F453070

General Info

Members Datasets Scaffolds Average Seq Length
485 289 970 220

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_101092862|Ga0068863_1010928621
Length 215
Sequence MPDPDPNDLLARNRAWAARIKSEEPGFFEELARAQSPQYLWIGCADSRVPANEILGLIPGEIFVHRNVANVVVHTDLNCLSVLQFAVDLLKVKHVLVVGHYGCAGVAAALLNRRLGLVDNWLRHIQDIRLKHAVYLEAQPEEKRAERLVELNVIEQVVNVCQTTIVQDAWERGQDLTVHGWTYALQDGLMRDLKMSVVSNTELTRCYQSALENLP

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
227 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
243 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
277 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
278 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
279 2643221645 Massilia sp. Root351 Isolate Unclassified
280 2643221664 Massilia sp. Root418 Isolate Unclassified
281 2738541280 Massilia sp. GV090 Isolate Unclassified
282 2738541300 Massilia sp. GV016 Isolate Unclassified
283 2738543018 Massilia sp. GV045 Isolate Unclassified
284 2738543030 Massilia sp. GV097 Isolate Unclassified
285 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
286 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
287 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
288 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
289 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.46
Metatranscriptomes 1.65
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.74
Nodule 1.03
Rhizoplane 1.86
Rhizosphere 88.04
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_101092862 3300005841 Bacteria 802
2 Ga0006759J45824_1087121 3300003163 Bacteria 898
3 JGI25151J46595_10003398 3300003187 Bacteria 8810
4 JGI25151J46595_10028396 3300003187 Bacteria 2229
5 rootL2_10067533 3300003322 Bacteria 2927
6 Ga0007417J51691_1021079 3300003544 Bacteria 1024
7 Ga0007410J51695_1038954 3300003574 Bacteria 1101
8 Ga0007409J51694_1014616 3300003575 Bacteria 1208
9 Ga0007416J51690_1011811 3300003577 Bacteria 1460
10 Ga0007411J51799_111718 3300003611 Bacteria 802
11 Ga0032354_1010298 3300003693 Bacteria 1213
12 Ga0055537_1003050 3300003773 Bacteria 5286
13 Ga0055524_1000629 3300003775 Bacteria 25247
14 Ga0055536_1000324 3300003781 Bacteria 35248
15 Ga0055534_1001753 3300003784 Bacteria 8178
16 JGI25405J52794_10049490 3300003911 Bacteria 899
17 Ga0065712_10280249 3300005290 Bacteria 897
18 Ga0065715_10242516 3300005293 Bacteria 1194
19 Ga0070658_10001403 3300005327 Bacteria 20571
20 Ga0070676_10471038 3300005328 Bacteria 887
21 Ga0070683_100066700 3300005329 Bacteria 3353
22 Ga0070670_100013450 3300005331 Bacteria 7010
23 Ga0070677_10025556 3300005333 Bacteria 2205
24 Ga0068869_100089543 3300005334 Bacteria 2311
25 Ga0070666_10055423 3300005335 Bacteria 2676
26 Ga0070682_100007448 3300005337 Bacteria 6172
27 Ga0070682_100019929 3300005337 Bacteria 3940
28 Ga0070682_100178434 3300005337 Bacteria 1481
29 Ga0070689_100003825 3300005340 Bacteria 10084
30 Ga0070661_100010090 3300005344 Bacteria 6558
31 Ga0070668_100363050 3300005347 Bacteria 1228
32 Ga0070668_101124958 3300005347 Bacteria 709
33 Ga0070669_100000846 3300005353 Bacteria 22205
34 Ga0070669_100151503 3300005353 Bacteria 1795
35 Ga0070669_100221547 3300005353 Bacteria 1496
36 Ga0070669_100684168 3300005353 Bacteria 865
37 Ga0070675_100128540 3300005354 Bacteria 2157
38 Ga0070675_100140166 3300005354 Bacteria 2066
39 Ga0070675_100603425 3300005354 Bacteria 996
40 Ga0070671_100003846 3300005355 Bacteria 11797
41 Ga0070674_100009526 3300005356 Bacteria 5817
42 Ga0070674_100061009 3300005356 Bacteria 2630
43 Ga0070674_100115224 3300005356 Bacteria 1981
44 Ga0070673_100271358 3300005364 Bacteria 1485
45 Ga0070673_100351244 3300005364 Bacteria 1309
46 Ga0070688_100371500 3300005365 Bacteria 1052
47 Ga0070659_100218878 3300005366 Bacteria 1571
48 Ga0070667_100039333 3300005367 Bacteria 3963
49 Ga0070667_100495394 3300005367 Bacteria 1120
50 Ga0070709_10536761 3300005434 Bacteria 893
51 Ga0070714_100463764 3300005435 Bacteria 1205
52 Ga0070705_100021935 3300005440 Bacteria 3404
53 Ga0070700_100248436 3300005441 Bacteria 1275
54 Ga0070694_100120594 3300005444 Bacteria 1881
55 Ga0070663_100202372 3300005455 Bacteria 1550
56 Ga0070663_100385317 3300005455 Bacteria 1143
57 Ga0070678_100039466 3300005456 Bacteria 3331
58 Ga0070678_100053036 3300005456 Bacteria 2947
59 Ga0070678_100395552 3300005456 Bacteria 1199
60 Ga0070662_100339887 3300005457 Bacteria 1228
61 Ga0070662_100343334 3300005457 Bacteria 1222
62 Ga0070662_100751038 3300005457 Bacteria 827
63 Ga0068867_100032821 3300005459 Bacteria 3756
64 Ga0068867_100089988 3300005459 Bacteria 2328
65 Ga0068867_100129812 3300005459 Bacteria 1957
66 Ga0070684_100639655 3300005535 Bacteria 990
67 Ga0068853_100300343 3300005539 Bacteria 1484
68 Ga0070672_100010864 3300005543 Bacteria 6332
69 Ga0070672_100160410 3300005543 Bacteria 1865
70 Ga0070672_100524526 3300005543 Bacteria 1026
71 Ga0070686_100141416 3300005544 Bacteria 1676
72 Ga0070695_100131378 3300005545 Bacteria 1726
73 Ga0070695_100372092 3300005545 Bacteria 1076
74 Ga0070693_100252218 3300005547 Bacteria 1170
75 Ga0070665_100007562 3300005548 Bacteria 11045
76 Ga0070665_100031299 3300005548 Bacteria 5355
77 Ga0070665_100182760 3300005548 Bacteria 2097
78 Ga0070665_100306347 3300005548 Bacteria 1592
79 Ga0070665_100425269 3300005548 Bacteria 1337
80 Ga0070665_100545975 3300005548 Bacteria 1171
81 Ga0070664_100007750 3300005564 Bacteria 8669
82 Ga0070664_100107464 3300005564 Bacteria 2433
83 Ga0070664_100251308 3300005564 Bacteria 1589
84 Ga0068857_100309528 3300005577 Bacteria 1457
85 Ga0068854_100393277 3300005578 Bacteria 1145
86 Ga0068852_100023289 3300005616 Bacteria 4982
87 Ga0068852_100673774 3300005616 Bacteria 1043
88 Ga0068859_100018585 3300005617 Bacteria 6988
89 Ga0068859_100063637 3300005617 Bacteria 3720
90 Ga0068859_100185140 3300005617 Bacteria 2166
91 Ga0068859_100809875 3300005617 Bacteria 1024
92 Ga0068864_100090085 3300005618 Bacteria 2704
93 Ga0068864_100459358 3300005618 Bacteria 1219
94 Ga0068861_100003428 3300005719 Bacteria 10524
95 Ga0068861_100028203 3300005719 Bacteria 4096
96 Ga0068861_100077136 3300005719 Bacteria 2598
97 Ga0068861_100154437 3300005719 Bacteria 1886
98 Ga0068861_100459566 3300005719 Bacteria 1142
99 Ga0068861_100742697 3300005719 Bacteria 916
100 Ga0068851_10016592 3300005834 Bacteria 3526
101 Ga0068863_100449569 3300005841 Bacteria 1264
102 Ga0068858_100063412 3300005842 Bacteria 3420
103 Ga0068860_101059722 3300005843 Bacteria 829
104 Ga0068862_100041341 3300005844 Bacteria 3921
105 Ga0068862_100116490 3300005844 Bacteria 2350
106 Ga0068862_100216066 3300005844 Bacteria 1734
107 Ga0068862_100267076 3300005844 Unclassified 1564
108 Ga0081455_10004105 3300005937 Bacteria 16479
109 Ga0070712_100009789 3300006175 Bacteria 6039
110 Ga0097621_100041214 3300006237 Bacteria 3716
111 Ga0097621_100098034 3300006237 Bacteria 2462
112 Ga0097621_100129672 3300006237 Bacteria 2145
113 Ga0068871_100115148 3300006358 Bacteria 2266
114 Ga0068871_100125803 3300006358 Bacteria 2169
115 Ga0068871_100235313 3300006358 Bacteria 1591
116 Ga0068871_100408909 3300006358 Bacteria 1210
117 Ga0068871_100545482 3300006358 Bacteria 1050
118 Ga0075428_100317960 3300006844 Bacteria 1673
119 Ga0075428_100679995 3300006844 Bacteria 1097
120 Ga0075430_100082854 3300006846 Unclassified 2688
121 Ga0075430_100412350 3300006846 Bacteria 1115
122 Ga0075431_100200842 3300006847 Bacteria 2040
123 Ga0068865_100117522 3300006881 Bacteria 1971
124 Ga0068865_100370581 3300006881 Bacteria 1165
125 Ga0068865_100873162 3300006881 Bacteria 781
126 Ga0097620_100018585 3300006931 Bacteria 6988
127 Ga0097620_100063637 3300006931 Bacteria 3720
128 Ga0097620_100185132 3300006931 Bacteria 2166
129 Ga0097620_100809774 3300006931 Bacteria 1024
130 Ga0099826_10000007 3300006948 Bacteria 393518
131 Ga0105251_10030584 3300009011 Bacteria 2702
132 Ga0111539_10251426 3300009094 Bacteria 2058
133 Ga0105245_10161711 3300009098 Bacteria 2125
134 Ga0105247_10477165 3300009101 Unclassified 904
135 Ga0114129_11445614 3300009147 Bacteria 847
136 Ga0105243_10041073 3300009148 Bacteria 3617
137 Ga0105243_10525084 3300009148 Bacteria 1126
138 Ga0105242_10060214 3300009176 Bacteria 3118
139 Ga0105248_10251911 3300009177 Bacteria 1987
140 Ga0105248_10748404 3300009177 Bacteria 1103
141 Ga0105248_11098741 3300009177 Bacteria 899
142 Ga0105237_10006330 3300009545 Bacteria 13156
143 Ga0105237_10242854 3300009545 Bacteria 1802
144 Ga0105238_10459045 3300009551 Bacteria 1271
145 Ga0105249_10593450 3300009553 Bacteria 1162
146 Ga0105249_10779368 3300009553 Bacteria 1019
147 Ga0105239_10094466 3300010375 Bacteria 3303
148 Ga0157369_10446181 3300013105 Bacteria 1340
149 Ga0157374_10128725 3300013296 Bacteria 2449
150 Ga0157374_10193293 3300013296 Bacteria 1990
151 Ga0157374_10732385 3300013296 Bacteria 1003
152 Ga0157378_10315068 3300013297 Bacteria 1518
153 Ga0163162_10611216 3300013306 Bacteria 1216
154 Ga0157372_10236499 3300013307 Bacteria 2119
155 Ga0157375_10011098 3300013308 Bacteria 7944
156 Ga0157375_10061692 3300013308 Bacteria 3723
157 Ga0157375_10073615 3300013308 Bacteria 3436
158 Ga0157375_10161396 3300013308 Bacteria 2383
159 Ga0157375_10278146 3300013308 Bacteria 1837
160 Ga0157375_10647674 3300013308 Bacteria 1213
161 Ga0163163_10091864 3300014325 Bacteria 3050
162 Ga0163163_11272761 3300014325 Bacteria 798
163 Ga0157380_10119502 3300014326 Bacteria 2229
164 Ga0157380_10174113 3300014326 Bacteria 1884
165 Ga0157380_10334069 3300014326 Bacteria 1410
166 Ga0157376_10112504 3300014969 Bacteria 2399
167 Ga0157376_10147153 3300014969 Bacteria 2120
168 Ga0182007_10040408 3300015262 Bacteria 1558
169 Ga0163161_10164163 3300017792 Bacteria 1695
170 Ga0213872_10000063 3300021361 Bacteria 97755
171 Ga0209565_1000106 3300025263 Bacteria 122574
172 Ga0209565_1009493 3300025263 Bacteria 2466
173 Ga0209675_1000168 3300025291 Bacteria 79360
174 Ga0209675_1001444 3300025291 Bacteria 13729
175 Ga0209675_1017926 3300025291 Bacteria 2000
176 Ga0209676_1000036 3300025292 Bacteria 457623
177 Ga0209025_1000462 3300025294 Bacteria 79379
178 Ga0209025_1001905 3300025294 Bacteria 24311
179 Ga0209025_1002261 3300025294 Bacteria 21104
180 Ga0209564_1000573 3300025295 Bacteria 58351
181 Ga0209564_1000957 3300025295 Bacteria 36712
182 Ga0209564_1001001 3300025295 Bacteria 35190
183 Ga0209758_1033047 3300025297 Bacteria 2086
184 Ga0209256_1000220 3300025299 Bacteria 106021
185 Ga0209256_1000554 3300025299 Bacteria 53681
186 Ga0209051_1017060 3300025303 Bacteria 3257
187 Ga0209051_1018808 3300025303 Bacteria 3041
188 Ga0207682_10002327 3300025893 Bacteria 8564
189 Ga0207682_10137094 3300025893 Bacteria 1096
190 Ga0207710_10309172 3300025900 Bacteria 800
191 Ga0207680_10007444 3300025903 Bacteria 5337
192 Ga0207699_10466428 3300025906 Bacteria 908
193 Ga0207643_10074191 3300025908 Bacteria 1962
194 Ga0207705_10021526 3300025909 Bacteria 4602
195 Ga0207671_10009133 3300025914 Bacteria 8322
196 Ga0207671_10208138 3300025914 Bacteria 1529
197 Ga0207693_10021314 3300025915 Bacteria 5150
198 Ga0207662_10103113 3300025918 Bacteria 1770
199 Ga0207657_10016101 3300025919 Bacteria 7218
200 Ga0207657_10722079 3300025919 Bacteria 773
201 Ga0207681_10095140 3300025923 Bacteria 2136
202 Ga0207681_10539010 3300025923 Bacteria 959
203 Ga0207650_10008345 3300025925 Bacteria 7072
204 Ga0207650_10028981 3300025925 Bacteria 3975
205 Ga0207650_10081203 3300025925 Bacteria 2459
206 Ga0207650_10258106 3300025925 Bacteria 1413
207 Ga0207650_10317100 3300025925 Bacteria 1276
208 Ga0207650_10783368 3300025925 Bacteria 808
209 Ga0207659_10119129 3300025926 Bacteria 2020
210 Ga0207659_10332780 3300025926 Bacteria 1256
211 Ga0207687_10201388 3300025927 Bacteria 1556
212 Ga0207687_10679387 3300025927 Bacteria 873
213 Ga0207644_10719709 3300025931 Bacteria 833
214 Ga0207690_10077321 3300025932 Bacteria 2313
215 Ga0207706_10096145 3300025933 Bacteria 2605
216 Ga0207706_10382389 3300025933 Bacteria 1221
217 Ga0207706_10546935 3300025933 Bacteria 997
218 Ga0207709_10198992 3300025935 Bacteria 1429
219 Ga0207709_10614358 3300025935 Unclassified 862
220 Ga0207670_10014583 3300025936 Bacteria 4671
221 Ga0207670_10033116 3300025936 Bacteria 3328
222 Ga0207669_10038557 3300025937 Bacteria 2752
223 Ga0207704_10134107 3300025938 Bacteria 1720
224 Ga0207704_10146611 3300025938 Bacteria 1659
225 Ga0207704_10387943 3300025938 Bacteria 1098
226 Ga0207691_10059721 3300025940 Bacteria 3466
227 Ga0207691_10411617 3300025940 Bacteria 1153
228 Ga0207711_10082662 3300025941 Bacteria 2808
229 Ga0207689_10034670 3300025942 Bacteria 4191
230 Ga0207661_10108798 3300025944 Bacteria 2341
231 Ga0207679_10108351 3300025945 Bacteria 2187
232 Ga0207679_10153480 3300025945 Bacteria 1877
233 Ga0207651_10218837 3300025960 Bacteria 1538
234 Ga0207651_10897624 3300025960 Bacteria 789
235 Ga0207712_10359877 3300025961 Bacteria 1212
236 Ga0207640_10282723 3300025981 Bacteria 1304
237 Ga0207640_10401053 3300025981 Bacteria 1117
238 Ga0207658_10027850 3300025986 Bacteria 3975
239 Ga0207703_10059131 3300026035 Bacteria 3131
240 Ga0207703_10071748 3300026035 Bacteria 2861
241 Ga0207703_10253922 3300026035 Bacteria 1586
242 Ga0207678_10198641 3300026067 Bacteria 1714
243 Ga0207678_10293104 3300026067 Bacteria 1398
244 Ga0207708_10102696 3300026075 Bacteria 2214
245 Ga0207708_10165706 3300026075 Bacteria 1747
246 Ga0207708_10189126 3300026075 Bacteria 1638
247 Ga0207708_10477560 3300026075 Bacteria 1042
248 Ga0207702_10229947 3300026078 Bacteria 1732
249 Ga0207641_10052285 3300026088 Bacteria 3459
250 Ga0207641_10080854 3300026088 Bacteria 2820
251 Ga0207641_10553201 3300026088 Bacteria 1122
252 Ga0207648_10034642 3300026089 Bacteria 4450
253 Ga0207648_10071550 3300026089 Bacteria 3022
254 Ga0207648_10548768 3300026089 Bacteria 1061
255 Ga0207676_10058089 3300026095 Bacteria 3050
256 Ga0207676_10793297 3300026095 Bacteria 924
257 Ga0207674_10606203 3300026116 Bacteria 1058
258 Ga0207675_100005763 3300026118 Bacteria 11848
259 Ga0207675_100130609 3300026118 Bacteria 2382
260 Ga0207675_100194476 3300026118 Bacteria 1947
261 Ga0207675_100658658 3300026118 Bacteria 1054
262 Ga0207683_10459393 3300026121 Bacteria 1174
263 Ga0209282_1000061 3300027666 Bacteria 96444
264 Ga0268266_10024376 3300028379 Bacteria 5145
265 Ga0268266_10159486 3300028379 Bacteria 2040
266 Ga0268265_10028239 3300028380 Bacteria 4015
267 Ga0268265_10296454 3300028380 Unclassified 1454
268 Ga0268265_10391009 3300028380 Bacteria 1282
269 Ga0268264_10124100 3300028381 Bacteria 2280
270 Ga0268264_10454475 3300028381 Bacteria 1242
271 Ga0265328_10111453 3300031239 Bacteria 1017
272 Ga0265320_10088526 3300031240 Bacteria 1436
273 Ga0307513_10110864 3300031456 Bacteria 2738
274 Ga0307513_10470176 3300031456 Bacteria 979
275 Ga0307408_100050296 3300031548 Bacteria 2997
276 Ga0265314_10046650 3300031711 Bacteria 3055
277 Ga0307405_10339946 3300031731 Bacteria 1154
278 Ga0307406_10007898 3300031901 Bacteria 5925
279 Ga0307407_10182544 3300031903 Bacteria 1392
280 Ga0307409_100021207 3300031995 Bacteria 4449
281 Ga0307409_100214491 3300031995 Bacteria 1733
282 Ga0307416_100021110 3300032002 Bacteria 4667
283 Ga0307416_101047861 3300032002 Bacteria 919
284 Ga0307411_10005352 3300032005 Bacteria 6291
285 Ga0307415_100554058 3300032126 Bacteria 1015
286 Ga0316593_10048206 3300032168 Unclassified 1434
287 Ga0373932_0101597 3300035112 Bacteria 936
288 Ga0373943_0320058 3300035170 Bacteria 884
289 Ga0373955_0316235 3300035172 Bacteria 943
290 Ga0373931_0095698 3300035691 Bacteria 1662
291 Ga0373931_0156886 3300035691 Bacteria 1331
292 Ga0373933_0161078 3300035724 Bacteria 1425
293 Ga0373937_0118525 3300036401 Bacteria 2466
294 Ga0373925_0009800 3300037068 Bacteria 6956
295 Ga0373925_0746021 3300037068 Bacteria 807
296 Ga0395899_0003696 3300037312 Bacteria 12107
297 Ga0395899_0020212 3300037312 Bacteria 5052
298 Ga0395900_0001354 3300037418 Bacteria 29502
299 Ga0395900_0159549 3300037418 Bacteria 2301
300 Ga0395900_0711261 3300037418 Bacteria 937
301 Ga0395898_0008292 3300037466 Bacteria 10987
302 Ga0395898_0015300 3300037466 Bacteria 7874
303 Ga0395898_0036893 3300037466 Bacteria 4851
304 Ga0395905_0000137 3300037471 Bacteria 120800
305 Ga0395905_0209465 3300037471 Bacteria 1826
306 Ga0395905_0487015 3300037471 Bacteria 1133
307 Ga0395905_0803130 3300037471 Bacteria 844
308 Ga0395901_0006191 3300038443 Bacteria 12125
309 Ga0395901_0172986 3300038443 Bacteria 2266
310 Ga0436361_0655175 3300039447 Bacteria 3151
311 Ga0436361_0811061 3300039447 Bacteria 135576
312 Ga0451841_0114343 3300041498 Bacteria 1016
313 Ga0451853_1268857 3300041512 Bacteria 1640
314 Ga0439444_0027466 3300042437 Bacteria 1048
315 Ga0466972_0000029 3300044658 Bacteria 165236
316 Ga0453683_0204860 3300044673 Bacteria 1253
317 Ga0466966_0011936 3300044684 Bacteria 5758
318 Ga0466964_0003634 3300044706 Bacteria 5637
319 Ga0453684_0000014 3300044712 Bacteria 993311
320 Ga0453684_0000682 3300044712 Bacteria 121090
321 Ga0453684_0000975 3300044712 Bacteria 94109
322 Ga0453684_0005513 3300044712 Bacteria 24982
323 Ga0453684_1113468 3300044712 Bacteria 833
324 Ga0466959_0080505 3300045049 Bacteria 2348
325 Ga0466959_0495206 3300045049 Bacteria 826
326 Ga0495617_037474 3300046452 Bacteria 1623
327 Ga0495617_096273 3300046452 Bacteria 963
328 Ga0495590_0039794 3300046457 Bacteria 1640
329 Ga0495638_0004277 3300046460 Bacteria 10843
330 Ga0495638_0028011 3300046460 Bacteria 3642
331 Ga0495638_0045273 3300046460 Bacteria 2768
332 Ga0495650_0000519 3300046471 Bacteria 57139
333 Ga0495650_0008211 3300046471 Bacteria 6133
334 Ga0495605_0001123 3300046474 Bacteria 17811
335 Ga0495605_0002642 3300046474 Bacteria 10980
336 Ga0495584_0002965 3300046491 Bacteria 9434
337 Ga0495584_0077713 3300046491 Bacteria 1669
338 Ga0495585_0014959 3300046492 Bacteria 4512
339 Ga0495585_0095971 3300046492 Bacteria 1591
340 Ga0495585_0130420 3300046492 Bacteria 1323
341 Ga0495596_0000577 3300046500 Bacteria 22883
342 Ga0495607_0044134 3300046501 Bacteria 2630
343 Ga0495607_0058357 3300046501 Bacteria 2206
344 Ga0495607_0098771 3300046501 Bacteria 1567
345 Ga0495583_0000004 3300046506 Bacteria 655287
346 Ga0495606_0006173 3300046507 Bacteria 11151
347 Ga0495606_0010926 3300046507 Bacteria 7469
348 Ga0495610_0005593 3300046512 Bacteria 8872
349 Ga0495610_0030322 3300046512 Bacteria 2836
350 Ga0495616_0001603 3300046513 Bacteria 15497
351 Ga0495616_0004162 3300046513 Bacteria 9168
352 Ga0495616_0005090 3300046513 Bacteria 8174
353 Ga0495616_0061734 3300046513 Bacteria 1837
354 Ga0495628_0585146 3300046516 Bacteria 798
355 Ga0495632_0018045 3300046519 Bacteria 3880
356 Ga0495644_0002672 3300046523 Bacteria 7092
357 Ga0495644_0003781 3300046523 Bacteria 5960
358 Ga0495648_0003940 3300046524 Bacteria 12854
359 Ga0495654_0099858 3300046530 Bacteria 1337
360 Ga0495586_0180774 3300046535 Bacteria 1193
361 Ga0495609_0002923 3300046538 Bacteria 10163
362 Ga0495609_0005238 3300046538 Bacteria 6898
363 Ga0495609_0008840 3300046538 Bacteria 4902
364 Ga0495609_0014916 3300046538 Bacteria 3645
365 Ga0495597_0011477 3300046542 Bacteria 4295
366 Ga0495597_0069577 3300046542 Bacteria 1518
367 Ga0495622_0000053 3300046557 Bacteria 102938
368 Ga0495622_0020711 3300046557 Bacteria 3062
369 Ga0495633_0004349 3300046558 Bacteria 9045
370 Ga0495633_0023113 3300046558 Bacteria 3081
371 Ga0495656_0085731 3300046615 Bacteria 1431
372 Ga0495668_0105047 3300046616 Bacteria 1545
373 Ga0495668_0148837 3300046616 Bacteria 1282
374 Ga0495611_0043100 3300046648 Bacteria 2016
375 Ga0495625_0007453 3300046660 Bacteria 9517
376 Ga0495625_0012345 3300046660 Bacteria 6926
377 Ga0495625_0031163 3300046660 Bacteria 3969
378 Ga0495625_0274781 3300046660 Bacteria 1086
379 Ga0495625_0303237 3300046660 Bacteria 1021
380 Ga0495659_0000118 3300046664 Bacteria 34962
381 Ga0495659_0003772 3300046664 Bacteria 4815
382 Ga0495661_0019790 3300046665 Bacteria 4405
383 Ga0495661_0054448 3300046665 Bacteria 2402
384 Ga0495658_0256204 3300046683 Bacteria 1101
385 Ga0495669_0249322 3300046684 Bacteria 853
386 Ga0495670_0003657 3300046691 Bacteria 7558
387 Ga0495670_0003990 3300046691 Bacteria 7240
388 Ga0495671_0001545 3300046692 Bacteria 15327
389 Ga0495671_0006506 3300046692 Bacteria 6746
390 Ga0495671_0025209 3300046692 Bacteria 3092
391 Ga0495649_0125923 3300046694 Bacteria 1353
392 Ga0495649_0206773 3300046694 Bacteria 1018
393 Ga0495589_0032506 3300046794 Bacteria 2623
394 Ga0495660_0001533 3300046810 Bacteria 15568
395 Ga0495660_0136330 3300046810 Bacteria 1226
396 Ga0495636_0011427 3300047318 Bacteria 3513
397 Ga0495672_0000035 3300047320 Bacteria 290329
398 Ga0495672_0061607 3300047320 Bacteria 2162
399 Ga0495683_0003291 3300047323 Bacteria 9449
400 Ga0495687_000536 3300047443 Bacteria 45378
401 Ga0495677_0003648 3300047445 Bacteria 5960
402 Ga0495685_000004 3300047447 Bacteria 115775
403 Ga0495673_0070009 3300047469 Bacteria 1478
404 Ga0495686_0021119 3300047472 Bacteria 4330
405 Ga0495686_0097047 3300047472 Bacteria 1783
406 Ga0495686_0324999 3300047472 Bacteria 842
407 Ga0495615_0060498 3300048090 Bacteria 998
408 Ga0496101_0037883 3300048904 Bacteria 3423
409 Ga0496102_0215104 3300048905 Bacteria 1811
410 Ga0496102_0233419 3300048905 Bacteria 1734
411 Ga0496106_0025589 3300048909 Bacteria 4393
412 Ga0496108_0101812 3300048911 Bacteria 2450
413 Ga0496109_0264694 3300048912 Bacteria 1620
414 Ga0496109_0654306 3300048912 Bacteria 988
415 Ga0496114_0015484 3300048917 Bacteria 6132
416 Ga0496114_0065944 3300048917 Bacteria 3034
417 Ga0496116_0037219 3300048919 Bacteria 3396
418 Ga0496121_0054326 3300048924 Bacteria 3348
419 Ga0496122_0022300 3300048925 Bacteria 5634
420 Ga0496123_0055155 3300048926 Bacteria 2609
421 Ga0496125_0000897 3300048928 Bacteria 47149
422 Ga0496125_0189893 3300048928 Bacteria 1358
423 Ga0496126_0381831 3300048929 Bacteria 1147
424 Ga0495678_068978 3300049459 Bacteria 1302
425 Ga0495682_0000343 3300049460 Bacteria 34418
426 Ga0495682_0003835 3300049460 Bacteria 6591
427 Ga0501033_0039293 3300049570 Bacteria 3534
428 Ga0501034_0012934 3300049571 Bacteria 8602
429 Ga0501034_0281434 3300049571 Bacteria 1602
430 Ga0501034_0440441 3300049571 Bacteria 1222
431 Ga0501036_0111417 3300049572 Bacteria 2312
432 Ga0501037_0078321 3300049573 Bacteria 2398
433 Ga0501038_0317561 3300049574 Bacteria 1219
434 Ga0501039_0094773 3300049575 Bacteria 2327
435 Ga0501039_0538478 3300049575 Bacteria 916
436 Ga0501042_0072136 3300049578 Bacteria 2471
437 Ga0501042_0393176 3300049578 Bacteria 1004
438 Ga0501043_0133857 3300049579 Bacteria 1942
439 Ga0501043_0273368 3300049579 Bacteria 1296
440 Ga0501046_0093272 3300049580 Bacteria 2314
441 Ga0501047_0441378 3300049581 Bacteria 1131
442 Ga0501048_0286948 3300049582 Bacteria 1170
443 Ga0501068_0000460 3300049584 Bacteria 20604
444 Ga0501068_0057309 3300049584 Bacteria 2362
445 Ga0501069_0148647 3300049585 Bacteria 1346
446 Ga0501070_0043641 3300049586 Bacteria 3731
447 Ga0501070_0159305 3300049586 Bacteria 1861
448 Ga0501071_0163765 3300049587 Bacteria 1663
449 Ga0501072_0160354 3300049588 Bacteria 1794
450 Ga0501072_0271695 3300049588 Bacteria 1348
451 Ga0501073_0058273 3300049589 Bacteria 2699
452 Ga0501073_0203090 3300049589 Bacteria 1370
453 Ga0501076_0314623 3300049592 Bacteria 1284
454 Ga0501076_0332514 3300049592 Bacteria 1246
455 Ga0501077_0002168 3300049593 Bacteria 11867
456 Ga0501079_0001221 3300049741 Bacteria 17991
457 Ga0501080_0000981 3300049742 Bacteria 23366
458 Ga0501080_0013226 3300049742 Bacteria 7582
459 Ga0501083_0001400 3300049744 Bacteria 16403
460 Ga0501035_0121417 3300049822 Bacteria 2283
461 Ga0501044_0077322 3300049823 Bacteria 3375
462 Ga0501044_0084892 3300049823 Bacteria 3199
463 Ga0501045_0586036 3300049824 Bacteria 826
464 nmdc:mga06r32_358325_c1 3300050510 Bacteria 1443
465 nmdc:mga08y16_237076_c1 3300050511 Bacteria 1886
466 nmdc:mga0n895_822116_c1 3300050512 Bacteria 918
467 nmdc:mga0a205_570942_c1 3300050515 Bacteria 985
468 Ga0495655_0068454 3300053083 Unclassified 987
469 Ga0501084_0045940 3300054114 Bacteria 3656
470 Ga0501084_0065185 3300054114 Bacteria 3047
471 Ga0501082_0173926 3300060353 Bacteria 1872
472 2513956184 2513237150 Bacteria 6553639
473 2514042494 2513237165 Bacteria 6771773
474 2644029251 2643221603 Bacteria 6147767
475 2644249371 2643221645 Bacteria 7207331
476 2644359474 2643221664 Bacteria 7272945
477 2738740799 2738541280 Bacteria 6630198
478 2738845113 2738541300 Bacteria 6675882
479 2739274698 2738543018 Bacteria 6718814
480 2739343742 2738543030 Bacteria 6719714
481 2834644133 2834641062 Bacteria 5559922
482 2858698360 2858688981 Bacteria 8184122
483 644746445 644736347 Bacteria 6476522
484 8003403947 8003400568 Bacteria 5535898
485 8055225952 8055225921 Bacteria 3341787
486 Ga0068863_101092862
487 Ga0006759J45824_1087121
488 JGI25151J46595_10003398
489 JGI25151J46595_10028396
490 rootL2_10067533
491 Ga0007417J51691_1021079
492 Ga0007410J51695_1038954
493 Ga0007409J51694_1014616
494 Ga0007416J51690_1011811
495 Ga0007411J51799_111718
496 Ga0032354_1010298
497 Ga0055537_1003050
498 Ga0055524_1000629
499 Ga0055536_1000324
500 Ga0055534_1001753
501 JGI25405J52794_10049490
502 Ga0065712_10280249
503 Ga0065715_10242516
504 Ga0070658_10001403
505 Ga0070676_10471038
506 Ga0070683_100066700
507 Ga0070670_100013450
508 Ga0070677_10025556
509 Ga0068869_100089543
510 Ga0070666_10055423
511 Ga0070682_100007448
512 Ga0070682_100019929
513 Ga0070682_100178434
514 Ga0070689_100003825
515 Ga0070661_100010090
516 Ga0070668_100363050
517 Ga0070668_101124958
518 Ga0070669_100000846
519 Ga0070669_100151503
520 Ga0070669_100221547
521 Ga0070669_100684168
522 Ga0070675_100128540
523 Ga0070675_100140166
524 Ga0070675_100603425
525 Ga0070671_100003846
526 Ga0070674_100009526
527 Ga0070674_100061009
528 Ga0070674_100115224
529 Ga0070673_100271358
530 Ga0070673_100351244
531 Ga0070688_100371500
532 Ga0070659_100218878
533 Ga0070667_100039333
534 Ga0070667_100495394
535 Ga0070709_10536761
536 Ga0070714_100463764
537 Ga0070705_100021935
538 Ga0070700_100248436
539 Ga0070694_100120594
540 Ga0070663_100202372
541 Ga0070663_100385317
542 Ga0070678_100039466
543 Ga0070678_100053036
544 Ga0070678_100395552
545 Ga0070662_100339887
546 Ga0070662_100343334
547 Ga0070662_100751038
548 Ga0068867_100032821
549 Ga0068867_100089988
550 Ga0068867_100129812
551 Ga0070684_100639655
552 Ga0068853_100300343
553 Ga0070672_100010864
554 Ga0070672_100160410
555 Ga0070672_100524526
556 Ga0070686_100141416
557 Ga0070695_100131378
558 Ga0070695_100372092
559 Ga0070693_100252218
560 Ga0070665_100007562
561 Ga0070665_100031299
562 Ga0070665_100182760
563 Ga0070665_100306347
564 Ga0070665_100425269
565 Ga0070665_100545975
566 Ga0070664_100007750
567 Ga0070664_100107464
568 Ga0070664_100251308
569 Ga0068857_100309528
570 Ga0068854_100393277
571 Ga0068852_100023289
572 Ga0068852_100673774
573 Ga0068859_100018585
574 Ga0068859_100063637
575 Ga0068859_100185140
576 Ga0068859_100809875
577 Ga0068864_100090085
578 Ga0068864_100459358
579 Ga0068861_100003428
580 Ga0068861_100028203
581 Ga0068861_100077136
582 Ga0068861_100154437
583 Ga0068861_100459566
584 Ga0068861_100742697
585 Ga0068851_10016592
586 Ga0068863_100449569
587 Ga0068858_100063412
588 Ga0068860_101059722
589 Ga0068862_100041341
590 Ga0068862_100116490
591 Ga0068862_100216066
592 Ga0068862_100267076
593 Ga0081455_10004105
594 Ga0070712_100009789
595 Ga0097621_100041214
596 Ga0097621_100098034
597 Ga0097621_100129672
598 Ga0068871_100115148
599 Ga0068871_100125803
600 Ga0068871_100235313
601 Ga0068871_100408909
602 Ga0068871_100545482
603 Ga0075428_100317960
604 Ga0075428_100679995
605 Ga0075430_100082854
606 Ga0075430_100412350
607 Ga0075431_100200842
608 Ga0068865_100117522
609 Ga0068865_100370581
610 Ga0068865_100873162
611 Ga0097620_100018585
612 Ga0097620_100063637
613 Ga0097620_100185132
614 Ga0097620_100809774
615 Ga0099826_10000007
616 Ga0105251_10030584
617 Ga0111539_10251426
618 Ga0105245_10161711
619 Ga0105247_10477165
620 Ga0114129_11445614
621 Ga0105243_10041073
622 Ga0105243_10525084
623 Ga0105242_10060214
624 Ga0105248_10251911
625 Ga0105248_10748404
626 Ga0105248_11098741
627 Ga0105237_10006330
628 Ga0105237_10242854
629 Ga0105238_10459045
630 Ga0105249_10593450
631 Ga0105249_10779368
632 Ga0105239_10094466
633 Ga0157369_10446181
634 Ga0157374_10128725
635 Ga0157374_10193293
636 Ga0157374_10732385
637 Ga0157378_10315068
638 Ga0163162_10611216
639 Ga0157372_10236499
640 Ga0157375_10011098
641 Ga0157375_10061692
642 Ga0157375_10073615
643 Ga0157375_10161396
644 Ga0157375_10278146
645 Ga0157375_10647674
646 Ga0163163_10091864
647 Ga0163163_11272761
648 Ga0157380_10119502
649 Ga0157380_10174113
650 Ga0157380_10334069
651 Ga0157376_10112504
652 Ga0157376_10147153
653 Ga0182007_10040408
654 Ga0163161_10164163
655 Ga0213872_10000063
656 Ga0209565_1000106
657 Ga0209565_1009493
658 Ga0209675_1000168
659 Ga0209675_1001444
660 Ga0209675_1017926
661 Ga0209676_1000036
662 Ga0209025_1000462
663 Ga0209025_1001905
664 Ga0209025_1002261
665 Ga0209564_1000573
666 Ga0209564_1000957
667 Ga0209564_1001001
668 Ga0209758_1033047
669 Ga0209256_1000220
670 Ga0209256_1000554
671 Ga0209051_1017060
672 Ga0209051_1018808
673 Ga0207682_10002327
674 Ga0207682_10137094
675 Ga0207710_10309172
676 Ga0207680_10007444
677 Ga0207699_10466428
678 Ga0207643_10074191
679 Ga0207705_10021526
680 Ga0207671_10009133
681 Ga0207671_10208138
682 Ga0207693_10021314
683 Ga0207662_10103113
684 Ga0207657_10016101
685 Ga0207657_10722079
686 Ga0207681_10095140
687 Ga0207681_10539010
688 Ga0207650_10008345
689 Ga0207650_10028981
690 Ga0207650_10081203
691 Ga0207650_10258106
692 Ga0207650_10317100
693 Ga0207650_10783368
694 Ga0207659_10119129
695 Ga0207659_10332780
696 Ga0207687_10201388
697 Ga0207687_10679387
698 Ga0207644_10719709
699 Ga0207690_10077321
700 Ga0207706_10096145
701 Ga0207706_10382389
702 Ga0207706_10546935
703 Ga0207709_10198992
704 Ga0207709_10614358
705 Ga0207670_10014583
706 Ga0207670_10033116
707 Ga0207669_10038557
708 Ga0207704_10134107
709 Ga0207704_10146611
710 Ga0207704_10387943
711 Ga0207691_10059721
712 Ga0207691_10411617
713 Ga0207711_10082662
714 Ga0207689_10034670
715 Ga0207661_10108798
716 Ga0207679_10108351
717 Ga0207679_10153480
718 Ga0207651_10218837
719 Ga0207651_10897624
720 Ga0207712_10359877
721 Ga0207640_10282723
722 Ga0207640_10401053
723 Ga0207658_10027850
724 Ga0207703_10059131
725 Ga0207703_10071748
726 Ga0207703_10253922
727 Ga0207678_10198641
728 Ga0207678_10293104
729 Ga0207708_10102696
730 Ga0207708_10165706
731 Ga0207708_10189126
732 Ga0207708_10477560
733 Ga0207702_10229947
734 Ga0207641_10052285
735 Ga0207641_10080854
736 Ga0207641_10553201
737 Ga0207648_10034642
738 Ga0207648_10071550
739 Ga0207648_10548768
740 Ga0207676_10058089
741 Ga0207676_10793297
742 Ga0207674_10606203
743 Ga0207675_100005763
744 Ga0207675_100130609
745 Ga0207675_100194476
746 Ga0207675_100658658
747 Ga0207683_10459393
748 Ga0209282_1000061
749 Ga0268266_10024376
750 Ga0268266_10159486
751 Ga0268265_10028239
752 Ga0268265_10296454
753 Ga0268265_10391009
754 Ga0268264_10124100
755 Ga0268264_10454475
756 Ga0265328_10111453
757 Ga0265320_10088526
758 Ga0307513_10110864
759 Ga0307513_10470176
760 Ga0307408_100050296
761 Ga0265314_10046650
762 Ga0307405_10339946
763 Ga0307406_10007898
764 Ga0307407_10182544
765 Ga0307409_100021207
766 Ga0307409_100214491
767 Ga0307416_100021110
768 Ga0307416_101047861
769 Ga0307411_10005352
770 Ga0307415_100554058
771 Ga0316593_10048206
772 Ga0373932_0101597
773 Ga0373943_0320058
774 Ga0373955_0316235
775 Ga0373931_0095698
776 Ga0373931_0156886
777 Ga0373933_0161078
778 Ga0373937_0118525
779 Ga0373925_0009800
780 Ga0373925_0746021
781 Ga0395899_0003696
782 Ga0395899_0020212
783 Ga0395900_0001354
784 Ga0395900_0159549
785 Ga0395900_0711261
786 Ga0395898_0008292
787 Ga0395898_0015300
788 Ga0395898_0036893
789 Ga0395905_0000137
790 Ga0395905_0209465
791 Ga0395905_0487015
792 Ga0395905_0803130
793 Ga0395901_0006191
794 Ga0395901_0172986
795 Ga0436361_0655175
796 Ga0436361_0811061
797 Ga0451841_0114343
798 Ga0451853_1268857
799 Ga0439444_0027466
800 Ga0466972_0000029
801 Ga0453683_0204860
802 Ga0466966_0011936
803 Ga0466964_0003634
804 Ga0453684_0000014
805 Ga0453684_0000682
806 Ga0453684_0000975
807 Ga0453684_0005513
808 Ga0453684_1113468
809 Ga0466959_0080505
810 Ga0466959_0495206
811 Ga0495617_037474
812 Ga0495617_096273
813 Ga0495590_0039794
814 Ga0495638_0004277
815 Ga0495638_0028011
816 Ga0495638_0045273
817 Ga0495650_0000519
818 Ga0495650_0008211
819 Ga0495605_0001123
820 Ga0495605_0002642
821 Ga0495584_0002965
822 Ga0495584_0077713
823 Ga0495585_0014959
824 Ga0495585_0095971
825 Ga0495585_0130420
826 Ga0495596_0000577
827 Ga0495607_0044134
828 Ga0495607_0058357
829 Ga0495607_0098771
830 Ga0495583_0000004
831 Ga0495606_0006173
832 Ga0495606_0010926
833 Ga0495610_0005593
834 Ga0495610_0030322
835 Ga0495616_0001603
836 Ga0495616_0004162
837 Ga0495616_0005090
838 Ga0495616_0061734
839 Ga0495628_0585146
840 Ga0495632_0018045
841 Ga0495644_0002672
842 Ga0495644_0003781
843 Ga0495648_0003940
844 Ga0495654_0099858
845 Ga0495586_0180774
846 Ga0495609_0002923
847 Ga0495609_0005238
848 Ga0495609_0008840
849 Ga0495609_0014916
850 Ga0495597_0011477
851 Ga0495597_0069577
852 Ga0495622_0000053
853 Ga0495622_0020711
854 Ga0495633_0004349
855 Ga0495633_0023113
856 Ga0495656_0085731
857 Ga0495668_0105047
858 Ga0495668_0148837
859 Ga0495611_0043100
860 Ga0495625_0007453
861 Ga0495625_0012345
862 Ga0495625_0031163
863 Ga0495625_0274781
864 Ga0495625_0303237
865 Ga0495659_0000118
866 Ga0495659_0003772
867 Ga0495661_0019790
868 Ga0495661_0054448
869 Ga0495658_0256204
870 Ga0495669_0249322
871 Ga0495670_0003657
872 Ga0495670_0003990
873 Ga0495671_0001545
874 Ga0495671_0006506
875 Ga0495671_0025209
876 Ga0495649_0125923
877 Ga0495649_0206773
878 Ga0495589_0032506
879 Ga0495660_0001533
880 Ga0495660_0136330
881 Ga0495636_0011427
882 Ga0495672_0000035
883 Ga0495672_0061607
884 Ga0495683_0003291
885 Ga0495687_000536
886 Ga0495677_0003648
887 Ga0495685_000004
888 Ga0495673_0070009
889 Ga0495686_0021119
890 Ga0495686_0097047
891 Ga0495686_0324999
892 Ga0495615_0060498
893 Ga0496101_0037883
894 Ga0496102_0215104
895 Ga0496102_0233419
896 Ga0496106_0025589
897 Ga0496108_0101812
898 Ga0496109_0264694
899 Ga0496109_0654306
900 Ga0496114_0015484
901 Ga0496114_0065944
902 Ga0496116_0037219
903 Ga0496121_0054326
904 Ga0496122_0022300
905 Ga0496123_0055155
906 Ga0496125_0000897
907 Ga0496125_0189893
908 Ga0496126_0381831
909 Ga0495678_068978
910 Ga0495682_0000343
911 Ga0495682_0003835
912 Ga0501033_0039293
913 Ga0501034_0012934
914 Ga0501034_0281434
915 Ga0501034_0440441
916 Ga0501036_0111417
917 Ga0501037_0078321
918 Ga0501038_0317561
919 Ga0501039_0094773
920 Ga0501039_0538478
921 Ga0501042_0072136
922 Ga0501042_0393176
923 Ga0501043_0133857
924 Ga0501043_0273368
925 Ga0501046_0093272
926 Ga0501047_0441378
927 Ga0501048_0286948
928 Ga0501068_0000460
929 Ga0501068_0057309
930 Ga0501069_0148647
931 Ga0501070_0043641
932 Ga0501070_0159305
933 Ga0501071_0163765
934 Ga0501072_0160354
935 Ga0501072_0271695
936 Ga0501073_0058273
937 Ga0501073_0203090
938 Ga0501076_0314623
939 Ga0501076_0332514
940 Ga0501077_0002168
941 Ga0501079_0001221
942 Ga0501080_0000981
943 Ga0501080_0013226
944 Ga0501083_0001400
945 Ga0501035_0121417
946 Ga0501044_0077322
947 Ga0501044_0084892
948 Ga0501045_0586036
949 nmdc:mga06r32_358325_c1
950 nmdc:mga08y16_237076_c1
951 nmdc:mga0n895_822116_c1
952 nmdc:mga0a205_570942_c1
953 Ga0495655_0068454
954 Ga0501084_0045940
955 Ga0501084_0065185
956 Ga0501082_0173926
957 2513956184
958 2514042494
959 2644029251
960 2644249371
961 2644359474
962 2738740799
963 2738845113
964 2739274698
965 2739343742
966 2834644133
967 2858698360
968 644746445
969 8003403947
970 8055225952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

39

190

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4waj-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydase variant p48s/a49p 0.97 40 220
3e24-assembly1.cif.gz_A h. influenzae beta-carbonic anhydrase, variant w39f 0.9669 42 220
3e2x-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase, variant v47a 0.9657 41 220
4znz-assembly1.cif.gz_A crystal structure of escherichia coli carbonic anhydrase (yadf) in complex with zn - artifact of purification 0.9655 11 220
4wam-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase variant w39v/g41a/p48s/a49p 0.9643 41 220
ID Description Score Start End Superfamily
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9622 41 220 3.40.1050.10
2a8cA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9517 11 220 3.40.1050.10
1ddzB02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9462 40 218 3.40.1050.10
3ucnB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9311 11 211 3.40.1050.10
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9098 41 220 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A7Y0DKE0-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9885 12 220 GO:0004089
GO:0008270
GO:0015976
AF-A0A2S9GTI7-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.985 12 220 GO:0004089
GO:0008270
GO:0015976
AF-A0A345D803-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9842 11 220 GO:0004089
GO:0008270
GO:0015976
AF-A0A0N0JW07-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9834 13 221 GO:0004089
GO:0008270
GO:0015976
AF-A0A0N1AUK7-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.983 11 221 GO:0004089
GO:0008270
GO:0015976

Map