F453072

General Info

Members Datasets Scaffolds Average Seq Length
485 336 970 148

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10113513|Ga0081455_101135133
Length 151
Sequence MPNTVRLHRVLATTPEKLYRAFLEPDAVAKWLPPNGFACTVHHLEARVGGTHKMSFRNFTAGDSSFGSHSFGGQYLELVPNERLRYTDKFDDPNLPGEMTVTVTLKKVSVGTELSIVQEGVPDAIPAEACYLGWQESLENLKRLVEPDIKP

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
153 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
154 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
258 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
282 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
283 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
288 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
289 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
290 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
291 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
292 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
293 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
294 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
295 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
296 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
297 2643221569 Achromobacter sp. Root565 Isolate Unclassified
298 2643221594 Achromobacter sp. Root170 Isolate Unclassified
299 2643221621 Achromobacter sp. Root83 Isolate Unclassified
300 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
301 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
302 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
303 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
304 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
305 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
306 2818991450 Burkholderia sp. 604 Isolate Unclassified
307 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
308 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
309 2858950400 Achromobacter sp. K91 Isolate Unclassified
310 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
311 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
312 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
313 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
314 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
315 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
316 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
317 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
318 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
319 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
320 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
321 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
322 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
323 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
324 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
325 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
326 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
327 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
328 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
329 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
330 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
331 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
332 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
333 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
334 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
335 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
336 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.69
Metatranscriptomes 0
Isolates 10.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 5.57
Rhizoplane 6.8
Rhizosphere 67.84
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10113513 3300005937 Bacteria 2149
2 JGI24740J21852_10069978 3300001979 Bacteria 942
3 JGI24739J22299_10008098 3300001989 Bacteria 3925
4 JGI24739J22299_10008222 3300001989 Bacteria 3894
5 JGI24739J22299_10036751 3300001989 Bacteria 1653
6 JGI24737J22298_10002958 3300001990 Bacteria 6023
7 JGI24737J22298_10038715 3300001990 Bacteria 1467
8 JGI24737J22298_10102394 3300001990 Bacteria 848
9 JGI24735J21928_10000985 3300002067 Bacteria 10197
10 JGI24735J21928_10003569 3300002067 Bacteria 5290
11 JGI24735J21928_10047422 3300002067 Bacteria 1245
12 JGI25162J39368_1000551 3300002737 Bacteria 27687
13 JGI25162J39368_1000604 3300002737 Bacteria 25862
14 JGI25157J39369_1000485 3300002741 Bacteria 24711
15 JGI25164J39214_1000046 3300002772 Bacteria 124984
16 JGI25164J39214_1000191 3300002772 Bacteria 53327
17 JGI25152J39213_1005748 3300002773 Bacteria 3535
18 JGI25165J46597_1000096 3300003214 Bacteria 161294
19 rootH1_10179127 3300003323 Bacteria 2873
20 JGI25160J50197_1021273 3300003354 Bacteria 1933
21 Ga0055527_1003070 3300003760 Bacteria 2588
22 Ga0055535_1000336 3300003761 Bacteria 46983
23 Ga0055535_1000675 3300003761 Bacteria 26608
24 Ga0055542_1000348 3300003762 Bacteria 48634
25 Ga0055529_1000309 3300003763 Bacteria 56116
26 Ga0055526_1002537 3300003771 Bacteria 12254
27 Ga0055524_1018412 3300003775 Bacteria 2426
28 Ga0055536_1073791 3300003781 Bacteria 665
29 Ga0055528_1019123 3300003790 Bacteria 2289
30 Ga0065714_10074392 3300005288 Bacteria 3043
31 Ga0070658_10096885 3300005327 Bacteria 2436
32 Ga0070658_10723659 3300005327 Bacteria 864
33 Ga0070683_100000046 3300005329 Bacteria 95134
34 Ga0070670_100000126 3300005331 Bacteria 71644
35 Ga0070666_10004034 3300005335 Bacteria 8911
36 Ga0070660_100162290 3300005339 Bacteria 1801
37 Ga0070660_100654436 3300005339 Bacteria 880
38 Ga0070689_100289903 3300005340 Bacteria 1360
39 Ga0070671_100596748 3300005355 Bacteria 954
40 Ga0070659_100168552 3300005366 Bacteria 1793
41 Ga0070659_100355858 3300005366 Bacteria 1229
42 Ga0070667_100000057 3300005367 Bacteria 150501
43 Ga0070663_100294172 3300005455 Bacteria 1298
44 Ga0070662_100151727 3300005457 Bacteria 1805
45 Ga0070662_100421674 3300005457 Bacteria 1104
46 Ga0070698_100753693 3300005471 Bacteria 917
47 Ga0070679_100108721 3300005530 Bacteria 2759
48 Ga0070679_100307380 3300005530 Unclassified 1536
49 Ga0070679_100398176 3300005530 Bacteria 1323
50 Ga0070684_100025052 3300005535 Bacteria 5010
51 Ga0068853_100005841 3300005539 Bacteria 9693
52 Ga0068853_100066614 3300005539 Bacteria 3128
53 Ga0068853_100207754 3300005539 Bacteria 1784
54 Ga0070672_100008032 3300005543 Bacteria 7207
55 Ga0070686_100804530 3300005544 Bacteria 758
56 Ga0068855_100007720 3300005563 Bacteria 12990
57 Ga0068855_100080510 3300005563 Bacteria 3777
58 Ga0068855_100286825 3300005563 Bacteria 1826
59 Ga0068857_100125711 3300005577 Bacteria 2310
60 Ga0068857_100375420 3300005577 Bacteria 1319
61 Ga0068854_100028297 3300005578 Bacteria 3871
62 Ga0068856_100006599 3300005614 Bacteria 11374
63 Ga0068856_100020287 3300005614 Bacteria 6455
64 Ga0068856_102028578 3300005614 Bacteria 585
65 Ga0068852_100039942 3300005616 Bacteria 3954
66 Ga0068852_100167206 3300005616 Bacteria 2058
67 Ga0068859_100720060 3300005617 Bacteria 1088
68 Ga0068863_100336489 3300005841 Bacteria 1468
69 Ga0068858_101946208 3300005842 Bacteria 581
70 Ga0068860_100216290 3300005843 Bacteria 1860
71 Ga0075365_10592613 3300006038 Bacteria 784
72 Ga0070712_101359833 3300006175 Bacteria 619
73 Ga0075362_10625984 3300006177 Bacteria 557
74 Ga0075369_10161475 3300006186 Bacteria 1027
75 Ga0075366_10015915 3300006195 Bacteria 4317
76 Ga0097621_100551902 3300006237 Bacteria 1049
77 Ga0068871_100107162 3300006358 Bacteria 2347
78 Ga0075430_100227517 3300006846 Bacteria 1547
79 Ga0068865_100077636 3300006881 Bacteria 2374
80 Ga0097620_100720082 3300006931 Bacteria 1088
81 Ga0099794_10020591 3300007265 Bacteria 2987
82 Ga0105251_10000029 3300009011 Bacteria 125097
83 Ga0105251_10002461 3300009011 Bacteria 14537
84 Ga0105251_10009781 3300009011 Bacteria 5624
85 Ga0105250_10073212 3300009092 Bacteria 1385
86 Ga0105240_10057758 3300009093 Bacteria 4845
87 Ga0105240_10240159 3300009093 Bacteria 2101
88 Ga0105247_10019748 3300009101 Bacteria 4047
89 Ga0105247_10705861 3300009101 Bacteria 760
90 Ga0105248_10004912 3300009177 Bacteria 14768
91 Ga0105248_11203229 3300009177 Bacteria 857
92 Ga0105237_10037680 3300009545 Bacteria 4886
93 Ga0105237_10096426 3300009545 Bacteria 2948
94 Ga0105237_10263158 3300009545 Bacteria 1727
95 Ga0105237_10313555 3300009545 Bacteria 1572
96 Ga0105238_10053312 3300009551 Bacteria 4064
97 Ga0105238_10473898 3300009551 Bacteria 1251
98 Ga0105147_106359 3300009982 Bacteria 1001
99 Ga0105239_10005426 3300010375 Bacteria 14965
100 Ga0105239_10542815 3300010375 Bacteria 1324
101 Ga0157370_10042767 3300013104 Bacteria 4364
102 Ga0157369_10000783 3300013105 Bacteria 40985
103 Ga0157369_10086121 3300013105 Bacteria 3356
104 Ga0157369_10238473 3300013105 Bacteria 1900
105 Ga0157369_10511527 3300013105 Bacteria 1242
106 Ga0157374_10310621 3300013296 Bacteria 1561
107 Ga0163162_10021856 3300013306 Bacteria 6303
108 Ga0157372_10107526 3300013307 Bacteria 3192
109 Ga0157375_10435014 3300013308 Bacteria 1478
110 Ga0157375_10667664 3300013308 Bacteria 1195
111 Ga0163163_10007443 3300014325 Bacteria 9663
112 Ga0163163_10739000 3300014325 Bacteria 1047
113 Ga0163163_10911047 3300014325 Bacteria 943
114 Ga0182007_10003546 3300015262 Bacteria 7350
115 Ga0163161_10000244 3300017792 Bacteria 49165
116 Ga0163161_10352956 3300017792 Bacteria 1169
117 Ga0209672_100160 3300025228 Bacteria 57654
118 Ga0209672_100651 3300025228 Bacteria 17730
119 Ga0207427_100040 3300025231 Bacteria 265135
120 Ga0209437_100172 3300025233 Bacteria 140146
121 Ga0209258_100246 3300025242 Bacteria 99606
122 Ga0209258_100272 3300025242 Bacteria 88382
123 Ga0209646_1002050 3300025246 Bacteria 4774
124 Ga0209026_1001902 3300025250 Bacteria 8480
125 Ga0209148_1000024 3300025254 Bacteria 669890
126 Ga0209148_1000185 3300025254 Bacteria 118117
127 Ga0209759_1000287 3300025256 Bacteria 70252
128 Ga0209759_1000807 3300025256 Bacteria 25155
129 Ga0209129_1002556 3300025258 Bacteria 8791
130 Ga0209233_1000108 3300025261 Bacteria 265137
131 Ga0209455_1000025 3300025272 Bacteria 670673
132 Ga0209455_1002195 3300025272 Bacteria 7724
133 Ga0209676_1020428 3300025292 Bacteria 2250
134 Ga0209564_1022954 3300025295 Bacteria 2185
135 Ga0209050_1012438 3300025298 Bacteria 3901
136 Ga0209256_1007394 3300025299 Bacteria 5431
137 Ga0207426_1001990 3300025302 Bacteria 14441
138 Ga0207426_1002441 3300025302 Bacteria 11864
139 Ga0209051_1030486 3300025303 Bacteria 2092
140 Ga0207696_1056476 3300025711 Bacteria 1111
141 Ga0207713_1000112 3300025735 Bacteria 133341
142 Ga0207710_10021471 3300025900 Bacteria 2767
143 Ga0207647_10000712 3300025904 Bacteria 26107
144 Ga0207647_10005249 3300025904 Bacteria 9535
145 Ga0207654_10017149 3300025911 Bacteria 3782
146 Ga0207695_10001998 3300025913 Bacteria 31500
147 Ga0207695_10280257 3300025913 Bacteria 1561
148 Ga0207671_10067018 3300025914 Bacteria 2673
149 Ga0207671_10181398 3300025914 Bacteria 1638
150 Ga0207657_10024087 3300025919 Bacteria 5651
151 Ga0207657_10108986 3300025919 Bacteria 2289
152 Ga0207652_10366941 3300025921 Bacteria 1300
153 Ga0207694_10000157 3300025924 Bacteria 70076
154 Ga0207694_10047369 3300025924 Bacteria 3325
155 Ga0207694_10677543 3300025924 Bacteria 869
156 Ga0207650_10000035 3300025925 Bacteria 215488
157 Ga0207687_10371507 3300025927 Bacteria 1169
158 Ga0207644_10186065 3300025931 Bacteria 1631
159 Ga0207644_11177973 3300025931 Bacteria 644
160 Ga0207690_10095918 3300025932 Bacteria 2108
161 Ga0207690_10356594 3300025932 Bacteria 1157
162 Ga0207706_10432701 3300025933 Bacteria 1139
163 Ga0207706_11566268 3300025933 Bacteria 535
164 Ga0207669_11015887 3300025937 Bacteria 697
165 Ga0207704_10077521 3300025938 Bacteria 2134
166 Ga0207691_10029682 3300025940 Bacteria 5114
167 Ga0207711_10006267 3300025941 Bacteria 10036
168 Ga0207711_10322871 3300025941 Bacteria 1427
169 Ga0207661_10000002 3300025944 Bacteria 816104
170 Ga0207667_10011520 3300025949 Bacteria 10275
171 Ga0207667_10029315 3300025949 Bacteria 5969
172 Ga0207667_10232189 3300025949 Bacteria 1889
173 Ga0207667_10506453 3300025949 Bacteria 1224
174 Ga0207651_10211575 3300025960 Bacteria 1561
175 Ga0207668_10181221 3300025972 Bacteria 1662
176 Ga0207640_10066447 3300025981 Bacteria 2409
177 Ga0207640_10079919 3300025981 Bacteria 2230
178 Ga0207658_10000551 3300025986 Bacteria 33984
179 Ga0207703_11832796 3300026035 Bacteria 583
180 Ga0207639_10014940 3300026041 Bacteria 5470
181 Ga0207639_10174172 3300026041 Bacteria 1825
182 Ga0207702_10000002 3300026078 Bacteria 491507
183 Ga0207702_10058373 3300026078 Bacteria 3284
184 Ga0207641_10318843 3300026088 Bacteria 1473
185 Ga0207674_10035480 3300026116 Bacteria 5204
186 Ga0207674_10036525 3300026116 Bacteria 5117
187 Ga0207675_100069139 3300026118 Bacteria 3300
188 Ga0207698_10018538 3300026142 Bacteria 4745
189 Ga0207698_10109072 3300026142 Bacteria 2315
190 Ga0207428_10331846 3300027907 Unclassified 1121
191 Ga0265338_10001292 3300028800 Bacteria 41039
192 Ga0265316_10531041 3300031344 Bacteria 838
193 Ga0307508_10223576 3300031616 Bacteria 1482
194 Ga0307516_10210142 3300031730 Bacteria 1661
195 Ga0307516_10428245 3300031730 Bacteria 981
196 Ga0307413_10015606 3300031824 Bacteria 3899
197 Ga0307413_11716223 3300031824 Bacteria 560
198 Ga0307410_10014537 3300031852 Bacteria 4636
199 Ga0307410_10511415 3300031852 Bacteria 990
200 Ga0307406_10006870 3300031901 Bacteria 6300
201 Ga0307412_10000403 3300031911 Bacteria 26350
202 Ga0307412_10004374 3300031911 Bacteria 7875
203 Ga0307409_100139931 3300031995 Bacteria 2084
204 Ga0307409_100154375 3300031995 Bacteria 1998
205 Ga0307416_101351818 3300032002 Bacteria 818
206 Ga0307416_101395116 3300032002 Bacteria 806
207 Ga0307414_10139252 3300032004 Bacteria 1897
208 Ga0307411_10570279 3300032005 Bacteria 969
209 Ga0307510_10243474 3300033180 Bacteria 1291
210 Ga0373924_0104960 3300035410 Bacteria 1218
211 Ga0373935_0711414 3300035692 Bacteria 739
212 Ga0373927_0064899 3300035695 Bacteria 2362
213 Ga0373927_0330969 3300035695 Bacteria 1003
214 Ga0373947_0066274 3300035725 Bacteria 2204
215 Ga0373937_0460211 3300036401 Bacteria 1208
216 Ga0373925_0123325 3300037068 Bacteria 2013
217 Ga0395900_0611925 3300037418 Bacteria 1029
218 Ga0395898_0000069 3300037466 Bacteria 254587
219 Ga0395898_0046274 3300037466 Bacteria 4274
220 Ga0395898_0633899 3300037466 Bacteria 1011
221 Ga0395905_0087632 3300037471 Bacteria 2918
222 Ga0395901_1887468 3300038443 Bacteria 545
223 Ga0436361_0636518 3300039447 Bacteria 1575
224 Ga0451853_0346831 3300041512 Bacteria 726
225 Ga0439432_164630 3300042006 Bacteria 648
226 Ga0439450_199417 3300042008 Bacteria 535
227 Ga0450888_067479 3300042126 Bacteria 533
228 Ga0451577_0406956 3300042876 Bacteria 1235
229 Ga0451577_1140824 3300042876 Unclassified 697
230 Ga0466969_0001473 3300044656 Bacteria 12646
231 Ga0466966_0007303 3300044684 Bacteria 7323
232 Ga0466961_0030016 3300044693 Bacteria 3493
233 Ga0453684_0330795 3300044712 Bacteria 1723
234 Ga0453684_0582139 3300044712 Bacteria 1229
235 Ga0466971_0091847 3300044719 Bacteria 1391
236 Ga0466970_0120415 3300044765 Bacteria 1437
237 Ga0466959_0847721 3300045049 Bacteria 610
238 Ga0466958_0786159 3300045836 Bacteria 620
239 Ga0466967_2142461 3300045976 Bacteria 555
240 Ga0466967_2158366 3300045976 Bacteria 553
241 Ga0495603_0040452 3300046455 Bacteria 2790
242 Ga0495590_0001159 3300046457 Bacteria 11537
243 Ga0495590_0214361 3300046457 Bacteria 710
244 Ga0495629_0002103 3300046459 Bacteria 15450
245 Ga0495629_0008214 3300046459 Bacteria 7676
246 Ga0495629_0453515 3300046459 Bacteria 868
247 Ga0495638_0000047 3300046460 Bacteria 216004
248 Ga0495651_0488419 3300046462 Bacteria 790
249 Ga0495653_0001072 3300046463 Bacteria 21091
250 Ga0495653_0030079 3300046463 Bacteria 4329
251 Ga0495653_0152035 3300046463 Bacteria 1616
252 Ga0495650_0002203 3300046471 Bacteria 16442
253 Ga0495650_0008031 3300046471 Bacteria 6231
254 Ga0495650_0047109 3300046471 Bacteria 1805
255 Ga0495580_0131551 3300046472 Bacteria 1735
256 Ga0495582_0030950 3300046473 Bacteria 2940
257 Ga0495582_0085386 3300046473 Bacteria 1756
258 Ga0495605_0128337 3300046474 Bacteria 1145
259 Ga0495639_0077396 3300046475 Bacteria 1544
260 Ga0495662_0175327 3300046476 Bacteria 1057
261 Ga0495664_0169338 3300046477 Bacteria 1325
262 Ga0495664_0249838 3300046477 Bacteria 1072
263 Ga0495664_0478992 3300046477 Bacteria 744
264 Ga0495584_0050207 3300046491 Bacteria 2101
265 Ga0495585_0125169 3300046492 Bacteria 1357
266 Ga0495596_0039387 3300046500 Bacteria 1867
267 Ga0495583_0001083 3300046506 Bacteria 30244
268 Ga0495606_0096953 3300046507 Bacteria 1803
269 Ga0495606_0366724 3300046507 Bacteria 759
270 Ga0495608_0195826 3300046511 Bacteria 1275
271 Ga0495610_0023438 3300046512 Bacteria 3355
272 Ga0495628_0018832 3300046516 Bacteria 5714
273 Ga0495630_0008047 3300046517 Bacteria 7580
274 Ga0495630_0046692 3300046517 Bacteria 3238
275 Ga0495643_0000160 3300046522 Bacteria 107502
276 Ga0495648_0000019 3300046524 Bacteria 276407
277 Ga0495648_0501738 3300046524 Bacteria 520
278 Ga0495642_0003905 3300046528 Bacteria 5836
279 Ga0495652_0006134 3300046529 Bacteria 11233
280 Ga0495654_0062663 3300046530 Bacteria 1782
281 Ga0495665_0000015 3300046531 Bacteria 66451
282 Ga0495665_0034780 3300046531 Bacteria 2695
283 Ga0495665_0475883 3300046531 Bacteria 630
284 Ga0495586_0139914 3300046535 Bacteria 1358
285 Ga0495586_0285557 3300046535 Bacteria 945
286 Ga0495609_0024578 3300046538 Bacteria 2763
287 Ga0495609_0024851 3300046538 Bacteria 2746
288 Ga0495597_0001887 3300046542 Bacteria 14297
289 Ga0495597_0006955 3300046542 Bacteria 5799
290 Ga0495645_0000238 3300046543 Bacteria 40111
291 Ga0495645_0008669 3300046543 Bacteria 7103
292 Ga0495645_0055693 3300046543 Bacteria 2871
293 Ga0495622_0000071 3300046557 Bacteria 89071
294 Ga0495633_0000077 3300046558 Bacteria 129051
295 Ga0495667_0249528 3300046559 Bacteria 1130
296 Ga0495656_0112847 3300046615 Bacteria 1274
297 Ga0495668_0698423 3300046616 Bacteria 561
298 Ga0495634_0124025 3300046642 Bacteria 1652
299 Ga0495634_0436845 3300046642 Bacteria 774
300 Ga0495625_0000447 3300046660 Bacteria 62017
301 Ga0495635_0022197 3300046663 Bacteria 4420
302 Ga0495588_0166166 3300046674 Bacteria 1167
303 Ga0495657_0371119 3300046675 Bacteria 845
304 Ga0495599_0221932 3300046678 Bacteria 1156
305 Ga0495623_0004100 3300046679 Bacteria 9601
306 Ga0495623_0299521 3300046679 Bacteria 889
307 Ga0495646_0000652 3300046680 Bacteria 19006
308 Ga0495646_0016576 3300046680 Bacteria 4678
309 Ga0495646_0400514 3300046680 Bacteria 714
310 Ga0495647_0166604 3300046681 Bacteria 952
311 Ga0495658_0289957 3300046683 Bacteria 1034
312 Ga0495669_0176246 3300046684 Bacteria 1018
313 Ga0495669_0344953 3300046684 Bacteria 720
314 Ga0495669_0457848 3300046684 Bacteria 619
315 Ga0495613_0009049 3300046689 Bacteria 7389
316 Ga0495624_0001634 3300046690 Bacteria 17184
317 Ga0495624_0495809 3300046690 Bacteria 731
318 Ga0495670_0316194 3300046691 Bacteria 838
319 Ga0495649_0012211 3300046694 Bacteria 5008
320 Ga0495649_0017723 3300046694 Bacteria 4016
321 Ga0495589_0003916 3300046794 Bacteria 7991
322 Ga0495589_0031567 3300046794 Bacteria 2666
323 Ga0495600_0101428 3300046809 Bacteria 1876
324 Ga0495660_0008470 3300046810 Bacteria 6023
325 Ga0495660_0086167 3300046810 Bacteria 1640
326 Ga0495581_0002045 3300047315 Bacteria 11345
327 Ga0495581_0094984 3300047315 Bacteria 1731
328 Ga0495674_0009227 3300047319 Bacteria 9375
329 Ga0495674_0020521 3300047319 Bacteria 6114
330 Ga0495674_0141015 3300047319 Bacteria 2026
331 Ga0495674_0573261 3300047319 Bacteria 896
332 Ga0495672_0020134 3300047320 Bacteria 4380
333 Ga0495680_0012736 3300047322 Bacteria 7378
334 Ga0495680_0106869 3300047322 Bacteria 2079
335 Ga0495683_0009451 3300047323 Bacteria 5194
336 Ga0495683_0073548 3300047323 Bacteria 1676
337 Ga0495683_0097890 3300047323 Bacteria 1414
338 Ga0495687_000005 3300047443 Bacteria 610401
339 Ga0495687_000172 3300047443 Bacteria 95963
340 Ga0495687_007044 3300047443 Bacteria 6730
341 Ga0495681_0184495 3300047470 Bacteria 855
342 Ga0495684_0493761 3300047471 Bacteria 843
343 Ga0495686_0025442 3300047472 Bacteria 3880
344 Ga0495593_0000133 3300047673 Bacteria 35691
345 Ga0495602_0009012 3300048088 Bacteria 10396
346 Ga0495602_0113176 3300048088 Bacteria 2200
347 Ga0495626_0307871 3300048091 Bacteria 625
348 Ga0496100_0015692 3300048903 Bacteria 4427
349 Ga0496100_0128792 3300048903 Bacteria 1780
350 Ga0496100_0794018 3300048903 Bacteria 741
351 Ga0496101_0012004 3300048904 Bacteria 5773
352 Ga0496101_0251968 3300048904 Bacteria 1376
353 Ga0496102_0022504 3300048905 Bacteria 5585
354 Ga0496102_0214240 3300048905 Bacteria 1816
355 Ga0496102_0596241 3300048905 Bacteria 1028
356 Ga0496102_1109306 3300048905 Bacteria 711
357 Ga0496103_0016864 3300048906 Bacteria 4362
358 Ga0496103_0224087 3300048906 Bacteria 1209
359 Ga0496103_0289879 3300048906 Bacteria 1053
360 Ga0496104_0024340 3300048907 Bacteria 5570
361 Ga0496105_0055448 3300048908 Bacteria 3272
362 Ga0496105_0071221 3300048908 Bacteria 2873
363 Ga0496105_0091086 3300048908 Bacteria 2518
364 Ga0496106_0000927 3300048909 Bacteria 21342
365 Ga0496106_0482163 3300048909 Bacteria 996
366 Ga0496107_0011986 3300048910 Bacteria 6050
367 Ga0496108_0424873 3300048911 Bacteria 1161
368 Ga0496109_0349456 3300048912 Bacteria 1397
369 Ga0496109_0499632 3300048912 Bacteria 1148
370 Ga0496110_0005273 3300048913 Bacteria 10118
371 Ga0496110_0177993 3300048913 Bacteria 1931
372 Ga0496111_0408452 3300048914 Bacteria 1003
373 Ga0496112_0027280 3300048915 Bacteria 5506
374 Ga0496113_0052182 3300048916 Bacteria 3053
375 Ga0496113_0311212 3300048916 Bacteria 1262
376 Ga0496114_0011278 3300048917 Bacteria 7137
377 Ga0496114_0111384 3300048917 Bacteria 2346
378 Ga0496114_0827189 3300048917 Bacteria 805
379 Ga0496115_0105671 3300048918 Bacteria 2311
380 Ga0496116_0008625 3300048919 Bacteria 8820
381 Ga0496116_0012173 3300048919 Bacteria 7040
382 Ga0496116_0215728 3300048919 Bacteria 989
383 Ga0496116_0276127 3300048919 Bacteria 817
384 Ga0496117_0018118 3300048920 Bacteria 5854
385 Ga0496117_0511245 3300048920 Bacteria 580
386 Ga0496118_0000692 3300048921 Bacteria 54767
387 Ga0496118_0041023 3300048921 Bacteria 3671
388 Ga0496118_0130406 3300048921 Bacteria 1616
389 Ga0496119_0066367 3300048922 Bacteria 2132
390 Ga0496120_0199814 3300048923 Bacteria 969
391 Ga0496121_0014098 3300048924 Bacteria 8521
392 Ga0496121_0132690 3300048924 Bacteria 1861
393 Ga0496121_0503456 3300048924 Bacteria 768
394 Ga0496121_0679145 3300048924 Bacteria 623
395 Ga0496122_0022670 3300048925 Bacteria 5573
396 Ga0496124_0015110 3300048927 Bacteria 7422
397 Ga0496124_0106290 3300048927 Bacteria 2266
398 Ga0496124_0269764 3300048927 Bacteria 1247
399 Ga0496125_0016492 3300048928 Bacteria 7090
400 Ga0496125_0138492 3300048928 Bacteria 1697
401 Ga0496125_0322219 3300048928 Bacteria 936
402 Ga0495678_013126 3300049459 Bacteria 3900
403 Ga0495678_139707 3300049459 Bacteria 794
404 Ga0495682_0225148 3300049460 Bacteria 664
405 Ga0501032_0204630 3300049569 Bacteria 1288
406 Ga0501033_0002576 3300049570 Bacteria 15299
407 Ga0501034_0001752 3300049571 Bacteria 27816
408 Ga0501046_0000681 3300049580 Bacteria 33000
409 Ga0501047_0169969 3300049581 Bacteria 2049
410 Ga0501047_0246811 3300049581 Bacteria 1634
411 Ga0501048_0033584 3300049582 Bacteria 3706
412 Ga0501068_0059802 3300049584 Bacteria 2313
413 Ga0501069_0567032 3300049585 Bacteria 680
414 Ga0501070_1027080 3300049586 Bacteria 638
415 Ga0501073_0277345 3300049589 Bacteria 1156
416 Ga0501083_0013438 3300049744 Bacteria 5722
417 Ga0501035_0191925 3300049822 Bacteria 1756
418 Ga0501044_0004164 3300049823 Bacteria 16251
419 Ga0501044_0031553 3300049823 Bacteria 5576
420 nmdc:mga03683_111263_c1 3300050489 Bacteria 1211
421 nmdc:mga00v17_1036767_c1 3300050491 Bacteria 515
422 nmdc:mga0k408_140244_c1 3300050493 Bacteria 1438
423 nmdc:mga0k408_566314_c1 3300050493 Bacteria 671
424 nmdc:mga06z11_537535_c1 3300050494 Bacteria 709
425 nmdc:mga0qj67_209526_c1 3300050509 Bacteria 1583
426 nmdc:mga08y16_148450_c1 3300050511 Unclassified 2437
427 nmdc:mga0a205_269415_c1 3300050515 Bacteria 1580
428 nmdc:mga0sz30_151384_c1 3300050516 Bacteria 1026
429 Ga0495612_0190889 3300053078 Bacteria 902
430 Ga0500566_0397442 3300053094 Bacteria 618
431 Ga0500634_0010102 3300053161 Bacteria 4811
432 Ga0500637_0206334 3300053178 Bacteria 1117
433 Ga0501084_0264337 3300054114 Bacteria 1453
434 Ga0466962_0011071 3300061719 Bacteria 4343
435 Ga0530510_0002166 3300061734 Bacteria 13474
436 2501080187 2501025502 Bacteria 9641094
437 2501409894 2501025504 Bacteria 8008976
438 2511089834 2510917013 Bacteria 9951648
439 2511095225 2510917014 Bacteria 8296963
440 2511104883 2510917015 Bacteria 7950052
441 2512974870 2512875026 Bacteria 6861065
442 2513603794 2513237089 Bacteria 6553624
443 2514004248 2513237160 Bacteria 6650282
444 2516016661 2515154189 Bacteria 9629850
445 2599905202 2599185292 Bacteria 6290804
446 2643858588 2643221569 Bacteria 6064337
447 2643982369 2643221594 Bacteria 5811388
448 2644121616 2643221621 Bacteria 6212786
449 2644304180 2643221654 Bacteria 5273570
450 2802718289 2802428858 Bacteria 6636079
451 2802725917 2802428859 Bacteria 6667919
452 2802736435 2802428861 Bacteria 6534206
453 2802744409 2802428862 Bacteria 6633353
454 2809034479 2808606395 Bacteria 6020352
455 2819621268 2818991450 Bacteria 6962147
456 2840882532 2840878972 Bacteria 5483153
457 2857540029 2857537821 Bacteria 5248181
458 2858953317 2858950400 Bacteria 6783797
459 2881930567 2881927736 Bacteria 3993927
460 2883090660 2883087390 Bacteria 9532701
461 2900638957 2900634093 Bacteria 10263517
462 2915981061 2915980308 Bacteria 6624279
463 2916066016 2916061851 Bacteria 6737736
464 2928109220 2928108538 Bacteria 7360024
465 2928136443 2928135762 Bacteria 7259641
466 2928503776 2928503688 Bacteria 7268108
467 2937035990 2937029754 Bacteria 6424026
468 2937038918 2937036028 Bacteria 6846469
469 2937084845 2937078374 Bacteria 6610289
470 2937088667 2937084907 Bacteria 6618516
471 2945988393 2945984333 Bacteria 7358892
472 2957376098 2957375807 Bacteria 6425588
473 2957439685 2957437181 Bacteria 6568994
474 2960592567 2960591022 Bacteria 6622873
475 2960636048 2960631154 Bacteria 6732508
476 2960681204 2960680706 Bacteria 6624464
477 2960694003 2960693952 Bacteria 6749742
478 2967691930 2967686174 Bacteria 6678622
479 2967733326 2967728569 Bacteria 6641507
480 2970029734 2970026789 Bacteria 6785236
481 2970127277 2970122695 Bacteria 6625855
482 2970145716 2970143518 Bacteria 6446480
483 2977537208 2977530762 Bacteria 6951399
484 2977550176 2977544691 Bacteria 6875412
485 8004006234 8003999396 Bacteria 7063185
486 Ga0081455_10113513
487 JGI24740J21852_10069978
488 JGI24739J22299_10008098
489 JGI24739J22299_10008222
490 JGI24739J22299_10036751
491 JGI24737J22298_10002958
492 JGI24737J22298_10038715
493 JGI24737J22298_10102394
494 JGI24735J21928_10000985
495 JGI24735J21928_10003569
496 JGI24735J21928_10047422
497 JGI25162J39368_1000551
498 JGI25162J39368_1000604
499 JGI25157J39369_1000485
500 JGI25164J39214_1000046
501 JGI25164J39214_1000191
502 JGI25152J39213_1005748
503 JGI25165J46597_1000096
504 rootH1_10179127
505 JGI25160J50197_1021273
506 Ga0055527_1003070
507 Ga0055535_1000336
508 Ga0055535_1000675
509 Ga0055542_1000348
510 Ga0055529_1000309
511 Ga0055526_1002537
512 Ga0055524_1018412
513 Ga0055536_1073791
514 Ga0055528_1019123
515 Ga0065714_10074392
516 Ga0070658_10096885
517 Ga0070658_10723659
518 Ga0070683_100000046
519 Ga0070670_100000126
520 Ga0070666_10004034
521 Ga0070660_100162290
522 Ga0070660_100654436
523 Ga0070689_100289903
524 Ga0070671_100596748
525 Ga0070659_100168552
526 Ga0070659_100355858
527 Ga0070667_100000057
528 Ga0070663_100294172
529 Ga0070662_100151727
530 Ga0070662_100421674
531 Ga0070698_100753693
532 Ga0070679_100108721
533 Ga0070679_100307380
534 Ga0070679_100398176
535 Ga0070684_100025052
536 Ga0068853_100005841
537 Ga0068853_100066614
538 Ga0068853_100207754
539 Ga0070672_100008032
540 Ga0070686_100804530
541 Ga0068855_100007720
542 Ga0068855_100080510
543 Ga0068855_100286825
544 Ga0068857_100125711
545 Ga0068857_100375420
546 Ga0068854_100028297
547 Ga0068856_100006599
548 Ga0068856_100020287
549 Ga0068856_102028578
550 Ga0068852_100039942
551 Ga0068852_100167206
552 Ga0068859_100720060
553 Ga0068863_100336489
554 Ga0068858_101946208
555 Ga0068860_100216290
556 Ga0075365_10592613
557 Ga0070712_101359833
558 Ga0075362_10625984
559 Ga0075369_10161475
560 Ga0075366_10015915
561 Ga0097621_100551902
562 Ga0068871_100107162
563 Ga0075430_100227517
564 Ga0068865_100077636
565 Ga0097620_100720082
566 Ga0099794_10020591
567 Ga0105251_10000029
568 Ga0105251_10002461
569 Ga0105251_10009781
570 Ga0105250_10073212
571 Ga0105240_10057758
572 Ga0105240_10240159
573 Ga0105247_10019748
574 Ga0105247_10705861
575 Ga0105248_10004912
576 Ga0105248_11203229
577 Ga0105237_10037680
578 Ga0105237_10096426
579 Ga0105237_10263158
580 Ga0105237_10313555
581 Ga0105238_10053312
582 Ga0105238_10473898
583 Ga0105147_106359
584 Ga0105239_10005426
585 Ga0105239_10542815
586 Ga0157370_10042767
587 Ga0157369_10000783
588 Ga0157369_10086121
589 Ga0157369_10238473
590 Ga0157369_10511527
591 Ga0157374_10310621
592 Ga0163162_10021856
593 Ga0157372_10107526
594 Ga0157375_10435014
595 Ga0157375_10667664
596 Ga0163163_10007443
597 Ga0163163_10739000
598 Ga0163163_10911047
599 Ga0182007_10003546
600 Ga0163161_10000244
601 Ga0163161_10352956
602 Ga0209672_100160
603 Ga0209672_100651
604 Ga0207427_100040
605 Ga0209437_100172
606 Ga0209258_100246
607 Ga0209258_100272
608 Ga0209646_1002050
609 Ga0209026_1001902
610 Ga0209148_1000024
611 Ga0209148_1000185
612 Ga0209759_1000287
613 Ga0209759_1000807
614 Ga0209129_1002556
615 Ga0209233_1000108
616 Ga0209455_1000025
617 Ga0209455_1002195
618 Ga0209676_1020428
619 Ga0209564_1022954
620 Ga0209050_1012438
621 Ga0209256_1007394
622 Ga0207426_1001990
623 Ga0207426_1002441
624 Ga0209051_1030486
625 Ga0207696_1056476
626 Ga0207713_1000112
627 Ga0207710_10021471
628 Ga0207647_10000712
629 Ga0207647_10005249
630 Ga0207654_10017149
631 Ga0207695_10001998
632 Ga0207695_10280257
633 Ga0207671_10067018
634 Ga0207671_10181398
635 Ga0207657_10024087
636 Ga0207657_10108986
637 Ga0207652_10366941
638 Ga0207694_10000157
639 Ga0207694_10047369
640 Ga0207694_10677543
641 Ga0207650_10000035
642 Ga0207687_10371507
643 Ga0207644_10186065
644 Ga0207644_11177973
645 Ga0207690_10095918
646 Ga0207690_10356594
647 Ga0207706_10432701
648 Ga0207706_11566268
649 Ga0207669_11015887
650 Ga0207704_10077521
651 Ga0207691_10029682
652 Ga0207711_10006267
653 Ga0207711_10322871
654 Ga0207661_10000002
655 Ga0207667_10011520
656 Ga0207667_10029315
657 Ga0207667_10232189
658 Ga0207667_10506453
659 Ga0207651_10211575
660 Ga0207668_10181221
661 Ga0207640_10066447
662 Ga0207640_10079919
663 Ga0207658_10000551
664 Ga0207703_11832796
665 Ga0207639_10014940
666 Ga0207639_10174172
667 Ga0207702_10000002
668 Ga0207702_10058373
669 Ga0207641_10318843
670 Ga0207674_10035480
671 Ga0207674_10036525
672 Ga0207675_100069139
673 Ga0207698_10018538
674 Ga0207698_10109072
675 Ga0207428_10331846
676 Ga0265338_10001292
677 Ga0265316_10531041
678 Ga0307508_10223576
679 Ga0307516_10210142
680 Ga0307516_10428245
681 Ga0307413_10015606
682 Ga0307413_11716223
683 Ga0307410_10014537
684 Ga0307410_10511415
685 Ga0307406_10006870
686 Ga0307412_10000403
687 Ga0307412_10004374
688 Ga0307409_100139931
689 Ga0307409_100154375
690 Ga0307416_101351818
691 Ga0307416_101395116
692 Ga0307414_10139252
693 Ga0307411_10570279
694 Ga0307510_10243474
695 Ga0373924_0104960
696 Ga0373935_0711414
697 Ga0373927_0064899
698 Ga0373927_0330969
699 Ga0373947_0066274
700 Ga0373937_0460211
701 Ga0373925_0123325
702 Ga0395900_0611925
703 Ga0395898_0000069
704 Ga0395898_0046274
705 Ga0395898_0633899
706 Ga0395905_0087632
707 Ga0395901_1887468
708 Ga0436361_0636518
709 Ga0451853_0346831
710 Ga0439432_164630
711 Ga0439450_199417
712 Ga0450888_067479
713 Ga0451577_0406956
714 Ga0451577_1140824
715 Ga0466969_0001473
716 Ga0466966_0007303
717 Ga0466961_0030016
718 Ga0453684_0330795
719 Ga0453684_0582139
720 Ga0466971_0091847
721 Ga0466970_0120415
722 Ga0466959_0847721
723 Ga0466958_0786159
724 Ga0466967_2142461
725 Ga0466967_2158366
726 Ga0495603_0040452
727 Ga0495590_0001159
728 Ga0495590_0214361
729 Ga0495629_0002103
730 Ga0495629_0008214
731 Ga0495629_0453515
732 Ga0495638_0000047
733 Ga0495651_0488419
734 Ga0495653_0001072
735 Ga0495653_0030079
736 Ga0495653_0152035
737 Ga0495650_0002203
738 Ga0495650_0008031
739 Ga0495650_0047109
740 Ga0495580_0131551
741 Ga0495582_0030950
742 Ga0495582_0085386
743 Ga0495605_0128337
744 Ga0495639_0077396
745 Ga0495662_0175327
746 Ga0495664_0169338
747 Ga0495664_0249838
748 Ga0495664_0478992
749 Ga0495584_0050207
750 Ga0495585_0125169
751 Ga0495596_0039387
752 Ga0495583_0001083
753 Ga0495606_0096953
754 Ga0495606_0366724
755 Ga0495608_0195826
756 Ga0495610_0023438
757 Ga0495628_0018832
758 Ga0495630_0008047
759 Ga0495630_0046692
760 Ga0495643_0000160
761 Ga0495648_0000019
762 Ga0495648_0501738
763 Ga0495642_0003905
764 Ga0495652_0006134
765 Ga0495654_0062663
766 Ga0495665_0000015
767 Ga0495665_0034780
768 Ga0495665_0475883
769 Ga0495586_0139914
770 Ga0495586_0285557
771 Ga0495609_0024578
772 Ga0495609_0024851
773 Ga0495597_0001887
774 Ga0495597_0006955
775 Ga0495645_0000238
776 Ga0495645_0008669
777 Ga0495645_0055693
778 Ga0495622_0000071
779 Ga0495633_0000077
780 Ga0495667_0249528
781 Ga0495656_0112847
782 Ga0495668_0698423
783 Ga0495634_0124025
784 Ga0495634_0436845
785 Ga0495625_0000447
786 Ga0495635_0022197
787 Ga0495588_0166166
788 Ga0495657_0371119
789 Ga0495599_0221932
790 Ga0495623_0004100
791 Ga0495623_0299521
792 Ga0495646_0000652
793 Ga0495646_0016576
794 Ga0495646_0400514
795 Ga0495647_0166604
796 Ga0495658_0289957
797 Ga0495669_0176246
798 Ga0495669_0344953
799 Ga0495669_0457848
800 Ga0495613_0009049
801 Ga0495624_0001634
802 Ga0495624_0495809
803 Ga0495670_0316194
804 Ga0495649_0012211
805 Ga0495649_0017723
806 Ga0495589_0003916
807 Ga0495589_0031567
808 Ga0495600_0101428
809 Ga0495660_0008470
810 Ga0495660_0086167
811 Ga0495581_0002045
812 Ga0495581_0094984
813 Ga0495674_0009227
814 Ga0495674_0020521
815 Ga0495674_0141015
816 Ga0495674_0573261
817 Ga0495672_0020134
818 Ga0495680_0012736
819 Ga0495680_0106869
820 Ga0495683_0009451
821 Ga0495683_0073548
822 Ga0495683_0097890
823 Ga0495687_000005
824 Ga0495687_000172
825 Ga0495687_007044
826 Ga0495681_0184495
827 Ga0495684_0493761
828 Ga0495686_0025442
829 Ga0495593_0000133
830 Ga0495602_0009012
831 Ga0495602_0113176
832 Ga0495626_0307871
833 Ga0496100_0015692
834 Ga0496100_0128792
835 Ga0496100_0794018
836 Ga0496101_0012004
837 Ga0496101_0251968
838 Ga0496102_0022504
839 Ga0496102_0214240
840 Ga0496102_0596241
841 Ga0496102_1109306
842 Ga0496103_0016864
843 Ga0496103_0224087
844 Ga0496103_0289879
845 Ga0496104_0024340
846 Ga0496105_0055448
847 Ga0496105_0071221
848 Ga0496105_0091086
849 Ga0496106_0000927
850 Ga0496106_0482163
851 Ga0496107_0011986
852 Ga0496108_0424873
853 Ga0496109_0349456
854 Ga0496109_0499632
855 Ga0496110_0005273
856 Ga0496110_0177993
857 Ga0496111_0408452
858 Ga0496112_0027280
859 Ga0496113_0052182
860 Ga0496113_0311212
861 Ga0496114_0011278
862 Ga0496114_0111384
863 Ga0496114_0827189
864 Ga0496115_0105671
865 Ga0496116_0008625
866 Ga0496116_0012173
867 Ga0496116_0215728
868 Ga0496116_0276127
869 Ga0496117_0018118
870 Ga0496117_0511245
871 Ga0496118_0000692
872 Ga0496118_0041023
873 Ga0496118_0130406
874 Ga0496119_0066367
875 Ga0496120_0199814
876 Ga0496121_0014098
877 Ga0496121_0132690
878 Ga0496121_0503456
879 Ga0496121_0679145
880 Ga0496122_0022670
881 Ga0496124_0015110
882 Ga0496124_0106290
883 Ga0496124_0269764
884 Ga0496125_0016492
885 Ga0496125_0138492
886 Ga0496125_0322219
887 Ga0495678_013126
888 Ga0495678_139707
889 Ga0495682_0225148
890 Ga0501032_0204630
891 Ga0501033_0002576
892 Ga0501034_0001752
893 Ga0501046_0000681
894 Ga0501047_0169969
895 Ga0501047_0246811
896 Ga0501048_0033584
897 Ga0501068_0059802
898 Ga0501069_0567032
899 Ga0501070_1027080
900 Ga0501073_0277345
901 Ga0501083_0013438
902 Ga0501035_0191925
903 Ga0501044_0004164
904 Ga0501044_0031553
905 nmdc:mga03683_111263_c1
906 nmdc:mga00v17_1036767_c1
907 nmdc:mga0k408_140244_c1
908 nmdc:mga0k408_566314_c1
909 nmdc:mga06z11_537535_c1
910 nmdc:mga0qj67_209526_c1
911 nmdc:mga08y16_148450_c1
912 nmdc:mga0a205_269415_c1
913 nmdc:mga0sz30_151384_c1
914 Ga0495612_0190889
915 Ga0500566_0397442
916 Ga0500634_0010102
917 Ga0500637_0206334
918 Ga0501084_0264337
919 Ga0466962_0011071
920 Ga0530510_0002166
921 2501080187
922 2501409894
923 2511089834
924 2511095225
925 2511104883
926 2512974870
927 2513603794
928 2514004248
929 2516016661
930 2599905202
931 2643858588
932 2643982369
933 2644121616
934 2644304180
935 2802718289
936 2802725917
937 2802736435
938 2802744409
939 2809034479
940 2819621268
941 2840882532
942 2857540029
943 2858953317
944 2881930567
945 2883090660
946 2900638957
947 2915981061
948 2916066016
949 2928109220
950 2928136443
951 2928503776
952 2937035990
953 2937038918
954 2937084845
955 2937088667
956 2945988393
957 2957376098
958 2957439685
959 2960592567
960 2960636048
961 2960681204
962 2960694003
963 2967691930
964 2967733326
965 2970029734
966 2970127277
967 2970145716
968 2977537208
969 2977550176
970 8004006234

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

12

146

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9954 2 144
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9909 2 144
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9883 2 144
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.988 1 144
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9839 2 144
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9952 2 144 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.988 2 144 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8986 4 142 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8682 3 139 3.30.530.20
2lghA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.855 3 139 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A023XIA1-F1-model_v4 deleted 1.002 1 147
AF-A0A0Q6VIA6-F1-model_v4 Toxin 1.002 1 147
AF-Q98IR1-F1-model_v4 Mlr2292 protein 1.002 1 147
AF-A0A656Z4X0-F1-model_v4 Polyketide cyclase 1.002 18 147
AF-A0A3S1ZYZ0-F1-model_v4 deleted 1.001 1 147

Map