F453057
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 485 | 220 | 485 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100360233|Ga0070713_1003602332 |
| Length | 189 |
| Sequence | MTLIDRRGSLHYRGTMLSKNSRIIRHLSLFCLAAAAIPAFAQTDMKTIVLKHLKTSRDFSLKVAGQMPEASYNFKLTPPQMSFAEQMVHISQSMAAILAPFSNSKPNMAKPASMDKKDVIAFMQKSYDGAIDQISKLTPDQLSKTYSGGEGTMSGMEILMFVLDHSTHHRASAEMYLRAKGITPTEYEF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 103 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 104 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 184 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 190 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 191 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 192 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 193 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 194 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.82 |
| Rhizosphere | 94.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_5472176 | 2162886012 | Unclassified | 848 |
| 2 | JGI24035J26624_1027838 | 3300002126 | Unclassified | 610 |
| 3 | Ga0065715_10076238 | 3300005293 | Unclassified | 565 |
| 4 | Ga0065715_10121950 | 3300005293 | Bacteria | 2217 |
| 5 | Ga0065715_10228854 | 3300005293 | Bacteria | 1241 |
| 6 | Ga0065707_10180299 | 3300005295 | Bacteria | 1423 |
| 7 | Ga0065707_10269189 | 3300005295 | Bacteria | 1076 |
| 8 | Ga0070658_10455692 | 3300005327 | Bacteria | 1102 |
| 9 | Ga0070676_10070374 | 3300005328 | Bacteria | 2098 |
| 10 | Ga0070683_100017554 | 3300005329 | Bacteria | 6326 |
| 11 | Ga0070683_100021932 | 3300005329 | Bacteria | 5701 |
| 12 | Ga0070690_100008464 | 3300005330 | Bacteria | 5926 |
| 13 | Ga0070690_100108227 | 3300005330 | Bacteria | 1851 |
| 14 | Ga0070670_100137019 | 3300005331 | Unclassified | 2115 |
| 15 | Ga0070670_100666922 | 3300005331 | Bacteria | 934 |
| 16 | Ga0070677_10010305 | 3300005333 | Unclassified | 3193 |
| 17 | Ga0068869_100054590 | 3300005334 | Bacteria | 2909 |
| 18 | Ga0068869_100362961 | 3300005334 | Unclassified | 1183 |
| 19 | Ga0070680_100011921 | 3300005336 | Bacteria | 6744 |
| 20 | Ga0068868_100013570 | 3300005338 | Bacteria | 5979 |
| 21 | Ga0070660_100102276 | 3300005339 | Bacteria | 2271 |
| 22 | Ga0070660_100853645 | 3300005339 | Unclassified | 767 |
| 23 | Ga0070689_100039754 | 3300005340 | Bacteria | 3603 |
| 24 | Ga0070689_100092201 | 3300005340 | Unclassified | 2389 |
| 25 | Ga0070689_100099307 | 3300005340 | Bacteria | 2303 |
| 26 | Ga0070691_10019853 | 3300005341 | Bacteria | 3102 |
| 27 | Ga0070687_100011530 | 3300005343 | Bacteria | 3869 |
| 28 | Ga0070661_100055814 | 3300005344 | Bacteria | 2892 |
| 29 | Ga0070661_100125848 | 3300005344 | Unclassified | 1922 |
| 30 | Ga0070692_10282613 | 3300005345 | Unclassified | 1006 |
| 31 | Ga0070692_10534979 | 3300005345 | Bacteria | 765 |
| 32 | Ga0070669_100024198 | 3300005353 | Bacteria | 4353 |
| 33 | Ga0070669_100132099 | 3300005353 | Bacteria | 1916 |
| 34 | Ga0070675_100182212 | 3300005354 | Bacteria | 1816 |
| 35 | Ga0070675_100231384 | 3300005354 | Bacteria | 1612 |
| 36 | Ga0070675_100539117 | 3300005354 | Unclassified | 1054 |
| 37 | Ga0070675_101383096 | 3300005354 | Bacteria | 649 |
| 38 | Ga0070671_100037828 | 3300005355 | Bacteria | 4004 |
| 39 | Ga0070671_100578952 | 3300005355 | Unclassified | 969 |
| 40 | Ga0070674_100016860 | 3300005356 | Bacteria | 4583 |
| 41 | Ga0070673_100288118 | 3300005364 | Bacteria | 1442 |
| 42 | Ga0070673_100378447 | 3300005364 | Bacteria | 1262 |
| 43 | Ga0070673_100540653 | 3300005364 | Unclassified | 1057 |
| 44 | Ga0070673_101075030 | 3300005364 | Bacteria | 751 |
| 45 | Ga0070688_100299274 | 3300005365 | Unclassified | 1162 |
| 46 | Ga0070688_100390031 | 3300005365 | Unclassified | 1028 |
| 47 | Ga0070709_10747581 | 3300005434 | Bacteria | 764 |
| 48 | Ga0070713_100094484 | 3300005436 | Unclassified | 2578 |
| 49 | Ga0070713_100111442 | 3300005436 | Bacteria | 2386 |
| 50 | Ga0070713_100240018 | 3300005436 | Unclassified | 1650 |
| 51 | Ga0070713_100360233 | 3300005436 | Bacteria | 1351 |
| 52 | Ga0070713_100561117 | 3300005436 | Unclassified | 1082 |
| 53 | Ga0070701_10012185 | 3300005438 | Bacteria | 3870 |
| 54 | Ga0070711_100408150 | 3300005439 | Bacteria | 1104 |
| 55 | Ga0070705_100201155 | 3300005440 | Bacteria | 1366 |
| 56 | Ga0070700_100353716 | 3300005441 | Unclassified | 1090 |
| 57 | Ga0070694_100019037 | 3300005444 | Bacteria | 4363 |
| 58 | Ga0070678_100021982 | 3300005456 | Bacteria | 4216 |
| 59 | Ga0070678_100085672 | 3300005456 | Unclassified | 2401 |
| 60 | Ga0070678_100490673 | 3300005456 | Unclassified | 1082 |
| 61 | Ga0070662_100200974 | 3300005457 | Bacteria | 1581 |
| 62 | Ga0070681_10019443 | 3300005458 | Bacteria | 6798 |
| 63 | Ga0068867_100006098 | 3300005459 | Bacteria | 8533 |
| 64 | Ga0068867_101470584 | 3300005459 | Unclassified | 634 |
| 65 | Ga0068867_101729858 | 3300005459 | Unclassified | 587 |
| 66 | Ga0070707_100996142 | 3300005468 | Unclassified | 803 |
| 67 | Ga0070699_100269686 | 3300005518 | Bacteria | 1523 |
| 68 | Ga0070679_100006875 | 3300005530 | Bacteria | 10609 |
| 69 | Ga0070684_100000896 | 3300005535 | Bacteria | 21078 |
| 70 | Ga0070684_100028774 | 3300005535 | Bacteria | 4702 |
| 71 | Ga0070684_100032657 | 3300005535 | Bacteria | 4438 |
| 72 | Ga0070684_100061590 | 3300005535 | Unclassified | 3284 |
| 73 | Ga0068853_100005709 | 3300005539 | Bacteria | 9789 |
| 74 | Ga0070672_100035087 | 3300005543 | Bacteria | 3810 |
| 75 | Ga0070672_100044958 | 3300005543 | Unclassified | 3413 |
| 76 | Ga0070686_100004785 | 3300005544 | Bacteria | 7475 |
| 77 | Ga0070686_100806565 | 3300005544 | Unclassified | 757 |
| 78 | Ga0070686_100961653 | 3300005544 | Unclassified | 698 |
| 79 | Ga0070693_100329734 | 3300005547 | Bacteria | 1038 |
| 80 | Ga0070693_100801340 | 3300005547 | Bacteria | 698 |
| 81 | Ga0070665_100035780 | 3300005548 | Bacteria | 4995 |
| 82 | Ga0070665_101004946 | 3300005548 | Unclassified | 846 |
| 83 | Ga0070704_100324120 | 3300005549 | Bacteria | 1292 |
| 84 | Ga0068855_100002190 | 3300005563 | Bacteria | 24156 |
| 85 | Ga0068855_100007763 | 3300005563 | Bacteria | 12956 |
| 86 | Ga0068855_100131963 | 3300005563 | Bacteria | 2852 |
| 87 | Ga0070664_100245929 | 3300005564 | Bacteria | 1607 |
| 88 | Ga0070664_101156999 | 3300005564 | Bacteria | 729 |
| 89 | Ga0068857_100004374 | 3300005577 | Bacteria | 11938 |
| 90 | Ga0068857_101368084 | 3300005577 | Unclassified | 688 |
| 91 | Ga0068854_100461358 | 3300005578 | Unclassified | 1063 |
| 92 | Ga0068854_101324437 | 3300005578 | Unclassified | 649 |
| 93 | Ga0068856_100001477 | 3300005614 | Bacteria | 24623 |
| 94 | Ga0068856_100005705 | 3300005614 | Bacteria | 12261 |
| 95 | Ga0068856_100067787 | 3300005614 | Bacteria | 3527 |
| 96 | Ga0068856_100145479 | 3300005614 | Bacteria | 2378 |
| 97 | Ga0068856_100324535 | 3300005614 | Bacteria | 1557 |
| 98 | Ga0068856_100552891 | 3300005614 | Unclassified | 1172 |
| 99 | Ga0070702_100206336 | 3300005615 | Bacteria | 1305 |
| 100 | Ga0070702_100471460 | 3300005615 | Bacteria | 915 |
| 101 | Ga0068852_100023869 | 3300005616 | Bacteria | 4932 |
| 102 | Ga0068852_100955744 | 3300005616 | Unclassified | 875 |
| 103 | Ga0068859_100049199 | 3300005617 | Bacteria | 4234 |
| 104 | Ga0068859_100270693 | 3300005617 | Bacteria | 1791 |
| 105 | Ga0068859_100433726 | 3300005617 | Unclassified | 1410 |
| 106 | Ga0068859_101248346 | 3300005617 | Unclassified | 819 |
| 107 | Ga0068864_100088960 | 3300005618 | Bacteria | 2720 |
| 108 | Ga0068864_100555227 | 3300005618 | Bacteria | 1110 |
| 109 | Ga0068866_10097528 | 3300005718 | Bacteria | 1615 |
| 110 | Ga0068861_100207513 | 3300005719 | Unclassified | 1648 |
| 111 | Ga0068851_10861438 | 3300005834 | Unclassified | 566 |
| 112 | Ga0068870_10042381 | 3300005840 | Unclassified | 2370 |
| 113 | Ga0068870_10073317 | 3300005840 | Bacteria | 1872 |
| 114 | Ga0068863_100014694 | 3300005841 | Bacteria | 7536 |
| 115 | Ga0068863_100658546 | 3300005841 | Bacteria | 1039 |
| 116 | Ga0068858_100018531 | 3300005842 | Bacteria | 6517 |
| 117 | Ga0068858_100126346 | 3300005842 | Bacteria | 2395 |
| 118 | Ga0068858_100189374 | 3300005842 | Bacteria | 1944 |
| 119 | Ga0068858_100423782 | 3300005842 | Unclassified | 1280 |
| 120 | Ga0068860_100022201 | 3300005843 | Bacteria | 6144 |
| 121 | Ga0068860_101333395 | 3300005843 | Unclassified | 738 |
| 122 | Ga0068862_100001318 | 3300005844 | Bacteria | 23064 |
| 123 | Ga0068862_100440943 | 3300005844 | Unclassified | 1226 |
| 124 | Ga0075432_10327226 | 3300006058 | Unclassified | 643 |
| 125 | Ga0070715_10257871 | 3300006163 | Bacteria | 914 |
| 126 | Ga0097621_100007227 | 3300006237 | Bacteria | 7927 |
| 127 | Ga0097621_100014049 | 3300006237 | Bacteria | 5983 |
| 128 | Ga0097621_100061328 | 3300006237 | Bacteria | 3084 |
| 129 | Ga0097621_100064455 | 3300006237 | Bacteria | 3013 |
| 130 | Ga0097621_100101640 | 3300006237 | Bacteria | 2419 |
| 131 | Ga0097621_100128952 | 3300006237 | Unclassified | 2151 |
| 132 | Ga0097621_100140375 | 3300006237 | Bacteria | 2064 |
| 133 | Ga0097621_100222343 | 3300006237 | Unclassified | 1646 |
| 134 | Ga0097621_101801471 | 3300006237 | Unclassified | 584 |
| 135 | Ga0068871_100001795 | 3300006358 | Bacteria | 14473 |
| 136 | Ga0068871_100033597 | 3300006358 | Unclassified | 4064 |
| 137 | Ga0068871_100081480 | 3300006358 | Bacteria | 2681 |
| 138 | Ga0068871_100161447 | 3300006358 | Unclassified | 1917 |
| 139 | Ga0068871_100208666 | 3300006358 | Unclassified | 1689 |
| 140 | Ga0068871_100314543 | 3300006358 | Bacteria | 1377 |
| 141 | Ga0068871_100445087 | 3300006358 | Bacteria | 1160 |
| 142 | Ga0068871_100973119 | 3300006358 | Unclassified | 789 |
| 143 | Ga0068871_101393545 | 3300006358 | Unclassified | 661 |
| 144 | Ga0075430_100146025 | 3300006846 | Bacteria | 1970 |
| 145 | Ga0075431_100874420 | 3300006847 | Unclassified | 869 |
| 146 | Ga0075433_10004312 | 3300006852 | Bacteria | 11044 |
| 147 | Ga0075434_100007944 | 3300006871 | Bacteria | 9834 |
| 148 | Ga0075434_100496098 | 3300006871 | Bacteria | 1242 |
| 149 | Ga0075429_100053142 | 3300006880 | Bacteria | 3525 |
| 150 | Ga0068865_100092377 | 3300006881 | Unclassified | 2198 |
| 151 | Ga0068865_100180649 | 3300006881 | Unclassified | 1625 |
| 152 | Ga0097620_100049195 | 3300006931 | Bacteria | 4234 |
| 153 | Ga0097620_100270670 | 3300006931 | Bacteria | 1791 |
| 154 | Ga0097620_100433730 | 3300006931 | Unclassified | 1410 |
| 155 | Ga0097620_101248310 | 3300006931 | Unclassified | 819 |
| 156 | Ga0075435_100061515 | 3300007076 | Bacteria | 3046 |
| 157 | Ga0075435_100077382 | 3300007076 | Unclassified | 2727 |
| 158 | Ga0105240_10008912 | 3300009093 | Bacteria | 14272 |
| 159 | Ga0105240_10052766 | 3300009093 | Bacteria | 5109 |
| 160 | Ga0105240_10143930 | 3300009093 | Bacteria | 2847 |
| 161 | Ga0105240_10355282 | 3300009093 | Bacteria | 1661 |
| 162 | Ga0111539_10009213 | 3300009094 | Bacteria | 12476 |
| 163 | Ga0111539_10494485 | 3300009094 | Unclassified | 1425 |
| 164 | Ga0111539_11268853 | 3300009094 | Bacteria | 855 |
| 165 | Ga0105245_10005015 | 3300009098 | Bacteria | 11637 |
| 166 | Ga0105245_10011107 | 3300009098 | Bacteria | 7839 |
| 167 | Ga0105245_10022023 | 3300009098 | Bacteria | 5593 |
| 168 | Ga0105245_10050393 | 3300009098 | Bacteria | 3732 |
| 169 | Ga0105245_10097060 | 3300009098 | Bacteria | 2721 |
| 170 | Ga0105245_10171413 | 3300009098 | Bacteria | 2067 |
| 171 | Ga0105245_10537369 | 3300009098 | Bacteria | 1190 |
| 172 | Ga0105245_11108302 | 3300009098 | Bacteria | 838 |
| 173 | Ga0105245_12016510 | 3300009098 | Bacteria | 630 |
| 174 | Ga0105247_10050586 | 3300009101 | Bacteria | 2557 |
| 175 | Ga0105243_10195513 | 3300009148 | Bacteria | 1770 |
| 176 | Ga0105241_10023381 | 3300009174 | Bacteria | 4583 |
| 177 | Ga0105241_10034007 | 3300009174 | Bacteria | 3828 |
| 178 | Ga0105241_10062756 | 3300009174 | Bacteria | 2865 |
| 179 | Ga0105241_10065179 | 3300009174 | Unclassified | 2814 |
| 180 | Ga0105242_10031057 | 3300009176 | Bacteria | 4265 |
| 181 | Ga0105242_10035503 | 3300009176 | Unclassified | 3997 |
| 182 | Ga0105242_10086836 | 3300009176 | Bacteria | 2626 |
| 183 | Ga0105242_10199013 | 3300009176 | Unclassified | 1778 |
| 184 | Ga0105242_10256125 | 3300009176 | Bacteria | 1579 |
| 185 | Ga0105248_10002427 | 3300009177 | Bacteria | 20684 |
| 186 | Ga0105248_10015004 | 3300009177 | Bacteria | 8530 |
| 187 | Ga0105248_10019966 | 3300009177 | Bacteria | 7418 |
| 188 | Ga0105248_10068096 | 3300009177 | Bacteria | 3997 |
| 189 | Ga0105237_10001317 | 3300009545 | Bacteria | 32923 |
| 190 | Ga0105237_10024993 | 3300009545 | Bacteria | 6111 |
| 191 | Ga0105237_10083555 | 3300009545 | Bacteria | 3184 |
| 192 | Ga0105237_10374186 | 3300009545 | Bacteria | 1429 |
| 193 | Ga0105237_10416404 | 3300009545 | Unclassified | 1349 |
| 194 | Ga0105237_10551787 | 3300009545 | Bacteria | 1159 |
| 195 | Ga0105237_11144067 | 3300009545 | Unclassified | 785 |
| 196 | Ga0105237_11450651 | 3300009545 | Unclassified | 693 |
| 197 | Ga0105238_10008673 | 3300009551 | Bacteria | 10171 |
| 198 | Ga0105238_10052385 | 3300009551 | Bacteria | 4102 |
| 199 | Ga0105238_10096540 | 3300009551 | Unclassified | 2942 |
| 200 | Ga0105238_10104379 | 3300009551 | Bacteria | 2815 |
| 201 | Ga0105238_10116351 | 3300009551 | Bacteria | 2653 |
| 202 | Ga0105249_10013555 | 3300009553 | Bacteria | 7200 |
| 203 | Ga0105239_10003048 | 3300010375 | Bacteria | 20831 |
| 204 | Ga0105239_10042185 | 3300010375 | Bacteria | 4999 |
| 205 | Ga0105239_10053806 | 3300010375 | Bacteria | 4414 |
| 206 | Ga0105239_10226984 | 3300010375 | Unclassified | 2095 |
| 207 | Ga0105239_10371442 | 3300010375 | Bacteria | 1616 |
| 208 | Ga0105239_10476470 | 3300010375 | Unclassified | 1418 |
| 209 | Ga0105246_10003902 | 3300011119 | Bacteria | 9033 |
| 210 | Ga0105246_10027514 | 3300011119 | Bacteria | 3727 |
| 211 | Ga0157370_10028274 | 3300013104 | Bacteria | 5518 |
| 212 | Ga0157370_10070296 | 3300013104 | Bacteria | 3304 |
| 213 | Ga0157369_10002275 | 3300013105 | Bacteria | 23100 |
| 214 | Ga0157369_10002738 | 3300013105 | Bacteria | 21047 |
| 215 | Ga0157369_10508078 | 3300013105 | Bacteria | 1247 |
| 216 | Ga0157374_10024250 | 3300013296 | Bacteria | 5435 |
| 217 | Ga0157374_10148513 | 3300013296 | Bacteria | 2278 |
| 218 | Ga0157374_10354553 | 3300013296 | Unclassified | 1458 |
| 219 | Ga0157374_10541776 | 3300013296 | Unclassified | 1171 |
| 220 | Ga0157374_10895315 | 3300013296 | Unclassified | 905 |
| 221 | Ga0157374_11087457 | 3300013296 | Unclassified | 820 |
| 222 | Ga0157374_11718928 | 3300013296 | Unclassified | 652 |
| 223 | Ga0157378_10003262 | 3300013297 | Bacteria | 14422 |
| 224 | Ga0157378_10006667 | 3300013297 | Bacteria | 10088 |
| 225 | Ga0157378_10328613 | 3300013297 | Unclassified | 1487 |
| 226 | Ga0157378_10480826 | 3300013297 | Unclassified | 1237 |
| 227 | Ga0157378_10644965 | 3300013297 | Bacteria | 1074 |
| 228 | Ga0163162_10081630 | 3300013306 | Bacteria | 3304 |
| 229 | Ga0163162_10359235 | 3300013306 | Bacteria | 1589 |
| 230 | Ga0163162_10498238 | 3300013306 | Bacteria | 1349 |
| 231 | Ga0163162_11382532 | 3300013306 | Bacteria | 801 |
| 232 | Ga0163162_11770542 | 3300013306 | Unclassified | 706 |
| 233 | Ga0157372_10019605 | 3300013307 | Bacteria | 7289 |
| 234 | Ga0157372_10037835 | 3300013307 | Bacteria | 5323 |
| 235 | Ga0157372_10072918 | 3300013307 | Bacteria | 3869 |
| 236 | Ga0157375_10008895 | 3300013308 | Bacteria | 8789 |
| 237 | Ga0157375_10082062 | 3300013308 | Bacteria | 3265 |
| 238 | Ga0157375_10148700 | 3300013308 | Unclassified | 2476 |
| 239 | Ga0157375_10233136 | 3300013308 | Bacteria | 2000 |
| 240 | Ga0157375_10430976 | 3300013308 | Bacteria | 1484 |
| 241 | Ga0157375_10471476 | 3300013308 | Unclassified | 1421 |
| 242 | Ga0157375_10917120 | 3300013308 | Unclassified | 1019 |
| 243 | Ga0157375_10976983 | 3300013308 | Bacteria | 987 |
| 244 | Ga0163163_10008800 | 3300014325 | Bacteria | 8985 |
| 245 | Ga0163163_10132012 | 3300014325 | Unclassified | 2538 |
| 246 | Ga0163163_11029670 | 3300014325 | Bacteria | 887 |
| 247 | Ga0157380_10037008 | 3300014326 | Bacteria | 3780 |
| 248 | Ga0157380_11405975 | 3300014326 | Unclassified | 748 |
| 249 | Ga0157377_10013748 | 3300014745 | Bacteria | 4103 |
| 250 | Ga0157377_10502560 | 3300014745 | Unclassified | 847 |
| 251 | Ga0157379_10003010 | 3300014968 | Bacteria | 14229 |
| 252 | Ga0157379_10124281 | 3300014968 | Unclassified | 2321 |
| 253 | Ga0157379_10340403 | 3300014968 | Bacteria | 1372 |
| 254 | Ga0157379_10474989 | 3300014968 | Bacteria | 1157 |
| 255 | Ga0157379_10628568 | 3300014968 | Bacteria | 1004 |
| 256 | Ga0157376_10059103 | 3300014969 | Bacteria | 3214 |
| 257 | Ga0157376_10117041 | 3300014969 | Unclassified | 2356 |
| 258 | Ga0157376_10229756 | 3300014969 | Bacteria | 1723 |
| 259 | Ga0157376_11055199 | 3300014969 | Bacteria | 837 |
| 260 | Ga0163161_10033476 | 3300017792 | Bacteria | 3673 |
| 261 | Ga0213873_10043524 | 3300021358 | Unclassified | 1165 |
| 262 | Ga0213873_10076430 | 3300021358 | Unclassified | 930 |
| 263 | Ga0213872_10000315 | 3300021361 | Bacteria | 41197 |
| 264 | Ga0213874_10001369 | 3300021377 | Bacteria | 5039 |
| 265 | Ga0213876_10022361 | 3300021384 | Bacteria | 3344 |
| 266 | Ga0213875_10012264 | 3300021388 | Bacteria | 4239 |
| 267 | Ga0213875_10013435 | 3300021388 | Bacteria | 4021 |
| 268 | Ga0213875_10065073 | 3300021388 | Bacteria | 1704 |
| 269 | Ga0213875_10080246 | 3300021388 | Bacteria | 1522 |
| 270 | Ga0213875_10092653 | 3300021388 | Bacteria | 1409 |
| 271 | Ga0213875_10165862 | 3300021388 | Bacteria | 1037 |
| 272 | Ga0213871_10003092 | 3300021441 | Bacteria | 3163 |
| 273 | Ga0207697_10012850 | 3300025315 | Bacteria | 3502 |
| 274 | Ga0207697_10063443 | 3300025315 | Unclassified | 1540 |
| 275 | Ga0207682_10000492 | 3300025893 | Bacteria | 18262 |
| 276 | Ga0207682_10025077 | 3300025893 | Unclassified | 2364 |
| 277 | Ga0207710_10069243 | 3300025900 | Bacteria | 1615 |
| 278 | Ga0207688_10000727 | 3300025901 | Bacteria | 16326 |
| 279 | Ga0207688_10075107 | 3300025901 | Bacteria | 1923 |
| 280 | Ga0207647_10074245 | 3300025904 | Unclassified | 2048 |
| 281 | Ga0207699_10581063 | 3300025906 | Bacteria | 815 |
| 282 | Ga0207645_10002485 | 3300025907 | Bacteria | 14467 |
| 283 | Ga0207643_10001159 | 3300025908 | Bacteria | 15659 |
| 284 | Ga0207643_10053992 | 3300025908 | Unclassified | 2283 |
| 285 | Ga0207705_10258666 | 3300025909 | Bacteria | 1329 |
| 286 | Ga0207654_10033389 | 3300025911 | Bacteria | 2852 |
| 287 | Ga0207654_10062076 | 3300025911 | Unclassified | 2188 |
| 288 | Ga0207654_10117761 | 3300025911 | Bacteria | 1663 |
| 289 | Ga0207654_10487297 | 3300025911 | Unclassified | 869 |
| 290 | Ga0207654_11063634 | 3300025911 | Unclassified | 589 |
| 291 | Ga0207707_10000761 | 3300025912 | Bacteria | 31771 |
| 292 | Ga0207707_10015549 | 3300025912 | Bacteria | 6628 |
| 293 | Ga0207707_10235519 | 3300025912 | Bacteria | 1593 |
| 294 | Ga0207695_10002495 | 3300025913 | Bacteria | 27107 |
| 295 | Ga0207695_10004086 | 3300025913 | Bacteria | 20051 |
| 296 | Ga0207695_10102945 | 3300025913 | Bacteria | 2847 |
| 297 | Ga0207695_10159457 | 3300025913 | Bacteria | 2188 |
| 298 | Ga0207671_10267636 | 3300025914 | Unclassified | 1346 |
| 299 | Ga0207671_10494273 | 3300025914 | Unclassified | 975 |
| 300 | Ga0207663_10049978 | 3300025916 | Bacteria | 2597 |
| 301 | Ga0207660_10131885 | 3300025917 | Bacteria | 1903 |
| 302 | Ga0207662_10068160 | 3300025918 | Bacteria | 2148 |
| 303 | Ga0207657_10100390 | 3300025919 | Bacteria | 2403 |
| 304 | Ga0207657_10452936 | 3300025919 | Unclassified | 1007 |
| 305 | Ga0207649_10148675 | 3300025920 | Bacteria | 1611 |
| 306 | Ga0207649_10517591 | 3300025920 | Unclassified | 909 |
| 307 | Ga0207649_11159935 | 3300025920 | Unclassified | 610 |
| 308 | Ga0207652_10001347 | 3300025921 | Bacteria | 21814 |
| 309 | Ga0207646_10767984 | 3300025922 | Unclassified | 860 |
| 310 | Ga0207681_10007135 | 3300025923 | Bacteria | 6851 |
| 311 | Ga0207681_10227075 | 3300025923 | Unclassified | 1447 |
| 312 | Ga0207681_10334468 | 3300025923 | Bacteria | 1208 |
| 313 | Ga0207681_10528903 | 3300025923 | Bacteria | 968 |
| 314 | Ga0207681_10675451 | 3300025923 | Unclassified | 857 |
| 315 | Ga0207694_10000953 | 3300025924 | Bacteria | 25560 |
| 316 | Ga0207694_10013230 | 3300025924 | Bacteria | 6212 |
| 317 | Ga0207694_10062148 | 3300025924 | Unclassified | 2907 |
| 318 | Ga0207694_10155737 | 3300025924 | Bacteria | 1843 |
| 319 | Ga0207650_10122169 | 3300025925 | Bacteria | 2029 |
| 320 | Ga0207650_11064513 | 3300025925 | Unclassified | 688 |
| 321 | Ga0207659_10405375 | 3300025926 | Unclassified | 1141 |
| 322 | Ga0207659_11086842 | 3300025926 | Unclassified | 688 |
| 323 | Ga0207687_10004364 | 3300025927 | Bacteria | 9437 |
| 324 | Ga0207687_10010285 | 3300025927 | Bacteria | 6113 |
| 325 | Ga0207687_10027930 | 3300025927 | Bacteria | 3788 |
| 326 | Ga0207687_10252973 | 3300025927 | Bacteria | 1401 |
| 327 | Ga0207687_10736054 | 3300025927 | Bacteria | 838 |
| 328 | Ga0207700_10227045 | 3300025928 | Bacteria | 1586 |
| 329 | Ga0207700_10299797 | 3300025928 | Bacteria | 1388 |
| 330 | Ga0207700_10682665 | 3300025928 | Bacteria | 916 |
| 331 | Ga0207664_10357534 | 3300025929 | Bacteria | 1293 |
| 332 | Ga0207664_10851762 | 3300025929 | Unclassified | 819 |
| 333 | Ga0207644_10502800 | 3300025931 | Unclassified | 1000 |
| 334 | Ga0207706_10023960 | 3300025933 | Bacteria | 5476 |
| 335 | Ga0207706_10115626 | 3300025933 | Bacteria | 2359 |
| 336 | Ga0207706_10283334 | 3300025933 | Bacteria | 1445 |
| 337 | Ga0207686_10009467 | 3300025934 | Bacteria | 5287 |
| 338 | Ga0207709_10079185 | 3300025935 | Bacteria | 2112 |
| 339 | Ga0207709_10210587 | 3300025935 | Unclassified | 1395 |
| 340 | Ga0207670_10092503 | 3300025936 | Bacteria | 2140 |
| 341 | Ga0207704_10164923 | 3300025938 | Unclassified | 1581 |
| 342 | Ga0207691_10006460 | 3300025940 | Bacteria | 11327 |
| 343 | Ga0207691_10040401 | 3300025940 | Bacteria | 4310 |
| 344 | Ga0207711_10006203 | 3300025941 | Bacteria | 10101 |
| 345 | Ga0207711_10006402 | 3300025941 | Bacteria | 9925 |
| 346 | Ga0207711_10064739 | 3300025941 | Bacteria | 3158 |
| 347 | Ga0207711_11621991 | 3300025941 | Unclassified | 590 |
| 348 | Ga0207711_11726501 | 3300025941 | Unclassified | 569 |
| 349 | Ga0207689_10001107 | 3300025942 | Bacteria | 25998 |
| 350 | Ga0207689_10348386 | 3300025942 | Bacteria | 1231 |
| 351 | Ga0207689_10367121 | 3300025942 | Unclassified | 1197 |
| 352 | Ga0207661_10009833 | 3300025944 | Bacteria | 6869 |
| 353 | Ga0207661_10129499 | 3300025944 | Bacteria | 2159 |
| 354 | Ga0207661_10143682 | 3300025944 | Bacteria | 2056 |
| 355 | Ga0207661_11224887 | 3300025944 | Unclassified | 690 |
| 356 | Ga0207679_10009412 | 3300025945 | Bacteria | 6260 |
| 357 | Ga0207679_10623065 | 3300025945 | Bacteria | 974 |
| 358 | Ga0207667_10001913 | 3300025949 | Bacteria | 26146 |
| 359 | Ga0207667_10016994 | 3300025949 | Bacteria | 8207 |
| 360 | Ga0207667_10018865 | 3300025949 | Bacteria | 7718 |
| 361 | Ga0207651_10065694 | 3300025960 | Bacteria | 2545 |
| 362 | Ga0207651_10571486 | 3300025960 | Bacteria | 985 |
| 363 | Ga0207712_10049499 | 3300025961 | Unclassified | 2928 |
| 364 | Ga0207668_10034287 | 3300025972 | Bacteria | 3370 |
| 365 | Ga0207677_10205459 | 3300026023 | Bacteria | 1569 |
| 366 | Ga0207703_10197347 | 3300026035 | Bacteria | 1786 |
| 367 | Ga0207703_10636286 | 3300026035 | Unclassified | 1011 |
| 368 | Ga0207703_11363004 | 3300026035 | Unclassified | 682 |
| 369 | Ga0207639_10006562 | 3300026041 | Bacteria | 7912 |
| 370 | Ga0207639_10082096 | 3300026041 | Bacteria | 2555 |
| 371 | Ga0207678_10309550 | 3300026067 | Bacteria | 1358 |
| 372 | Ga0207708_10032354 | 3300026075 | Bacteria | 3972 |
| 373 | Ga0207702_10011734 | 3300026078 | Bacteria | 7298 |
| 374 | Ga0207702_10069131 | 3300026078 | Bacteria | 3036 |
| 375 | Ga0207702_11602276 | 3300026078 | Unclassified | 644 |
| 376 | Ga0207641_10111676 | 3300026088 | Bacteria | 2424 |
| 377 | Ga0207641_10671291 | 3300026088 | Bacteria | 1019 |
| 378 | Ga0207648_10008815 | 3300026089 | Bacteria | 9715 |
| 379 | Ga0207648_10241976 | 3300026089 | Bacteria | 1607 |
| 380 | Ga0207676_10513819 | 3300026095 | Unclassified | 1139 |
| 381 | Ga0207674_10000682 | 3300026116 | Bacteria | 44093 |
| 382 | Ga0207674_10353086 | 3300026116 | Bacteria | 1421 |
| 383 | Ga0207674_10375111 | 3300026116 | Unclassified | 1375 |
| 384 | Ga0207674_11075571 | 3300026116 | Unclassified | 774 |
| 385 | Ga0207675_100012882 | 3300026118 | Bacteria | 7813 |
| 386 | Ga0207675_100090401 | 3300026118 | Unclassified | 2879 |
| 387 | Ga0207675_100456484 | 3300026118 | Bacteria | 1267 |
| 388 | Ga0207683_10069132 | 3300026121 | Unclassified | 3119 |
| 389 | Ga0207683_10078602 | 3300026121 | Bacteria | 2924 |
| 390 | Ga0207698_10008302 | 3300026142 | Bacteria | 6558 |
| 391 | Ga0209998_10055246 | 3300027717 | Unclassified | 926 |
| 392 | Ga0207428_10003783 | 3300027907 | Bacteria | 14518 |
| 393 | Ga0268266_10015171 | 3300028379 | Bacteria | 6615 |
| 394 | Ga0268265_10096287 | 3300028380 | Bacteria | 2378 |
| 395 | Ga0268265_10209403 | 3300028380 | Bacteria | 1698 |
| 396 | Ga0268264_10283549 | 3300028381 | Unclassified | 1553 |
| 397 | Ga0268264_10456349 | 3300028381 | Unclassified | 1239 |
| 398 | Ga0265338_10196857 | 3300028800 | Bacteria | 1523 |
| 399 | Ga0265332_10022601 | 3300031238 | Unclassified | 2775 |
| 400 | Ga0265340_10039360 | 3300031247 | Bacteria | 2334 |
| 401 | Ga0265316_10129500 | 3300031344 | Unclassified | 1902 |
| 402 | Ga0265314_10001232 | 3300031711 | Bacteria | 29204 |
| 403 | Ga0265314_10127373 | 3300031711 | Unclassified | 1593 |
| 404 | Ga0373934_0000928 | 3300035086 | Bacteria | 10605 |
| 405 | Ga0373934_0028387 | 3300035086 | Bacteria | 2180 |
| 406 | Ga0373934_0193611 | 3300035086 | Bacteria | 836 |
| 407 | Ga0373923_0283241 | 3300035111 | Unclassified | 781 |
| 408 | Ga0373939_0259658 | 3300035114 | Unclassified | 679 |
| 409 | Ga0373953_0136644 | 3300035117 | Bacteria | 1047 |
| 410 | Ga0373954_0002995 | 3300035118 | Bacteria | 7123 |
| 411 | Ga0373956_0047313 | 3300035119 | Bacteria | 1924 |
| 412 | Ga0373957_0306447 | 3300035120 | Bacteria | 674 |
| 413 | Ga0373955_0220747 | 3300035172 | Bacteria | 1132 |
| 414 | Ga0373955_0230902 | 3300035172 | Bacteria | 1107 |
| 415 | Ga0373955_0234677 | 3300035172 | Unclassified | 1098 |
| 416 | Ga0373924_0113821 | 3300035410 | Bacteria | 1171 |
| 417 | Ga0373935_0272219 | 3300035692 | Bacteria | 1190 |
| 418 | Ga0373927_0172962 | 3300035695 | Bacteria | 1416 |
| 419 | Ga0373933_0026618 | 3300035724 | Bacteria | 3323 |
| 420 | Ga0373933_0036882 | 3300035724 | Unclassified | 2865 |
| 421 | Ga0373937_0019522 | 3300036401 | Bacteria | 6065 |
| 422 | Ga0373937_0168218 | 3300036401 | Bacteria | 2056 |
| 423 | Ga0373937_0179754 | 3300036401 | Bacteria | 1986 |
| 424 | Ga0373937_0582893 | 3300036401 | Unclassified | 1062 |
| 425 | Ga0373937_1127402 | 3300036401 | Unclassified | 733 |
| 426 | Ga0373925_0070171 | 3300037068 | Bacteria | 2648 |
| 427 | Ga0373925_0322254 | 3300037068 | Viruses | 1251 |
| 428 | Ga0436364_0356229 | 3300037853 | Bacteria | 15943 |
| 429 | Ga0436364_0713301 | 3300037853 | Bacteria | 1487 |
| 430 | Ga0436364_0755318 | 3300037853 | Bacteria | 1037 |
| 431 | Ga0436364_0787827 | 3300037853 | Bacteria | 12605 |
| 432 | Ga0436364_1128605 | 3300037853 | Bacteria | 48889 |
| 433 | Ga0436364_1455492 | 3300037853 | Bacteria | 2392 |
| 434 | Ga0436365_0230171 | 3300039437 | Bacteria | 2318 |
| 435 | Ga0436365_0522788 | 3300039437 | Bacteria | 3540 |
| 436 | Ga0436365_0912888 | 3300039437 | Bacteria | 3251 |
| 437 | Ga0436365_1041088 | 3300039437 | Unclassified | 876 |
| 438 | Ga0436360_0437733 | 3300039438 | Bacteria | 8911 |
| 439 | Ga0436361_1020706 | 3300039447 | Bacteria | 66534 |
| 440 | Ga0436363_0033107 | 3300039450 | Bacteria | 1886 |
| 441 | Ga0436363_0046554 | 3300039450 | Bacteria | 872 |
| 442 | Ga0436363_1596932 | 3300039450 | Bacteria | 4514 |
| 443 | Ga0436362_0055550 | 3300039453 | Unclassified | 697 |
| 444 | Ga0436362_0389385 | 3300039453 | Unclassified | 1294 |
| 445 | Ga0436362_0660779 | 3300039453 | Bacteria | 5300 |
| 446 | Ga0436362_0701711 | 3300039453 | Bacteria | 787 |
| 447 | Ga0439464_0168004 | 3300042439 | Unclassified | 691 |
| 448 | Ga0466969_0262237 | 3300044656 | Unclassified | 783 |
| 449 | Ga0451576_0201874 | 3300045051 | Bacteria | 2076 |
| 450 | Ga0495651_0169594 | 3300046462 | Bacteria | 1556 |
| 451 | Ga0495651_0225858 | 3300046462 | Bacteria | 1293 |
| 452 | Ga0495651_0325000 | 3300046462 | Bacteria | 1024 |
| 453 | Ga0495580_0016895 | 3300046472 | Bacteria | 5470 |
| 454 | Ga0495580_0045433 | 3300046472 | Bacteria | 3120 |
| 455 | Ga0495580_0224980 | 3300046472 | Bacteria | 1289 |
| 456 | Ga0495580_0821056 | 3300046472 | Unclassified | 602 |
| 457 | Ga0495582_0275556 | 3300046473 | Bacteria | 966 |
| 458 | Ga0495594_0520666 | 3300046499 | Unclassified | 675 |
| 459 | Ga0495608_0093545 | 3300046511 | Bacteria | 1942 |
| 460 | Ga0495652_0198666 | 3300046529 | Bacteria | 1524 |
| 461 | Ga0495587_0001707 | 3300046536 | Bacteria | 14667 |
| 462 | Ga0495587_0055334 | 3300046536 | Unclassified | 2337 |
| 463 | Ga0495587_0212242 | 3300046536 | Unclassified | 1093 |
| 464 | Ga0495645_0067700 | 3300046543 | Bacteria | 2579 |
| 465 | Ga0495635_0277999 | 3300046663 | Bacteria | 1125 |
| 466 | Ga0495647_0119520 | 3300046681 | Bacteria | 1107 |
| 467 | Ga0495669_0074951 | 3300046684 | Bacteria | 1547 |
| 468 | Ga0495674_0184087 | 3300047319 | Bacteria | 1738 |
| 469 | Ga0495680_0208093 | 3300047322 | Bacteria | 1401 |
| 470 | Ga0495602_0120617 | 3300048088 | Bacteria | 2110 |
| 471 | Ga0495602_0482909 | 3300048088 | Bacteria | 869 |
| 472 | Ga0496104_0427801 | 3300048907 | Bacteria | 1236 |
| 473 | Ga0496109_0080023 | 3300048912 | Bacteria | 3011 |
| 474 | Ga0496114_0639038 | 3300048917 | Unclassified | 937 |
| 475 | Ga0496115_0183658 | 3300048918 | Unclassified | 1728 |
| 476 | nmdc:mga06r32_327045_c1 | 3300050510 | Bacteria | 1518 |
| 477 | nmdc:mga08y16_78588_c1 | 3300050511 | Bacteria | 3440 |
| 478 | nmdc:mga0n895_325264_c1 | 3300050512 | Bacteria | 1558 |
| 479 | nmdc:mga0n895_5514_c1 | 3300050512 | Bacteria | 10593 |
| 480 | nmdc:mga0rr50_54732_c1 | 3300050513 | Bacteria | 2974 |
| 481 | nmdc:mga0rr50_99720_c1 | 3300050513 | Bacteria | 2279 |
| 482 | nmdc:mga08x19_158678_c1 | 3300050514 | Unclassified | 1535 |
| 483 | nmdc:mga08x19_277684_c1 | 3300050514 | Bacteria | 1160 |
| 484 | nmdc:mga0a205_550_c1 | 3300050515 | Bacteria | 24226 |
| 485 | Ga0466962_0181867 | 3300061719 | Bacteria | 1025 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_10116351 | Ga0105238_101163512 | 150 |
| 2 | 3300009545 | Ga0105237_10083555 | Ga0105237_100835552 | 152 |
| 3 | 3300010375 | Ga0105239_10371442 | Ga0105239_103714422 | 152 |
| 4 | 3300013308 | Ga0157375_10976983 | Ga0157375_109769831 | 155 |
| 5 | 3300014968 | Ga0157379_10628568 | Ga0157379_106285681 | 155 |
| 6 | 3300014969 | Ga0157376_10229756 | Ga0157376_102297562 | 155 |
| 7 | 3300009094 | Ga0111539_11268853 | Ga0111539_112688532 | 156 |
| 8 | 3300009545 | Ga0105237_11144067 | Ga0105237_111440671 | 157 |
| 9 | 3300013297 | Ga0157378_10480826 | Ga0157378_104808262 | 157 |
| 10 | 3300014325 | Ga0163163_10008800 | Ga0163163_100088002 | 157 |
| 11 | 3300039437 | Ga0436365_1041088 | Ga0436365_1041088_353_847 | 157 |
| 12 | 3300039453 | Ga0436362_0701711 | Ga0436362_0701711_248_724 | 157 |
| 13 | 3300025900 | Ga0207710_10069243 | Ga0207710_100692433 | 159 |
| 14 | 3300013297 | Ga0157378_10644965 | Ga0157378_106449652 | 160 |
| 15 | 3300009098 | Ga0105245_10537369 | Ga0105245_105373691 | 161 |
| 16 | 3300009148 | Ga0105243_10195513 | Ga0105243_101955134 | 161 |
| 17 | 3300009176 | Ga0105242_10086836 | Ga0105242_100868364 | 161 |
| 18 | 3300013296 | Ga0157374_10024250 | Ga0157374_100242504 | 161 |
| 19 | 3300013306 | Ga0163162_11382532 | Ga0163162_113825322 | 161 |
| 20 | 3300013308 | Ga0157375_10082062 | Ga0157375_100820623 | 161 |
| 21 | 3300014968 | Ga0157379_10474989 | Ga0157379_104749892 | 161 |
| 22 | 3300014969 | Ga0157376_11055199 | Ga0157376_110551992 | 161 |
| 23 | 3300039450 | Ga0436363_0046554 | Ga0436363_0046554_293_787 | 161 |
| 24 | 3300046472 | Ga0495580_0821056 | Ga0495580_0821056_81_569 | 161 |
| 25 | 3300050514 | nmdc:mga08x19_158678_c1 | nmdc:mga08x19_158678_c1_675_1163 | 161 |
| 26 | 3300009098 | Ga0105245_10050393 | Ga0105245_100503934 | 162 |
| 27 | 3300025912 | Ga0207707_10235519 | Ga0207707_102355194 | 163 |
| 28 | 3300013296 | Ga0157374_10895315 | Ga0157374_108953151 | 164 |
| 29 | 3300021388 | Ga0213875_10165862 | Ga0213875_101658622 | 164 |
| 30 | 3300035172 | Ga0373955_0220747 | Ga0373955_0220747_140_646 | 164 |
| 31 | 3300035692 | Ga0373935_0272219 | Ga0373935_0272219_538_1044 | 164 |
| 32 | 3300037068 | Ga0373925_0070171 | Ga0373925_0070171_49_555 | 164 |
| 33 | 3300037853 | Ga0436364_0755318 | Ga0436364_0755318_455_958 | 164 |
| 34 | 3300039437 | Ga0436365_0230171 | Ga0436365_0230171_1495_1998 | 164 |
| 35 | 3300044656 | Ga0466969_0262237 | Ga0466969_0262237_158_664 | 164 |
| 36 | 3300061719 | Ga0466962_0181867 | Ga0466962_0181867_265_771 | 164 |
| 37 | 3300013296 | Ga0157374_11087457 | Ga0157374_110874572 | 165 |
| 38 | 3300021358 | Ga0213873_10043524 | Ga0213873_100435242 | 165 |
| 39 | 3300021358 | Ga0213873_10076430 | Ga0213873_100764302 | 165 |
| 40 | 3300021361 | Ga0213872_10000315 | Ga0213872_1000031527 | 165 |
| 41 | 3300021377 | Ga0213874_10001369 | Ga0213874_100013693 | 165 |
| 42 | 3300021384 | Ga0213876_10022361 | Ga0213876_100223612 | 165 |
| 43 | 3300021388 | Ga0213875_10012264 | Ga0213875_100122644 | 165 |
| 44 | 3300021388 | Ga0213875_10065073 | Ga0213875_100650731 | 165 |
| 45 | 3300021388 | Ga0213875_10080246 | Ga0213875_100802462 | 165 |
| 46 | 3300021388 | Ga0213875_10092653 | Ga0213875_100926532 | 165 |
| 47 | 3300021441 | Ga0213871_10003092 | Ga0213871_100030923 | 165 |
| 48 | 3300025923 | Ga0207681_10528903 | Ga0207681_105289032 | 165 |
| 49 | 3300025929 | Ga0207664_10357534 | Ga0207664_103575342 | 165 |
| 50 | 3300028380 | Ga0268265_10209403 | Ga0268265_102094032 | 165 |
| 51 | 3300037853 | Ga0436364_0356229 | Ga0436364_0356229_12817_13323 | 165 |
| 52 | 3300037853 | Ga0436364_0713301 | Ga0436364_0713301_444_950 | 165 |
| 53 | 3300037853 | Ga0436364_1128605 | Ga0436364_1128605_33538_34044 | 165 |
| 54 | 3300037853 | Ga0436364_1455492 | Ga0436364_1455492_1845_2366 | 165 |
| 55 | 3300039437 | Ga0436365_0912888 | Ga0436365_0912888_1465_1971 | 165 |
| 56 | 3300039438 | Ga0436360_0437733 | Ga0436360_0437733_1673_2176 | 165 |
| 57 | 3300039447 | Ga0436361_1020706 | Ga0436361_1020706_27454_27957 | 165 |
| 58 | 3300039450 | Ga0436363_0033107 | Ga0436363_0033107_502_1017 | 165 |
| 59 | 3300039450 | Ga0436363_1596932 | Ga0436363_1596932_3827_4351 | 165 |
| 60 | 3300039453 | Ga0436362_0055550 | Ga0436362_0055550_76_582 | 165 |
| 61 | 3300039453 | Ga0436362_0389385 | Ga0436362_0389385_348_851 | 165 |
| 62 | 3300039453 | Ga0436362_0660779 | Ga0436362_0660779_1196_1717 | 165 |
| 63 | 3300009545 | Ga0105237_10551787 | Ga0105237_105517872 | 166 |
| 64 | 3300025912 | Ga0207707_10015549 | Ga0207707_100155496 | 166 |
| 65 | 3300005364 | Ga0070673_101075030 | Ga0070673_1010750302 | 167 |
| 66 | 3300028381 | Ga0268264_10283549 | Ga0268264_102835493 | 167 |
| 67 | 3300005334 | Ga0068869_100362961 | Ga0068869_1003629612 | 168 |
| 68 | 3300005436 | Ga0070713_100111442 | Ga0070713_1001114422 | 168 |
| 69 | 3300005459 | Ga0068867_101470584 | Ga0068867_1014705841 | 168 |
| 70 | 3300006237 | Ga0097621_100061328 | Ga0097621_1000613284 | 168 |
| 71 | 3300006358 | Ga0068871_100161447 | Ga0068871_1001614472 | 168 |
| 72 | 3300009098 | Ga0105245_10005015 | Ga0105245_100050159 | 168 |
| 73 | 3300009098 | Ga0105245_10097060 | Ga0105245_100970602 | 168 |
| 74 | 3300009101 | Ga0105247_10050586 | Ga0105247_100505863 | 168 |
| 75 | 3300009174 | Ga0105241_10062756 | Ga0105241_100627563 | 168 |
| 76 | 3300011119 | Ga0105246_10027514 | Ga0105246_100275141 | 168 |
| 77 | 3300013297 | Ga0157378_10003262 | Ga0157378_100032627 | 168 |
| 78 | 3300013306 | Ga0163162_10498238 | Ga0163162_104982382 | 168 |
| 79 | 3300025911 | Ga0207654_10062076 | Ga0207654_100620763 | 168 |
| 80 | 3300025927 | Ga0207687_10010285 | Ga0207687_100102855 | 168 |
| 81 | 3300025927 | Ga0207687_10252973 | Ga0207687_102529732 | 168 |
| 82 | 3300025928 | Ga0207700_10227045 | Ga0207700_102270452 | 168 |
| 83 | 3300025935 | Ga0207709_10079185 | Ga0207709_100791852 | 168 |
| 84 | 3300025942 | Ga0207689_10367121 | Ga0207689_103671212 | 168 |
| 85 | 3300026088 | Ga0207641_10111676 | Ga0207641_101116764 | 168 |
| 86 | 3300026095 | Ga0207676_10513819 | Ga0207676_105138192 | 168 |
| 87 | 3300036401 | Ga0373937_1127402 | Ga0373937_1127402_164_673 | 168 |
| 88 | 3300046543 | Ga0495645_0067700 | Ga0495645_0067700_335_850 | 168 |
| 89 | 3300002126 | JGI24035J26624_1027838 | JGI24035J26624_10278381 | 169 |
| 90 | 3300005434 | Ga0070709_10747581 | Ga0070709_107475812 | 169 |
| 91 | 3300005436 | Ga0070713_100240018 | Ga0070713_1002400182 | 169 |
| 92 | 3300006237 | Ga0097621_100007227 | Ga0097621_1000072276 | 169 |
| 93 | 3300006358 | Ga0068871_100033597 | Ga0068871_1000335974 | 169 |
| 94 | 3300009176 | Ga0105242_10199013 | Ga0105242_101990132 | 169 |
| 95 | 3300009545 | Ga0105237_10416404 | Ga0105237_104164043 | 169 |
| 96 | 3300009551 | Ga0105238_10096540 | Ga0105238_100965403 | 169 |
| 97 | 3300010375 | Ga0105239_10476470 | Ga0105239_104764701 | 169 |
| 98 | 3300013296 | Ga0157374_10354553 | Ga0157374_103545532 | 169 |
| 99 | 3300013297 | Ga0157378_10006667 | Ga0157378_100066679 | 169 |
| 100 | 3300025906 | Ga0207699_10581063 | Ga0207699_105810632 | 169 |
| 101 | 3300025911 | Ga0207654_10487297 | Ga0207654_104872972 | 169 |
| 102 | 3300025914 | Ga0207671_10267636 | Ga0207671_102676363 | 169 |
| 103 | 3300025924 | Ga0207694_10062148 | Ga0207694_100621483 | 169 |
| 104 | 3300025929 | Ga0207664_10851762 | Ga0207664_108517621 | 169 |
| 105 | 3300046684 | Ga0495669_0074951 | Ga0495669_0074951_512_1021 | 169 |
| 106 | 3300005328 | Ga0070676_10070374 | Ga0070676_100703742 | 170 |
| 107 | 3300005329 | Ga0070683_100017554 | Ga0070683_1000175542 | 170 |
| 108 | 3300005535 | Ga0070684_100061590 | Ga0070684_1000615902 | 170 |
| 109 | 3300006237 | Ga0097621_100014049 | Ga0097621_1000140492 | 170 |
| 110 | 3300006237 | Ga0097621_100064455 | Ga0097621_1000644555 | 170 |
| 111 | 3300006358 | Ga0068871_100001795 | Ga0068871_1000017952 | 170 |
| 112 | 3300006358 | Ga0068871_100208666 | Ga0068871_1002086663 | 170 |
| 113 | 3300006871 | Ga0075434_100496098 | Ga0075434_1004960982 | 170 |
| 114 | 3300007076 | Ga0075435_100077382 | Ga0075435_1000773824 | 170 |
| 115 | 3300014325 | Ga0163163_11029670 | Ga0163163_110296702 | 170 |
| 116 | 3300014969 | Ga0157376_10117041 | Ga0157376_101170411 | 170 |
| 117 | 3300025944 | Ga0207661_10009833 | Ga0207661_100098338 | 170 |
| 118 | 3300035086 | Ga0373934_0000928 | Ga0373934_0000928_206_721 | 170 |
| 119 | 3300035114 | Ga0373939_0259658 | Ga0373939_0259658_30_545 | 170 |
| 120 | 3300035118 | Ga0373954_0002995 | Ga0373954_0002995_5548_6063 | 170 |
| 121 | 3300035410 | Ga0373924_0113821 | Ga0373924_0113821_419_934 | 170 |
| 122 | 3300036401 | Ga0373937_0168218 | Ga0373937_0168218_336_851 | 170 |
| 123 | 3300037068 | Ga0373925_0322254 | Ga0373925_0322254_611_1126 | 170 |
| 124 | 3300046462 | Ga0495651_0225858 | Ga0495651_0225858_215_730 | 170 |
| 125 | 3300046499 | Ga0495594_0520666 | Ga0495594_0520666_115_648 | 170 |
| 126 | 3300046536 | Ga0495587_0212242 | Ga0495587_0212242_146_661 | 170 |
| 127 | 3300048088 | Ga0495602_0482909 | Ga0495602_0482909_320_835 | 170 |
| 128 | 3300050512 | nmdc:mga0n895_325264_c1 | nmdc:mga0n895_325264_c1_591_1103 | 170 |
| 129 | 3300050513 | nmdc:mga0rr50_54732_c1 | nmdc:mga0rr50_54732_c1_1555_2067 | 170 |
| 130 | 3300050514 | nmdc:mga08x19_277684_c1 | nmdc:mga08x19_277684_c1_275_787 | 170 |
| 131 | 2162886012 | MBSR1b_contig_5472176 | MBSR1b_0837.00002040 | 171 |
| 132 | 3300005293 | Ga0065715_10076238 | Ga0065715_100762381 | 171 |
| 133 | 3300005293 | Ga0065715_10121950 | Ga0065715_101219502 | 171 |
| 134 | 3300005293 | Ga0065715_10228854 | Ga0065715_102288541 | 171 |
| 135 | 3300005295 | Ga0065707_10180299 | Ga0065707_101802992 | 171 |
| 136 | 3300005295 | Ga0065707_10269189 | Ga0065707_102691892 | 171 |
| 137 | 3300005327 | Ga0070658_10455692 | Ga0070658_104556922 | 171 |
| 138 | 3300005329 | Ga0070683_100021932 | Ga0070683_1000219326 | 171 |
| 139 | 3300005330 | Ga0070690_100008464 | Ga0070690_1000084641 | 171 |
| 140 | 3300005330 | Ga0070690_100108227 | Ga0070690_1001082272 | 171 |
| 141 | 3300005331 | Ga0070670_100137019 | Ga0070670_1001370192 | 171 |
| 142 | 3300005331 | Ga0070670_100666922 | Ga0070670_1006669221 | 171 |
| 143 | 3300005333 | Ga0070677_10010305 | Ga0070677_100103052 | 171 |
| 144 | 3300005334 | Ga0068869_100054590 | Ga0068869_1000545901 | 171 |
| 145 | 3300005336 | Ga0070680_100011921 | Ga0070680_1000119211 | 171 |
| 146 | 3300005338 | Ga0068868_100013570 | Ga0068868_1000135707 | 171 |
| 147 | 3300005339 | Ga0070660_100102276 | Ga0070660_1001022762 | 171 |
| 148 | 3300005339 | Ga0070660_100853645 | Ga0070660_1008536451 | 171 |
| 149 | 3300005340 | Ga0070689_100039754 | Ga0070689_1000397543 | 171 |
| 150 | 3300005340 | Ga0070689_100092201 | Ga0070689_1000922013 | 171 |
| 151 | 3300005340 | Ga0070689_100099307 | Ga0070689_1000993072 | 171 |
| 152 | 3300005341 | Ga0070691_10019853 | Ga0070691_100198533 | 171 |
| 153 | 3300005343 | Ga0070687_100011530 | Ga0070687_1000115302 | 171 |
| 154 | 3300005344 | Ga0070661_100055814 | Ga0070661_1000558142 | 171 |
| 155 | 3300005344 | Ga0070661_100125848 | Ga0070661_1001258481 | 171 |
| 156 | 3300005345 | Ga0070692_10282613 | Ga0070692_102826132 | 171 |
| 157 | 3300005345 | Ga0070692_10534979 | Ga0070692_105349791 | 171 |
| 158 | 3300005353 | Ga0070669_100024198 | Ga0070669_1000241982 | 171 |
| 159 | 3300005353 | Ga0070669_100132099 | Ga0070669_1001320992 | 171 |
| 160 | 3300005354 | Ga0070675_100182212 | Ga0070675_1001822122 | 171 |
| 161 | 3300005354 | Ga0070675_100231384 | Ga0070675_1002313842 | 171 |
| 162 | 3300005354 | Ga0070675_100539117 | Ga0070675_1005391172 | 171 |
| 163 | 3300005354 | Ga0070675_101383096 | Ga0070675_1013830961 | 171 |
| 164 | 3300005355 | Ga0070671_100037828 | Ga0070671_1000378282 | 171 |
| 165 | 3300005355 | Ga0070671_100578952 | Ga0070671_1005789522 | 171 |
| 166 | 3300005356 | Ga0070674_100016860 | Ga0070674_1000168603 | 171 |
| 167 | 3300005364 | Ga0070673_100288118 | Ga0070673_1002881181 | 171 |
| 168 | 3300005364 | Ga0070673_100378447 | Ga0070673_1003784472 | 171 |
| 169 | 3300005364 | Ga0070673_100540653 | Ga0070673_1005406531 | 171 |
| 170 | 3300005365 | Ga0070688_100299274 | Ga0070688_1002992742 | 171 |
| 171 | 3300005365 | Ga0070688_100390031 | Ga0070688_1003900311 | 171 |
| 172 | 3300005436 | Ga0070713_100094484 | Ga0070713_1000944842 | 171 |
| 173 | 3300005436 | Ga0070713_100360233 | Ga0070713_1003602332 | 171 |
| 174 | 3300005436 | Ga0070713_100561117 | Ga0070713_1005611172 | 171 |
| 175 | 3300005438 | Ga0070701_10012185 | Ga0070701_100121854 | 171 |
| 176 | 3300005439 | Ga0070711_100408150 | Ga0070711_1004081502 | 171 |
| 177 | 3300005440 | Ga0070705_100201155 | Ga0070705_1002011552 | 171 |
| 178 | 3300005441 | Ga0070700_100353716 | Ga0070700_1003537161 | 171 |
| 179 | 3300005444 | Ga0070694_100019037 | Ga0070694_1000190374 | 171 |
| 180 | 3300005456 | Ga0070678_100021982 | Ga0070678_1000219823 | 171 |
| 181 | 3300005456 | Ga0070678_100085672 | Ga0070678_1000856723 | 171 |
| 182 | 3300005456 | Ga0070678_100490673 | Ga0070678_1004906731 | 171 |
| 183 | 3300005457 | Ga0070662_100200974 | Ga0070662_1002009742 | 171 |
| 184 | 3300005458 | Ga0070681_10019443 | Ga0070681_100194437 | 171 |
| 185 | 3300005459 | Ga0068867_100006098 | Ga0068867_1000060983 | 171 |
| 186 | 3300005459 | Ga0068867_101729858 | Ga0068867_1017298581 | 171 |
| 187 | 3300005468 | Ga0070707_100996142 | Ga0070707_1009961422 | 171 |
| 188 | 3300005518 | Ga0070699_100269686 | Ga0070699_1002696861 | 171 |
| 189 | 3300005530 | Ga0070679_100006875 | Ga0070679_1000068757 | 171 |
| 190 | 3300005535 | Ga0070684_100000896 | Ga0070684_1000008963 | 171 |
| 191 | 3300005535 | Ga0070684_100028774 | Ga0070684_1000287743 | 171 |
| 192 | 3300005535 | Ga0070684_100032657 | Ga0070684_1000326572 | 171 |
| 193 | 3300005539 | Ga0068853_100005709 | Ga0068853_1000057099 | 171 |
| 194 | 3300005543 | Ga0070672_100035087 | Ga0070672_1000350874 | 171 |
| 195 | 3300005543 | Ga0070672_100044958 | Ga0070672_1000449584 | 171 |
| 196 | 3300005544 | Ga0070686_100004785 | Ga0070686_1000047857 | 171 |
| 197 | 3300005544 | Ga0070686_100806565 | Ga0070686_1008065652 | 171 |
| 198 | 3300005544 | Ga0070686_100961653 | Ga0070686_1009616531 | 171 |
| 199 | 3300005547 | Ga0070693_100329734 | Ga0070693_1003297341 | 171 |
| 200 | 3300005547 | Ga0070693_100801340 | Ga0070693_1008013401 | 171 |
| 201 | 3300005548 | Ga0070665_100035780 | Ga0070665_1000357804 | 171 |
| 202 | 3300005548 | Ga0070665_101004946 | Ga0070665_1010049461 | 171 |
| 203 | 3300005549 | Ga0070704_100324120 | Ga0070704_1003241202 | 171 |
| 204 | 3300005563 | Ga0068855_100002190 | Ga0068855_10000219016 | 171 |
| 205 | 3300005563 | Ga0068855_100007763 | Ga0068855_1000077639 | 171 |
| 206 | 3300005563 | Ga0068855_100131963 | Ga0068855_1001319634 | 171 |
| 207 | 3300005564 | Ga0070664_100245929 | Ga0070664_1002459292 | 171 |
| 208 | 3300005564 | Ga0070664_101156999 | Ga0070664_1011569992 | 171 |
| 209 | 3300005577 | Ga0068857_100004374 | Ga0068857_1000043749 | 171 |
| 210 | 3300005577 | Ga0068857_101368084 | Ga0068857_1013680841 | 171 |
| 211 | 3300005578 | Ga0068854_100461358 | Ga0068854_1004613581 | 171 |
| 212 | 3300005578 | Ga0068854_101324437 | Ga0068854_1013244371 | 171 |
| 213 | 3300005614 | Ga0068856_100001477 | Ga0068856_1000014778 | 171 |
| 214 | 3300005614 | Ga0068856_100005705 | Ga0068856_10000570511 | 171 |
| 215 | 3300005614 | Ga0068856_100067787 | Ga0068856_1000677872 | 171 |
| 216 | 3300005614 | Ga0068856_100145479 | Ga0068856_1001454792 | 171 |
| 217 | 3300005614 | Ga0068856_100324535 | Ga0068856_1003245351 | 171 |
| 218 | 3300005614 | Ga0068856_100552891 | Ga0068856_1005528912 | 171 |
| 219 | 3300005615 | Ga0070702_100206336 | Ga0070702_1002063361 | 171 |
| 220 | 3300005615 | Ga0070702_100471460 | Ga0070702_1004714601 | 171 |
| 221 | 3300005616 | Ga0068852_100023869 | Ga0068852_1000238693 | 171 |
| 222 | 3300005616 | Ga0068852_100955744 | Ga0068852_1009557442 | 171 |
| 223 | 3300005617 | Ga0068859_100049199 | Ga0068859_1000491994 | 171 |
| 224 | 3300005617 | Ga0068859_100270693 | Ga0068859_1002706931 | 171 |
| 225 | 3300005617 | Ga0068859_100433726 | Ga0068859_1004337262 | 171 |
| 226 | 3300005617 | Ga0068859_101248346 | Ga0068859_1012483462 | 171 |
| 227 | 3300005618 | Ga0068864_100088960 | Ga0068864_1000889602 | 171 |
| 228 | 3300005618 | Ga0068864_100555227 | Ga0068864_1005552271 | 171 |
| 229 | 3300005718 | Ga0068866_10097528 | Ga0068866_100975282 | 171 |
| 230 | 3300005719 | Ga0068861_100207513 | Ga0068861_1002075133 | 171 |
| 231 | 3300005834 | Ga0068851_10861438 | Ga0068851_108614381 | 171 |
| 232 | 3300005840 | Ga0068870_10042381 | Ga0068870_100423811 | 171 |
| 233 | 3300005840 | Ga0068870_10073317 | Ga0068870_100733172 | 171 |
| 234 | 3300005841 | Ga0068863_100014694 | Ga0068863_1000146945 | 171 |
| 235 | 3300005841 | Ga0068863_100658546 | Ga0068863_1006585461 | 171 |
| 236 | 3300005842 | Ga0068858_100018531 | Ga0068858_1000185315 | 171 |
| 237 | 3300005842 | Ga0068858_100126346 | Ga0068858_1001263462 | 171 |
| 238 | 3300005842 | Ga0068858_100189374 | Ga0068858_1001893742 | 171 |
| 239 | 3300005842 | Ga0068858_100423782 | Ga0068858_1004237822 | 171 |
| 240 | 3300005843 | Ga0068860_100022201 | Ga0068860_1000222012 | 171 |
| 241 | 3300005843 | Ga0068860_101333395 | Ga0068860_1013333952 | 171 |
| 242 | 3300005844 | Ga0068862_100001318 | Ga0068862_1000013182 | 171 |
| 243 | 3300005844 | Ga0068862_100440943 | Ga0068862_1004409431 | 171 |
| 244 | 3300006058 | Ga0075432_10327226 | Ga0075432_103272261 | 171 |
| 245 | 3300006163 | Ga0070715_10257871 | Ga0070715_102578712 | 171 |
| 246 | 3300006237 | Ga0097621_100101640 | Ga0097621_1001016401 | 171 |
| 247 | 3300006237 | Ga0097621_100128952 | Ga0097621_1001289522 | 171 |
| 248 | 3300006237 | Ga0097621_100140375 | Ga0097621_1001403753 | 171 |
| 249 | 3300006237 | Ga0097621_100222343 | Ga0097621_1002223431 | 171 |
| 250 | 3300006237 | Ga0097621_101801471 | Ga0097621_1018014711 | 171 |
| 251 | 3300006358 | Ga0068871_100081480 | Ga0068871_1000814802 | 171 |
| 252 | 3300006358 | Ga0068871_100314543 | Ga0068871_1003145433 | 171 |
| 253 | 3300006358 | Ga0068871_100445087 | Ga0068871_1004450871 | 171 |
| 254 | 3300006358 | Ga0068871_100973119 | Ga0068871_1009731191 | 171 |
| 255 | 3300006358 | Ga0068871_101393545 | Ga0068871_1013935451 | 171 |
| 256 | 3300006846 | Ga0075430_100146025 | Ga0075430_1001460252 | 171 |
| 257 | 3300006847 | Ga0075431_100874420 | Ga0075431_1008744202 | 171 |
| 258 | 3300006852 | Ga0075433_10004312 | Ga0075433_100043121 | 171 |
| 259 | 3300006871 | Ga0075434_100007944 | Ga0075434_1000079445 | 171 |
| 260 | 3300006880 | Ga0075429_100053142 | Ga0075429_1000531423 | 171 |
| 261 | 3300006881 | Ga0068865_100092377 | Ga0068865_1000923771 | 171 |
| 262 | 3300006881 | Ga0068865_100180649 | Ga0068865_1001806492 | 171 |
| 263 | 3300006931 | Ga0097620_100049195 | Ga0097620_1000491954 | 171 |
| 264 | 3300006931 | Ga0097620_100270670 | Ga0097620_1002706702 | 171 |
| 265 | 3300006931 | Ga0097620_100433730 | Ga0097620_1004337302 | 171 |
| 266 | 3300006931 | Ga0097620_101248310 | Ga0097620_1012483102 | 171 |
| 267 | 3300007076 | Ga0075435_100061515 | Ga0075435_1000615154 | 171 |
| 268 | 3300009093 | Ga0105240_10008912 | Ga0105240_100089129 | 171 |
| 269 | 3300009093 | Ga0105240_10052766 | Ga0105240_100527664 | 171 |
| 270 | 3300009093 | Ga0105240_10143930 | Ga0105240_101439303 | 171 |
| 271 | 3300009093 | Ga0105240_10355282 | Ga0105240_103552822 | 171 |
| 272 | 3300009094 | Ga0111539_10009213 | Ga0111539_1000921312 | 171 |
| 273 | 3300009094 | Ga0111539_10494485 | Ga0111539_104944852 | 171 |
| 274 | 3300009098 | Ga0105245_10011107 | Ga0105245_100111073 | 171 |
| 275 | 3300009098 | Ga0105245_10022023 | Ga0105245_100220232 | 171 |
| 276 | 3300009098 | Ga0105245_10171413 | Ga0105245_101714133 | 171 |
| 277 | 3300009098 | Ga0105245_11108302 | Ga0105245_111083021 | 171 |
| 278 | 3300009098 | Ga0105245_12016510 | Ga0105245_120165101 | 171 |
| 279 | 3300009174 | Ga0105241_10023381 | Ga0105241_100233814 | 171 |
| 280 | 3300009174 | Ga0105241_10034007 | Ga0105241_100340075 | 171 |
| 281 | 3300009174 | Ga0105241_10065179 | Ga0105241_100651793 | 171 |
| 282 | 3300009176 | Ga0105242_10031057 | Ga0105242_100310573 | 171 |
| 283 | 3300009176 | Ga0105242_10035503 | Ga0105242_100355034 | 171 |
| 284 | 3300009176 | Ga0105242_10256125 | Ga0105242_102561251 | 171 |
| 285 | 3300009177 | Ga0105248_10002427 | Ga0105248_100024272 | 171 |
| 286 | 3300009177 | Ga0105248_10015004 | Ga0105248_100150044 | 171 |
| 287 | 3300009177 | Ga0105248_10019966 | Ga0105248_100199665 | 171 |
| 288 | 3300009177 | Ga0105248_10068096 | Ga0105248_100680963 | 171 |
| 289 | 3300009545 | Ga0105237_10001317 | Ga0105237_1000131714 | 171 |
| 290 | 3300009545 | Ga0105237_10024993 | Ga0105237_100249932 | 171 |
| 291 | 3300009545 | Ga0105237_10374186 | Ga0105237_103741862 | 171 |
| 292 | 3300009545 | Ga0105237_11450651 | Ga0105237_114506511 | 171 |
| 293 | 3300009551 | Ga0105238_10008673 | Ga0105238_100086735 | 171 |
| 294 | 3300009551 | Ga0105238_10052385 | Ga0105238_100523855 | 171 |
| 295 | 3300009551 | Ga0105238_10104379 | Ga0105238_101043792 | 171 |
| 296 | 3300009553 | Ga0105249_10013555 | Ga0105249_100135556 | 171 |
| 297 | 3300010375 | Ga0105239_10003048 | Ga0105239_1000304816 | 171 |
| 298 | 3300010375 | Ga0105239_10042185 | Ga0105239_100421852 | 171 |
| 299 | 3300010375 | Ga0105239_10053806 | Ga0105239_100538065 | 171 |
| 300 | 3300010375 | Ga0105239_10226984 | Ga0105239_102269842 | 171 |
| 301 | 3300011119 | Ga0105246_10003902 | Ga0105246_1000390210 | 171 |
| 302 | 3300013104 | Ga0157370_10028274 | Ga0157370_100282743 | 171 |
| 303 | 3300013104 | Ga0157370_10070296 | Ga0157370_100702963 | 171 |
| 304 | 3300013105 | Ga0157369_10002275 | Ga0157369_100022756 | 171 |
| 305 | 3300013105 | Ga0157369_10002738 | Ga0157369_1000273814 | 171 |
| 306 | 3300013105 | Ga0157369_10508078 | Ga0157369_105080782 | 171 |
| 307 | 3300013296 | Ga0157374_10148513 | Ga0157374_101485132 | 171 |
| 308 | 3300013296 | Ga0157374_10541776 | Ga0157374_105417762 | 171 |
| 309 | 3300013296 | Ga0157374_11718928 | Ga0157374_117189281 | 171 |
| 310 | 3300013297 | Ga0157378_10328613 | Ga0157378_103286132 | 171 |
| 311 | 3300013306 | Ga0163162_10081630 | Ga0163162_100816303 | 171 |
| 312 | 3300013306 | Ga0163162_10359235 | Ga0163162_103592352 | 171 |
| 313 | 3300013306 | Ga0163162_11770542 | Ga0163162_117705421 | 171 |
| 314 | 3300013307 | Ga0157372_10019605 | Ga0157372_100196053 | 171 |
| 315 | 3300013307 | Ga0157372_10037835 | Ga0157372_100378352 | 171 |
| 316 | 3300013307 | Ga0157372_10072918 | Ga0157372_100729185 | 171 |
| 317 | 3300013308 | Ga0157375_10008895 | Ga0157375_100088954 | 171 |
| 318 | 3300013308 | Ga0157375_10148700 | Ga0157375_101487001 | 171 |
| 319 | 3300013308 | Ga0157375_10233136 | Ga0157375_102331363 | 171 |
| 320 | 3300013308 | Ga0157375_10430976 | Ga0157375_104309761 | 171 |
| 321 | 3300013308 | Ga0157375_10471476 | Ga0157375_104714762 | 171 |
| 322 | 3300013308 | Ga0157375_10917120 | Ga0157375_109171202 | 171 |
| 323 | 3300014325 | Ga0163163_10132012 | Ga0163163_101320123 | 171 |
| 324 | 3300014326 | Ga0157380_10037008 | Ga0157380_100370082 | 171 |
| 325 | 3300014326 | Ga0157380_11405975 | Ga0157380_114059751 | 171 |
| 326 | 3300014745 | Ga0157377_10013748 | Ga0157377_100137483 | 171 |
| 327 | 3300014745 | Ga0157377_10502560 | Ga0157377_105025602 | 171 |
| 328 | 3300014968 | Ga0157379_10003010 | Ga0157379_1000301011 | 171 |
| 329 | 3300014968 | Ga0157379_10124281 | Ga0157379_101242813 | 171 |
| 330 | 3300014968 | Ga0157379_10340403 | Ga0157379_103404032 | 171 |
| 331 | 3300014969 | Ga0157376_10059103 | Ga0157376_100591032 | 171 |
| 332 | 3300017792 | Ga0163161_10033476 | Ga0163161_100334764 | 171 |
| 333 | 3300021388 | Ga0213875_10013435 | Ga0213875_100134354 | 171 |
| 334 | 3300025315 | Ga0207697_10012850 | Ga0207697_100128504 | 171 |
| 335 | 3300025315 | Ga0207697_10063443 | Ga0207697_100634432 | 171 |
| 336 | 3300025893 | Ga0207682_10000492 | Ga0207682_100004925 | 171 |
| 337 | 3300025893 | Ga0207682_10025077 | Ga0207682_100250771 | 171 |
| 338 | 3300025901 | Ga0207688_10000727 | Ga0207688_1000072712 | 171 |
| 339 | 3300025901 | Ga0207688_10075107 | Ga0207688_100751073 | 171 |
| 340 | 3300025904 | Ga0207647_10074245 | Ga0207647_100742451 | 171 |
| 341 | 3300025907 | Ga0207645_10002485 | Ga0207645_1000248513 | 171 |
| 342 | 3300025908 | Ga0207643_10001159 | Ga0207643_1000115912 | 171 |
| 343 | 3300025908 | Ga0207643_10053992 | Ga0207643_100539922 | 171 |
| 344 | 3300025909 | Ga0207705_10258666 | Ga0207705_102586662 | 171 |
| 345 | 3300025911 | Ga0207654_10033389 | Ga0207654_100333894 | 171 |
| 346 | 3300025911 | Ga0207654_10117761 | Ga0207654_101177612 | 171 |
| 347 | 3300025911 | Ga0207654_11063634 | Ga0207654_110636341 | 171 |
| 348 | 3300025912 | Ga0207707_10000761 | Ga0207707_1000076125 | 171 |
| 349 | 3300025913 | Ga0207695_10002495 | Ga0207695_100024956 | 171 |
| 350 | 3300025913 | Ga0207695_10004086 | Ga0207695_1000408612 | 171 |
| 351 | 3300025913 | Ga0207695_10102945 | Ga0207695_101029453 | 171 |
| 352 | 3300025913 | Ga0207695_10159457 | Ga0207695_101594573 | 171 |
| 353 | 3300025914 | Ga0207671_10494273 | Ga0207671_104942731 | 171 |
| 354 | 3300025916 | Ga0207663_10049978 | Ga0207663_100499782 | 171 |
| 355 | 3300025917 | Ga0207660_10131885 | Ga0207660_101318851 | 171 |
| 356 | 3300025918 | Ga0207662_10068160 | Ga0207662_100681602 | 171 |
| 357 | 3300025919 | Ga0207657_10100390 | Ga0207657_101003902 | 171 |
| 358 | 3300025919 | Ga0207657_10452936 | Ga0207657_104529362 | 171 |
| 359 | 3300025920 | Ga0207649_10148675 | Ga0207649_101486752 | 171 |
| 360 | 3300025920 | Ga0207649_10517591 | Ga0207649_105175911 | 171 |
| 361 | 3300025920 | Ga0207649_11159935 | Ga0207649_111599351 | 171 |
| 362 | 3300025921 | Ga0207652_10001347 | Ga0207652_1000134717 | 171 |
| 363 | 3300025922 | Ga0207646_10767984 | Ga0207646_107679841 | 171 |
| 364 | 3300025923 | Ga0207681_10007135 | Ga0207681_100071352 | 171 |
| 365 | 3300025923 | Ga0207681_10227075 | Ga0207681_102270752 | 171 |
| 366 | 3300025923 | Ga0207681_10334468 | Ga0207681_103344682 | 171 |
| 367 | 3300025923 | Ga0207681_10675451 | Ga0207681_106754512 | 171 |
| 368 | 3300025924 | Ga0207694_10000953 | Ga0207694_1000095317 | 171 |
| 369 | 3300025924 | Ga0207694_10013230 | Ga0207694_100132302 | 171 |
| 370 | 3300025924 | Ga0207694_10155737 | Ga0207694_101557372 | 171 |
| 371 | 3300025925 | Ga0207650_10122169 | Ga0207650_101221691 | 171 |
| 372 | 3300025925 | Ga0207650_11064513 | Ga0207650_110645131 | 171 |
| 373 | 3300025926 | Ga0207659_10405375 | Ga0207659_104053752 | 171 |
| 374 | 3300025926 | Ga0207659_11086842 | Ga0207659_110868422 | 171 |
| 375 | 3300025927 | Ga0207687_10004364 | Ga0207687_100043643 | 171 |
| 376 | 3300025927 | Ga0207687_10027930 | Ga0207687_100279304 | 171 |
| 377 | 3300025927 | Ga0207687_10736054 | Ga0207687_107360542 | 171 |
| 378 | 3300025928 | Ga0207700_10299797 | Ga0207700_102997972 | 171 |
| 379 | 3300025928 | Ga0207700_10682665 | Ga0207700_106826652 | 171 |
| 380 | 3300025931 | Ga0207644_10502800 | Ga0207644_105028001 | 171 |
| 381 | 3300025933 | Ga0207706_10023960 | Ga0207706_100239604 | 171 |
| 382 | 3300025933 | Ga0207706_10115626 | Ga0207706_101156263 | 171 |
| 383 | 3300025933 | Ga0207706_10283334 | Ga0207706_102833341 | 171 |
| 384 | 3300025934 | Ga0207686_10009467 | Ga0207686_100094673 | 171 |
| 385 | 3300025935 | Ga0207709_10210587 | Ga0207709_102105873 | 171 |
| 386 | 3300025936 | Ga0207670_10092503 | Ga0207670_100925032 | 171 |
| 387 | 3300025938 | Ga0207704_10164923 | Ga0207704_101649232 | 171 |
| 388 | 3300025940 | Ga0207691_10006460 | Ga0207691_1000646011 | 171 |
| 389 | 3300025940 | Ga0207691_10040401 | Ga0207691_100404013 | 171 |
| 390 | 3300025941 | Ga0207711_10006203 | Ga0207711_100062033 | 171 |
| 391 | 3300025941 | Ga0207711_10006402 | Ga0207711_100064025 | 171 |
| 392 | 3300025941 | Ga0207711_10064739 | Ga0207711_100647393 | 171 |
| 393 | 3300025941 | Ga0207711_11621991 | Ga0207711_116219911 | 171 |
| 394 | 3300025941 | Ga0207711_11726501 | Ga0207711_117265011 | 171 |
| 395 | 3300025942 | Ga0207689_10001107 | Ga0207689_1000110723 | 171 |
| 396 | 3300025942 | Ga0207689_10348386 | Ga0207689_103483862 | 171 |
| 397 | 3300025944 | Ga0207661_10129499 | Ga0207661_101294992 | 171 |
| 398 | 3300025944 | Ga0207661_10143682 | Ga0207661_101436823 | 171 |
| 399 | 3300025944 | Ga0207661_11224887 | Ga0207661_112248872 | 171 |
| 400 | 3300025945 | Ga0207679_10009412 | Ga0207679_100094122 | 171 |
| 401 | 3300025945 | Ga0207679_10623065 | Ga0207679_106230652 | 171 |
| 402 | 3300025949 | Ga0207667_10001913 | Ga0207667_100019133 | 171 |
| 403 | 3300025949 | Ga0207667_10016994 | Ga0207667_100169943 | 171 |
| 404 | 3300025949 | Ga0207667_10018865 | Ga0207667_100188657 | 171 |
| 405 | 3300025960 | Ga0207651_10065694 | Ga0207651_100656941 | 171 |
| 406 | 3300025960 | Ga0207651_10571486 | Ga0207651_105714862 | 171 |
| 407 | 3300025961 | Ga0207712_10049499 | Ga0207712_100494994 | 171 |
| 408 | 3300025972 | Ga0207668_10034287 | Ga0207668_100342872 | 171 |
| 409 | 3300026023 | Ga0207677_10205459 | Ga0207677_102054593 | 171 |
| 410 | 3300026035 | Ga0207703_10197347 | Ga0207703_101973472 | 171 |
| 411 | 3300026035 | Ga0207703_10636286 | Ga0207703_106362861 | 171 |
| 412 | 3300026035 | Ga0207703_11363004 | Ga0207703_113630041 | 171 |
| 413 | 3300026041 | Ga0207639_10006562 | Ga0207639_100065627 | 171 |
| 414 | 3300026041 | Ga0207639_10082096 | Ga0207639_100820962 | 171 |
| 415 | 3300026067 | Ga0207678_10309550 | Ga0207678_103095502 | 171 |
| 416 | 3300026075 | Ga0207708_10032354 | Ga0207708_100323543 | 171 |
| 417 | 3300026078 | Ga0207702_10011734 | Ga0207702_100117345 | 171 |
| 418 | 3300026078 | Ga0207702_10069131 | Ga0207702_100691312 | 171 |
| 419 | 3300026078 | Ga0207702_11602276 | Ga0207702_116022761 | 171 |
| 420 | 3300026088 | Ga0207641_10671291 | Ga0207641_106712911 | 171 |
| 421 | 3300026089 | Ga0207648_10008815 | Ga0207648_100088155 | 171 |
| 422 | 3300026089 | Ga0207648_10241976 | Ga0207648_102419762 | 171 |
| 423 | 3300026116 | Ga0207674_10000682 | Ga0207674_1000068215 | 171 |
| 424 | 3300026116 | Ga0207674_10353086 | Ga0207674_103530863 | 171 |
| 425 | 3300026116 | Ga0207674_10375111 | Ga0207674_103751112 | 171 |
| 426 | 3300026116 | Ga0207674_11075571 | Ga0207674_110755712 | 171 |
| 427 | 3300026118 | Ga0207675_100012882 | Ga0207675_1000128823 | 171 |
| 428 | 3300026118 | Ga0207675_100090401 | Ga0207675_1000904011 | 171 |
| 429 | 3300026118 | Ga0207675_100456484 | Ga0207675_1004564842 | 171 |
| 430 | 3300026121 | Ga0207683_10069132 | Ga0207683_100691322 | 171 |
| 431 | 3300026121 | Ga0207683_10078602 | Ga0207683_100786022 | 171 |
| 432 | 3300026142 | Ga0207698_10008302 | Ga0207698_100083027 | 171 |
| 433 | 3300027717 | Ga0209998_10055246 | Ga0209998_100552462 | 171 |
| 434 | 3300027907 | Ga0207428_10003783 | Ga0207428_100037833 | 171 |
| 435 | 3300028379 | Ga0268266_10015171 | Ga0268266_100151713 | 171 |
| 436 | 3300028380 | Ga0268265_10096287 | Ga0268265_100962873 | 171 |
| 437 | 3300028381 | Ga0268264_10456349 | Ga0268264_104563492 | 171 |
| 438 | 3300028800 | Ga0265338_10196857 | Ga0265338_101968572 | 171 |
| 439 | 3300031238 | Ga0265332_10022601 | Ga0265332_100226012 | 171 |
| 440 | 3300031247 | Ga0265340_10039360 | Ga0265340_100393602 | 171 |
| 441 | 3300031344 | Ga0265316_10129500 | Ga0265316_101295003 | 171 |
| 442 | 3300031711 | Ga0265314_10001232 | Ga0265314_1000123210 | 171 |
| 443 | 3300031711 | Ga0265314_10127373 | Ga0265314_101273732 | 171 |
| 444 | 3300035086 | Ga0373934_0028387 | Ga0373934_0028387_1564_2082 | 171 |
| 445 | 3300035086 | Ga0373934_0193611 | Ga0373934_0193611_173_691 | 171 |
| 446 | 3300035111 | Ga0373923_0283241 | Ga0373923_0283241_231_749 | 171 |
| 447 | 3300035117 | Ga0373953_0136644 | Ga0373953_0136644_438_956 | 171 |
| 448 | 3300035119 | Ga0373956_0047313 | Ga0373956_0047313_1042_1560 | 171 |
| 449 | 3300035120 | Ga0373957_0306447 | Ga0373957_0306447_140_658 | 171 |
| 450 | 3300035172 | Ga0373955_0230902 | Ga0373955_0230902_498_1016 | 171 |
| 451 | 3300035172 | Ga0373955_0234677 | Ga0373955_0234677_104_622 | 171 |
| 452 | 3300035695 | Ga0373927_0172962 | Ga0373927_0172962_578_1102 | 171 |
| 453 | 3300035724 | Ga0373933_0026618 | Ga0373933_0026618_1647_2165 | 171 |
| 454 | 3300035724 | Ga0373933_0036882 | Ga0373933_0036882_2227_2745 | 171 |
| 455 | 3300036401 | Ga0373937_0019522 | Ga0373937_0019522_367_885 | 171 |
| 456 | 3300036401 | Ga0373937_0179754 | Ga0373937_0179754_1262_1780 | 171 |
| 457 | 3300036401 | Ga0373937_0582893 | Ga0373937_0582893_128_646 | 171 |
| 458 | 3300037853 | Ga0436364_0787827 | Ga0436364_0787827_3094_3615 | 171 |
| 459 | 3300039437 | Ga0436365_0522788 | Ga0436365_0522788_517_1038 | 171 |
| 460 | 3300042439 | Ga0439464_0168004 | Ga0439464_0168004_52_570 | 171 |
| 461 | 3300045051 | Ga0451576_0201874 | Ga0451576_0201874_1269_1787 | 171 |
| 462 | 3300046462 | Ga0495651_0169594 | Ga0495651_0169594_807_1325 | 171 |
| 463 | 3300046462 | Ga0495651_0325000 | Ga0495651_0325000_388_906 | 171 |
| 464 | 3300046472 | Ga0495580_0016895 | Ga0495580_0016895_4122_4646 | 171 |
| 465 | 3300046472 | Ga0495580_0045433 | Ga0495580_0045433_1308_1841 | 171 |
| 466 | 3300046472 | Ga0495580_0224980 | Ga0495580_0224980_327_845 | 171 |
| 467 | 3300046473 | Ga0495582_0275556 | Ga0495582_0275556_26_544 | 171 |
| 468 | 3300046511 | Ga0495608_0093545 | Ga0495608_0093545_23_541 | 171 |
| 469 | 3300046529 | Ga0495652_0198666 | Ga0495652_0198666_655_1173 | 171 |
| 470 | 3300046536 | Ga0495587_0001707 | Ga0495587_0001707_3086_3604 | 171 |
| 471 | 3300046536 | Ga0495587_0055334 | Ga0495587_0055334_571_1089 | 171 |
| 472 | 3300046663 | Ga0495635_0277999 | Ga0495635_0277999_224_742 | 171 |
| 473 | 3300046681 | Ga0495647_0119520 | Ga0495647_0119520_425_943 | 171 |
| 474 | 3300047319 | Ga0495674_0184087 | Ga0495674_0184087_417_935 | 171 |
| 475 | 3300047322 | Ga0495680_0208093 | Ga0495680_0208093_41_559 | 171 |
| 476 | 3300048088 | Ga0495602_0120617 | Ga0495602_0120617_807_1325 | 171 |
| 477 | 3300048907 | Ga0496104_0427801 | Ga0496104_0427801_206_724 | 171 |
| 478 | 3300048912 | Ga0496109_0080023 | Ga0496109_0080023_702_1220 | 171 |
| 479 | 3300048917 | Ga0496114_0639038 | Ga0496114_0639038_268_786 | 171 |
| 480 | 3300048918 | Ga0496115_0183658 | Ga0496115_0183658_1146_1664 | 171 |
| 481 | 3300050510 | nmdc:mga06r32_327045_c1 | nmdc:mga06r32_327045_c1_918_1469 | 171 |
| 482 | 3300050511 | nmdc:mga08y16_78588_c1 | nmdc:mga08y16_78588_c1_2901_3419 | 171 |
| 483 | 3300050512 | nmdc:mga0n895_5514_c1 | nmdc:mga0n895_5514_c1_4747_5265 | 171 |
| 484 | 3300050513 | nmdc:mga0rr50_99720_c1 | nmdc:mga0rr50_99720_c1_458_976 | 171 |
| 485 | 3300050515 | nmdc:mga0a205_550_c1 | nmdc:mga0a205_550_c1_18956_19474 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3di5-assembly1.cif.gz_A | crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution | 0.8685 | 31 | 170 |
| 6iz2-assembly1.cif.gz_A | crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 | 0.8515 | 28 | 170 |
| 3gor-assembly2.cif.gz_D | crystal structure of putative metal-dependent hydrolase apc36150 | 0.8398 | 28 | 171 |
| 3dka-assembly1.cif.gz_A | crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution | 0.8212 | 30 | 171 |
| 6iz2-assembly1.cif.gz_A | crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 | 0.82 | 28 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3di5A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.832 | 29 | 170 | 1.20.120.450 |
| 3dkaA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8291 | 30 | 162 | 1.20.120.450 |
| 3dkaA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8116 | 30 | 162 | 1.20.120.450 |
| 3di5A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8061 | 29 | 170 | 1.20.120.450 |
| 2ou6A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7994 | 32 | 162 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A317IVF9-F1-model_v4 | DinB family protein | 0.9817 | 26 | 171 |
|
| AF-A0A162PK14-F1-model_v4 | Damage-inducible protein DinB | 0.9404 | 29 | 171 |
|
| AF-A0A7V4YYR4-F1-model_v4 | Damage-inducible protein DinB | 0.939 | 28 | 171 |
|
| AF-A0A2V8Y6R3-F1-model_v4 | DinB-like domain-containing protein | 0.9388 | 28 | 171 |
|
| AF-A0A2V9AJS9-F1-model_v4 | DinB-like domain-containing protein | 0.9376 | 28 | 171 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar