513 171
342 3300025908 Ga0207643_10001159 Ga0207643_1000115912 171
343 3300025908 Ga0207643_10053992 Ga0207643_100539922 171
344 3300025909 Ga0207705_10258666 Ga0207705_102586662 171
345 3300025911 Ga0207654_10033389 Ga0207654_100333894 171
346 3300025911 Ga0207654_10117761 Ga0207654_101177612 171
347 3300025911 Ga0207654_11063634 Ga0207654_110636341 171
348 3300025912 Ga0207707_10000761 Ga0207707_1000076125 171
349 3300025913 Ga0207695_10002495 Ga0207695_100024956 171
350 3300025913 Ga0207695_10004086 Ga0207695_1000408612 171
351 3300025913 Ga0207695_10102945 Ga0207695_101029453 171
352 3300025913 Ga0207695_10159457 Ga0207695_101594573 171
353 3300025914 Ga0207671_10494273 Ga0207671_104942731 171
354 3300025916 Ga0207663_10049978 Ga0207663_100499782 171
355 3300025917 Ga0207660_10131885 Ga0207660_101318851 171
356 3300025918 Ga0207662_10068160 Ga0207662_100681602 171
357 3300025919 Ga0207657_10100390 Ga0207657_101003902 171
358 3300025919 Ga0207657_10452936 Ga0207657_104529362 171
359 3300025920 Ga0207649_10148675 Ga0207649_101486752 171
360 3300025920 Ga0207649_10517591 Ga0207649_105175911 171
361 3300025920 Ga0207649_11159935 Ga0207649_111599351 171
362 3300025921 Ga0207652_10001347 Ga0207652_1000134717 171
363 3300025922 Ga0207646_10767984 Ga0207646_107679841 171
364 3300025923 Ga0207681_10007135 Ga0207681_100071352 171
365 3300025923 Ga0207681_10227075 Ga0207681_102270752 171
366 3300025923 Ga0207681_10334468 Ga0207681_103344682 171
367 3300025923 Ga0207681_10675451 Ga0207681_106754512 171
368 3300025924 Ga0207694_10000953 Ga0207694_1000095317 171
369 3300025924 Ga0207694_10013230 Ga0207694_100132302 171
370 3300025924 Ga0207694_10155737 Ga0207694_101557372 171
371 3300025925 Ga0207650_10122169 Ga0207650_101221691 171
372 3300025925 Ga0207650_11064513 Ga0207650_110645131 171
373 3300025926 Ga0207659_10405375 Ga0207659_104053752 171
374 3300025926 Ga0207659_11086842 Ga0207659_110868422 171
375 3300025927 Ga0207687_10004364 Ga0207687_100043643 171
376 3300025927 Ga0207687_10027930 Ga0207687_100279304 171
377 3300025927 Ga0207687_10736054 Ga0207687_107360542 171
378 3300025928 Ga0207700_10299797 Ga0207700_102997972 171
379 3300025928 Ga0207700_10682665 Ga0207700_106826652 171
380 3300025931 Ga0207644_10502800 Ga0207644_105028001 171
381 3300025933 Ga0207706_10023960 Ga0207706_100239604 171
382 3300025933 Ga0207706_10115626 Ga0207706_101156263 171
383 3300025933 Ga0207706_10283334 Ga0207706_102833341 171
384 3300025934 Ga0207686_10009467 Ga0207686_100094673 171
385 3300025935 Ga0207709_10210587 Ga0207709_102105873 171
386 3300025936 Ga0207670_10092503 Ga0207670_100925032 171
387 3300025938 Ga0207704_10164923 Ga0207704_101649232 171
388 3300025940 Ga0207691_10006460 Ga0207691_1000646011 171
389 3300025940 Ga0207691_10040401 Ga0207691_100404013 171
390 3300025941 Ga0207711_10006203 Ga0207711_100062033 171
391 3300025941 Ga0207711_10006402 Ga0207711_100064025 171
392 3300025941 Ga0207711_10064739 Ga0207711_100647393 171
393 3300025941 Ga0207711_11621991 Ga0207711_116219911 171
394 3300025941 Ga0207711_11726501 Ga0207711_117265011 171
395 3300025942 Ga0207689_10001107 Ga0207689_1000110723 171
396 3300025942 Ga0207689_10348386 Ga0207689_103483862 171
397 3300025944 Ga0207661_10129499 Ga0207661_101294992 171
398 3300025944 Ga0207661_10143682 Ga0207661_101436823 171
399 3300025944 Ga0207661_11224887 Ga0207661_112248872 171
400 3300025945 Ga0207679_10009412 Ga0207679_100094122 171
401 3300025945 Ga0207679_10623065 Ga0207679_106230652 171
402 3300025949 Ga0207667_10001913 Ga0207667_100019133 171
403 3300025949 Ga0207667_10016994 Ga0207667_100169943 171
404 3300025949 Ga0207667_10018865 Ga0207667_100188657 171
405 3300025960 Ga0207651_10065694 Ga0207651_100656941 171
406 3300025960 Ga0207651_10571486 Ga0207651_105714862 171
407 3300025961 Ga0207712_10049499 Ga0207712_100494994 171
408 3300025972 Ga0207668_10034287 Ga0207668_100342872 171
409 3300026023 Ga0207677_10205459 Ga0207677_102054593 171
410 3300026035 Ga0207703_10197347 Ga0207703_101973472 171
411 3300026035 Ga0207703_10636286 Ga0207703_106362861 171
412 3300026035 Ga0207703_11363004 Ga0207703_113630041 171
413 3300026041 Ga0207639_10006562 Ga0207639_100065627 171
414 3300026041 Ga0207639_10082096 Ga0207639_100820962 171
415 3300026067 Ga0207678_10309550 Ga0207678_103095502 171
416 3300026075 Ga0207708_10032354 Ga0207708_100323543 171
417 3300026078 Ga0207702_10011734 Ga0207702_100117345 171
418 3300026078 Ga0207702_10069131 Ga0207702_100691312 171
419 3300026078 Ga0207702_11602276 Ga0207702_116022761 171
420 3300026088 Ga0207641_10671291 Ga0207641_106712911 171
421 3300026089 Ga0207648_10008815 Ga0207648_100088155 171
422 3300026089 Ga0207648_10241976 Ga0207648_102419762 171
423 3300026116 Ga0207674_10000682 Ga0207674_1000068215 171
424 3300026116 Ga0207674_10353086 Ga0207674_103530863 171
425 3300026116 Ga0207674_10375111 Ga0207674_103751112 171
426 3300026116 Ga0207674_11075571 Ga0207674_110755712 171
427 3300026118 Ga0207675_100012882 Ga0207675_1000128823 171
428 3300026118 Ga0207675_100090401 Ga0207675_1000904011 171
429 3300026118 Ga0207675_100456484 Ga0207675_1004564842 171
430 3300026121 Ga0207683_10069132 Ga0207683_100691322 171
431 3300026121 Ga0207683_10078602 Ga0207683_100786022 171
432 3300026142 Ga0207698_10008302 Ga0207698_100083027 171
433 3300027717 Ga0209998_10055246 Ga0209998_100552462 171
434 3300027907 Ga0207428_10003783 Ga0207428_100037833 171
435 3300028379 Ga0268266_10015171 Ga0268266_100151713 171
436 3300028380 Ga0268265_10096287 Ga0268265_100962873 171
437 3300028381 Ga0268264_10456349 Ga0268264_104563492 171
438 3300028800 Ga0265338_10196857 Ga0265338_101968572 171
439 3300031238 Ga0265332_10022601 Ga0265332_100226012 171
440 3300031247 Ga0265340_10039360 Ga0265340_100393602 171
441 3300031344 Ga0265316_10129500 Ga0265316_101295003 171
442 3300031711 Ga0265314_10001232 Ga0265314_1000123210 171
443 3300031711 Ga0265314_10127373 Ga0265314_101273732 171
444 3300035086 Ga0373934_0028387 Ga0373934_0028387_1564_2082 171
445 3300035086 Ga0373934_0193611 Ga0373934_0193611_173_691 171
446 3300035111 Ga0373923_0283241 Ga0373923_0283241_231_749 171
447 3300035117 Ga0373953_0136644 Ga0373953_0136644_438_956 171
448 3300035119 Ga0373956_0047313 Ga0373956_0047313_1042_1560 171
449 3300035120 Ga0373957_0306447 Ga0373957_0306447_140_658 171
450 3300035172 Ga0373955_0230902 Ga0373955_0230902_498_1016 171
451 3300035172 Ga0373955_0234677 Ga0373955_0234677_104_622 171
452 3300035695 Ga0373927_0172962 Ga0373927_0172962_578_1102 171
453 3300035724 Ga0373933_0026618 Ga0373933_0026618_1647_2165 171
454 3300035724 Ga0373933_0036882 Ga0373933_0036882_2227_2745 171
455 3300036401 Ga0373937_0019522 Ga0373937_0019522_367_885 171
456 3300036401 Ga0373937_0179754 Ga0373937_0179754_1262_1780 171
457 3300036401 Ga0373937_0582893 Ga0373937_0582893_128_646 171
458 3300037853 Ga0436364_0787827 Ga0436364_0787827_3094_3615 171
459 3300039437 Ga0436365_0522788 Ga0436365_0522788_517_1038 171
460 3300042439 Ga0439464_0168004 Ga0439464_0168004_52_570 171
461 3300045051 Ga0451576_0201874 Ga0451576_0201874_1269_1787 171
462 3300046462 Ga0495651_0169594 Ga0495651_0169594_807_1325 171
463 3300046462 Ga0495651_0325000 Ga0495651_0325000_388_906 171
464 3300046472 Ga0495580_0016895 Ga0495580_0016895_4122_4646 171
465 3300046472 Ga0495580_0045433 Ga0495580_0045433_1308_1841 171
466 3300046472 Ga0495580_0224980 Ga0495580_0224980_327_845 171
467 3300046473 Ga0495582_0275556 Ga0495582_0275556_26_544 171
468 3300046511 Ga0495608_0093545 Ga0495608_0093545_23_541 171
469 3300046529 Ga0495652_0198666 Ga0495652_0198666_655_1173 171
470 3300046536 Ga0495587_0001707 Ga0495587_0001707_3086_3604 171
471 3300046536 Ga0495587_0055334 Ga0495587_0055334_571_1089 171
472 3300046663 Ga0495635_0277999 Ga0495635_0277999_224_742 171
473 3300046681 Ga0495647_0119520 Ga0495647_0119520_425_943 171
474 3300047319 Ga0495674_0184087 Ga0495674_0184087_417_935 171
475 3300047322 Ga0495680_0208093 Ga0495680_0208093_41_559 171
476 3300048088 Ga0495602_0120617 Ga0495602_0120617_807_1325 171
477 3300048907 Ga0496104_0427801 Ga0496104_0427801_206_724 171
478 3300048912 Ga0496109_0080023 Ga0496109_0080023_702_1220 171
479 3300048917 Ga0496114_0639038 Ga0496114_0639038_268_786 171
480 3300048918 Ga0496115_0183658 Ga0496115_0183658_1146_1664 171
481 3300050510 nmdc:mga06r32_327045_c1 nmdc:mga06r32_327045_c1_918_1469 171
482 3300050511 nmdc:mga08y16_78588_c1 nmdc:mga08y16_78588_c1_2901_3419 171
483 3300050512 nmdc:mga0n895_5514_c1 nmdc:mga0n895_5514_c1_4747_5265 171
484 3300050513 nmdc:mga0rr50_99720_c1 nmdc:mga0rr50_99720_c1_458_976 171
485 3300050515 nmdc:mga0a205_550_c1 nmdc:mga0a205_550_c1_18956_19474 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

42

189

0.93

PF12867

DinB_2

DinB superfamily

52

173

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8685 31 170
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8515 28 170
3gor-assembly2.cif.gz_D crystal structure of putative metal-dependent hydrolase apc36150 0.8398 28 171
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8212 30 171
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.82 28 170
ID Description Score Start End Superfamily
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.832 29 170 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8291 30 162 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8116 30 162 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8061 29 170 1.20.120.450
2ou6A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7994 32 162 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A317IVF9-F1-model_v4 DinB family protein 0.9817 26 171
AF-A0A162PK14-F1-model_v4 Damage-inducible protein DinB 0.9404 29 171
AF-A0A7V4YYR4-F1-model_v4 Damage-inducible protein DinB 0.939 28 171
AF-A0A2V8Y6R3-F1-model_v4 DinB-like domain-containing protein 0.9388 28 171
AF-A0A2V9AJS9-F1-model_v4 DinB-like domain-containing protein 0.9376 28 171

Feature Viewer

pLDDT pTM Quality
88.35 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map