F453083

General Info

Members Datasets Scaffolds Average Seq Length
485 188 970 262

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001108|Ga0105240_1000110824
Length 315
Sequence VSEGEGGGGGWSSEFNKGYAKIPHYRVAARVVFQPSVRRKPERRSRALSRRVAMKLPIRLFLMSLVVAGSANAAMVAKNLDYDVGGKKMQSVLVYDDAAKTPRPGLVMTPDWLGINADNIALAKQIAGKDYVVLVADVYGADVRPKNPDEAGAATKNMYAHRGDLRARIGAALDQLKAQGGKAPLDGKHWGAFGFCFGGATTLELARGAGEVAGVVSFHGNLASDPALKDNIKAKVLVLHGADDKFESPEQIAGFQQEMRDAGADWQFLSYGGAVHCFAIPTADGKVPGCKYDERTAKRAFAQMHQFFGEIFEAK

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
126 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
183 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
184 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 2.06
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 4.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10001108 3300009093 Bacteria 47413
2 Ga0070658_10055376 3300005327 Bacteria 3222
3 Ga0070658_10147278 3300005327 Bacteria 1969
4 Ga0070683_100155257 3300005329 Bacteria 2170
5 Ga0070690_100103371 3300005330 Bacteria 1892
6 Ga0070670_100228942 3300005331 Bacteria 1617
7 Ga0070670_100270805 3300005331 Bacteria 1482
8 Ga0070670_100522372 3300005331 Bacteria 1057
9 Ga0068869_100029264 3300005334 Bacteria 3858
10 Ga0070666_10000350 3300005335 Bacteria 28941
11 Ga0070666_10004180 3300005335 Bacteria 8765
12 Ga0070666_10010272 3300005335 Bacteria 5852
13 Ga0070666_10030930 3300005335 Bacteria 3531
14 Ga0070666_10040713 3300005335 Bacteria 3102
15 Ga0070666_10232308 3300005335 Bacteria 1303
16 Ga0070680_100070734 3300005336 Bacteria 2866
17 Ga0070680_100272889 3300005336 Bacteria 1432
18 Ga0068868_100027431 3300005338 Bacteria 4346
19 Ga0068868_100106401 3300005338 Bacteria 2275
20 Ga0070689_100162476 3300005340 Bacteria 1806
21 Ga0070661_100049777 3300005344 Bacteria 3067
22 Ga0070661_100051539 3300005344 Bacteria 3012
23 Ga0070661_100145344 3300005344 Bacteria 1790
24 Ga0070661_100216186 3300005344 Bacteria 1469
25 Ga0070661_100398244 3300005344 Bacteria 1088
26 Ga0070669_100012211 3300005353 Bacteria 6096
27 Ga0070675_100026753 3300005354 Bacteria 4629
28 Ga0070671_100031998 3300005355 Bacteria 4349
29 Ga0070674_100216187 3300005356 Bacteria 1489
30 Ga0070673_100021166 3300005364 Bacteria 4708
31 Ga0070673_100049802 3300005364 Bacteria 3272
32 Ga0070673_100432451 3300005364 Bacteria 1181
33 Ga0070659_100120149 3300005366 Bacteria 2127
34 Ga0070667_100013185 3300005367 Bacteria 6832
35 Ga0070667_100020046 3300005367 Bacteria 5552
36 Ga0070667_100035954 3300005367 Bacteria 4150
37 Ga0070667_100130138 3300005367 Bacteria 2196
38 Ga0070667_100133516 3300005367 Bacteria 2168
39 Ga0070667_100244330 3300005367 Bacteria 1604
40 Ga0070667_100289896 3300005367 Bacteria 1471
41 Ga0070667_100302831 3300005367 Unclassified 1439
42 Ga0070663_100000029 3300005455 Bacteria 82128
43 Ga0070663_100005153 3300005455 Bacteria 7738
44 Ga0070663_100054907 3300005455 Bacteria 2849
45 Ga0070663_100175004 3300005455 Bacteria 1661
46 Ga0070678_100052598 3300005456 Bacteria 2958
47 Ga0070678_100059527 3300005456 Bacteria 2808
48 Ga0070662_100004053 3300005457 Bacteria 9200
49 Ga0070662_100329555 3300005457 Unclassified 1247
50 Ga0070681_10243516 3300005458 Bacteria 1712
51 Ga0068867_100019447 3300005459 Bacteria 4838
52 Ga0070685_10008593 3300005466 Bacteria 5255
53 Ga0070685_10143348 3300005466 Bacteria 1507
54 Ga0070684_100156920 3300005535 Bacteria 2064
55 Ga0070684_100792660 3300005535 Bacteria 885
56 Ga0068853_100002537 3300005539 Bacteria 13707
57 Ga0068853_100033907 3300005539 Bacteria 4332
58 Ga0068853_100055188 3300005539 Bacteria 3424
59 Ga0068853_100063363 3300005539 Bacteria 3202
60 Ga0068853_100084095 3300005539 Bacteria 2788
61 Ga0068853_100102414 3300005539 Bacteria 2533
62 Ga0068853_100120728 3300005539 Bacteria 2338
63 Ga0070686_100043252 3300005544 Bacteria 2826
64 Ga0070693_100261801 3300005547 Bacteria 1151
65 Ga0070665_100000026 3300005548 Bacteria 365176
66 Ga0070665_100006914 3300005548 Bacteria 11528
67 Ga0070665_100010402 3300005548 Bacteria 9415
68 Ga0070665_100014732 3300005548 Bacteria 7845
69 Ga0070665_100023347 3300005548 Bacteria 6225
70 Ga0070665_100089521 3300005548 Bacteria 3083
71 Ga0070665_100117982 3300005548 Bacteria 2656
72 Ga0070665_100213401 3300005548 Bacteria 1931
73 Ga0070665_100500887 3300005548 Bacteria 1226
74 Ga0068855_100019339 3300005563 Bacteria 8183
75 Ga0068855_100087470 3300005563 Bacteria 3601
76 Ga0068855_100360917 3300005563 Bacteria 1598
77 Ga0068855_101080304 3300005563 Unclassified 840
78 Ga0070664_100067718 3300005564 Bacteria 3051
79 Ga0070664_100106960 3300005564 Bacteria 2438
80 Ga0070664_100631607 3300005564 Bacteria 995
81 Ga0068857_100084549 3300005577 Bacteria 2835
82 Ga0068857_100109360 3300005577 Bacteria 2484
83 Ga0068854_100012520 3300005578 Bacteria 5559
84 Ga0068856_100030997 3300005614 Bacteria 5230
85 Ga0068856_100156288 3300005614 Bacteria 2291
86 Ga0068852_100007256 3300005616 Bacteria 8083
87 Ga0068852_100058623 3300005616 Bacteria 3336
88 Ga0068852_100165405 3300005616 Bacteria 2069
89 Ga0068852_100209396 3300005616 Unclassified 1849
90 Ga0068852_100539988 3300005616 Unclassified 1165
91 Ga0068859_100001840 3300005617 Bacteria 21596
92 Ga0068859_100035642 3300005617 Bacteria 4993
93 Ga0068859_100091736 3300005617 Bacteria 3089
94 Ga0068859_100111193 3300005617 Bacteria 2802
95 Ga0068859_100313080 3300005617 Bacteria 1663
96 Ga0068859_100404674 3300005617 Bacteria 1461
97 Ga0068864_100007613 3300005618 Bacteria 8917
98 Ga0068864_100060869 3300005618 Bacteria 3269
99 Ga0068864_100521401 3300005618 Bacteria 1146
100 Ga0068861_100016689 3300005719 Bacteria 5201
101 Ga0068851_10000257 3300005834 Bacteria 25204
102 Ga0068863_100003420 3300005841 Bacteria 15650
103 Ga0068863_100015047 3300005841 Bacteria 7434
104 Ga0068863_100032202 3300005841 Bacteria 4997
105 Ga0068863_100054825 3300005841 Bacteria 3776
106 Ga0068863_100166170 3300005841 Bacteria 2116
107 Ga0068863_100398505 3300005841 Bacteria 1346
108 Ga0068863_100610877 3300005841 Bacteria 1080
109 Ga0068858_100089538 3300005842 Bacteria 2863
110 Ga0068860_100025094 3300005843 Bacteria 5753
111 Ga0068860_100060657 3300005843 Bacteria 3594
112 Ga0068860_100115366 3300005843 Bacteria 2569
113 Ga0068860_100207545 3300005843 Bacteria 1900
114 Ga0068862_100000185 3300005844 Bacteria 68550
115 Ga0081455_10090524 3300005937 Bacteria 2480
116 Ga0081540_1013631 3300005983 Bacteria 5272
117 Ga0070717_10463329 3300006028 Unclassified 1143
118 Ga0070712_100387365 3300006175 Bacteria 1152
119 Ga0097621_100105352 3300006237 Bacteria 2377
120 Ga0097621_100116278 3300006237 Unclassified 2265
121 Ga0097621_100138095 3300006237 Bacteria 2081
122 Ga0097621_100226603 3300006237 Bacteria 1631
123 Ga0068871_100036203 3300006358 Bacteria 3928
124 Ga0068871_100040939 3300006358 Bacteria 3713
125 Ga0068871_100073237 3300006358 Bacteria 2823
126 Ga0068871_100087030 3300006358 Bacteria 2597
127 Ga0068865_100001855 3300006881 Bacteria 12406
128 Ga0068865_100006246 3300006881 Bacteria 7254
129 Ga0068865_100018474 3300006881 Bacteria 4499
130 Ga0068865_100037794 3300006881 Bacteria 3262
131 Ga0068865_100078000 3300006881 Bacteria 2369
132 Ga0097620_100001840 3300006931 Bacteria 21596
133 Ga0097620_100035641 3300006931 Bacteria 4993
134 Ga0097620_100091732 3300006931 Bacteria 3089
135 Ga0097620_100111199 3300006931 Bacteria 2802
136 Ga0097620_100313097 3300006931 Bacteria 1663
137 Ga0097620_100404662 3300006931 Bacteria 1461
138 Ga0105240_10029279 3300009093 Bacteria 7179
139 Ga0105240_10066951 3300009093 Bacteria 4454
140 Ga0105240_10414510 3300009093 Bacteria 1515
141 Ga0105245_10191777 3300009098 Bacteria 1958
142 Ga0105245_10295514 3300009098 Bacteria 1588
143 Ga0105247_10078331 3300009101 Bacteria 2079
144 Ga0105241_10022873 3300009174 Bacteria 4634
145 Ga0105241_10050290 3300009174 Bacteria 3176
146 Ga0105241_10148384 3300009174 Bacteria 1916
147 Ga0105241_10758279 3300009174 Bacteria 890
148 Ga0105242_10011540 3300009176 Bacteria 6795
149 Ga0105242_10137652 3300009176 Bacteria 2115
150 Ga0105248_10000246 3300009177 Bacteria 62735
151 Ga0105248_10218952 3300009177 Bacteria 2144
152 Ga0105237_10000231 3300009545 Bacteria 79368
153 Ga0105237_10008060 3300009545 Bacteria 11456
154 Ga0105237_10054191 3300009545 Bacteria 4018
155 Ga0105237_10066189 3300009545 Bacteria 3609
156 Ga0105237_10247667 3300009545 Unclassified 1784
157 Ga0105237_10470162 3300009545 Bacteria 1263
158 Ga0105238_10002517 3300009551 Bacteria 18331
159 Ga0105238_10010512 3300009551 Bacteria 9291
160 Ga0105238_10011232 3300009551 Bacteria 9011
161 Ga0105238_10021215 3300009551 Bacteria 6620
162 Ga0105238_10062903 3300009551 Bacteria 3711
163 Ga0105238_10173779 3300009551 Bacteria 2131
164 Ga0105238_10312464 3300009551 Bacteria 1556
165 Ga0105249_10001225 3300009553 Bacteria 22566
166 Ga0105249_10003063 3300009553 Bacteria 14440
167 Ga0105249_10062410 3300009553 Bacteria 3422
168 Ga0105249_10169495 3300009553 Bacteria 2116
169 Ga0105239_10006133 3300010375 Bacteria 13987
170 Ga0105239_10007220 3300010375 Bacteria 12763
171 Ga0105239_10069261 3300010375 Bacteria 3877
172 Ga0105239_10095752 3300010375 Bacteria 3279
173 Ga0105239_10145809 3300010375 Bacteria 2640
174 Ga0105239_10192060 3300010375 Unclassified 2285
175 Ga0105246_10010675 3300011119 Bacteria 5689
176 Ga0157373_10134699 3300013100 Unclassified 1737
177 Ga0157370_10240645 3300013104 Bacteria 1674
178 Ga0157369_10000001 3300013105 Bacteria 554908
179 Ga0157369_10011883 3300013105 Bacteria 9890
180 Ga0157369_10331284 3300013105 Unclassified 1582
181 Ga0157374_10050922 3300013296 Bacteria 3852
182 Ga0157374_10084600 3300013296 Bacteria 3015
183 Ga0157374_10143304 3300013296 Bacteria 2320
184 Ga0157378_10088515 3300013297 Bacteria 2810
185 Ga0157378_10092472 3300013297 Unclassified 2752
186 Ga0163162_10000021 3300013306 Bacteria 214873
187 Ga0163162_10006211 3300013306 Bacteria 11575
188 Ga0163162_10029580 3300013306 Bacteria 5421
189 Ga0163162_10614302 3300013306 Unclassified 1213
190 Ga0157372_10001728 3300013307 Bacteria 23694
191 Ga0157372_10011884 3300013307 Bacteria 9277
192 Ga0157372_10033755 3300013307 Bacteria 5623
193 Ga0157372_10104863 3300013307 Bacteria 3233
194 Ga0157372_10138755 3300013307 Bacteria 2800
195 Ga0157375_10001711 3300013308 Bacteria 18837
196 Ga0157375_10101345 3300013308 Bacteria 2962
197 Ga0163163_10001486 3300014325 Bacteria 19850
198 Ga0163163_10004834 3300014325 Bacteria 11573
199 Ga0163163_10492291 3300014325 Bacteria 1288
200 Ga0157379_10003069 3300014968 Bacteria 14127
201 Ga0157379_10034516 3300014968 Bacteria 4510
202 Ga0157379_10127347 3300014968 Bacteria 2292
203 Ga0157379_10249583 3300014968 Bacteria 1611
204 Ga0157376_10011316 3300014969 Bacteria 6572
205 Ga0157376_10029837 3300014969 Bacteria 4347
206 Ga0157376_10065030 3300014969 Bacteria 3078
207 Ga0157376_10075155 3300014969 Bacteria 2883
208 Ga0157376_10209990 3300014969 Bacteria 1797
209 Ga0157376_10350206 3300014969 Bacteria 1413
210 Ga0209233_1002755 3300025261 Bacteria 6323
211 Ga0207697_10034652 3300025315 Bacteria 2066
212 Ga0207656_10000343 3300025321 Bacteria 15834
213 Ga0207656_10015685 3300025321 Bacteria 2937
214 Ga0207656_10046243 3300025321 Bacteria 1866
215 Ga0207680_10000092 3300025903 Bacteria 41687
216 Ga0207680_10005480 3300025903 Bacteria 6065
217 Ga0207680_10081471 3300025903 Bacteria 2035
218 Ga0207647_10002348 3300025904 Bacteria 14385
219 Ga0207645_10004975 3300025907 Bacteria 9742
220 Ga0207705_10043041 3300025909 Bacteria 3243
221 Ga0207654_10029181 3300025911 Bacteria 3016
222 Ga0207654_10055336 3300025911 Bacteria 2296
223 Ga0207707_10298575 3300025912 Bacteria 1393
224 Ga0207695_10000032 3300025913 Bacteria 521283
225 Ga0207695_10000256 3300025913 Bacteria 135850
226 Ga0207695_10071391 3300025913 Bacteria 3546
227 Ga0207695_10088961 3300025913 Bacteria 3107
228 Ga0207695_10148675 3300025913 Bacteria 2284
229 Ga0207671_10004399 3300025914 Bacteria 13503
230 Ga0207671_10051190 3300025914 Bacteria 3060
231 Ga0207671_10061903 3300025914 Unclassified 2778
232 Ga0207671_10169072 3300025914 Bacteria 1697
233 Ga0207671_10257638 3300025914 Bacteria 1372
234 Ga0207671_10445363 3300025914 Bacteria 1031
235 Ga0207663_10101082 3300025916 Bacteria 1937
236 Ga0207663_10133130 3300025916 Bacteria 1721
237 Ga0207649_10001915 3300025920 Bacteria 11887
238 Ga0207649_10031448 3300025920 Bacteria 3155
239 Ga0207649_10170402 3300025920 Bacteria 1516
240 Ga0207694_10000926 3300025924 Bacteria 25987
241 Ga0207694_10001219 3300025924 Bacteria 22303
242 Ga0207694_10001900 3300025924 Bacteria 17304
243 Ga0207694_10013702 3300025924 Bacteria 6110
244 Ga0207694_10046534 3300025924 Bacteria 3353
245 Ga0207694_10084565 3300025924 Bacteria 2496
246 Ga0207650_10237735 3300025925 Bacteria 1471
247 Ga0207659_10041806 3300025926 Bacteria 3211
248 Ga0207706_10004125 3300025933 Bacteria 13708
249 Ga0207706_10304113 3300025933 Bacteria 1389
250 Ga0207686_10052765 3300025934 Bacteria 2539
251 Ga0207704_10008111 3300025938 Bacteria 5000
252 Ga0207704_10024249 3300025938 Bacteria 3286
253 Ga0207704_10028670 3300025938 Bacteria 3092
254 Ga0207704_10053131 3300025938 Bacteria 2461
255 Ga0207691_10032229 3300025940 Bacteria 4887
256 Ga0207691_10089244 3300025940 Bacteria 2765
257 Ga0207711_10002283 3300025941 Bacteria 17214
258 Ga0207711_10054511 3300025941 Bacteria 3431
259 Ga0207689_10028174 3300025942 Bacteria 4698
260 Ga0207689_10045113 3300025942 Bacteria 3646
261 Ga0207689_10059186 3300025942 Bacteria 3151
262 Ga0207689_10588044 3300025942 Bacteria 936
263 Ga0207679_10095716 3300025945 Bacteria 2309
264 Ga0207679_10664819 3300025945 Bacteria 943
265 Ga0207667_10012246 3300025949 Bacteria 9905
266 Ga0207667_10079892 3300025949 Bacteria 3389
267 Ga0207667_10217811 3300025949 Bacteria 1956
268 Ga0207667_10329783 3300025949 Bacteria 1558
269 Ga0207712_10000189 3300025961 Bacteria 63193
270 Ga0207712_10016011 3300025961 Bacteria 4847
271 Ga0207712_10023327 3300025961 Bacteria 4082
272 Ga0207712_10050533 3300025961 Bacteria 2903
273 Ga0207712_10186858 3300025961 Unclassified 1632
274 Ga0207668_10004626 3300025972 Bacteria 8092
275 Ga0207668_10029954 3300025972 Bacteria 3572
276 Ga0207668_10099587 3300025972 Bacteria 2157
277 Ga0207668_10120103 3300025972 Bacteria 1989
278 Ga0207640_10018023 3300025981 Bacteria 4143
279 Ga0207640_10365503 3300025981 Bacteria 1164
280 Ga0207658_10000013 3300025986 Bacteria 220396
281 Ga0207658_10020312 3300025986 Bacteria 4599
282 Ga0207658_10138888 3300025986 Bacteria 1963
283 Ga0207677_10114115 3300026023 Bacteria 2018
284 Ga0207677_10235524 3300026023 Bacteria 1478
285 Ga0207677_10409442 3300026023 Bacteria 1152
286 Ga0207703_10070886 3300026035 Bacteria 2877
287 Ga0207639_10000240 3300026041 Bacteria 41113
288 Ga0207639_10004037 3300026041 Bacteria 9906
289 Ga0207639_10005312 3300026041 Bacteria 8698
290 Ga0207639_10029851 3300026041 Bacteria 3996
291 Ga0207639_10046036 3300026041 Bacteria 3289
292 Ga0207639_10074828 3300026041 Bacteria 2661
293 Ga0207639_10440508 3300026041 Bacteria 1181
294 Ga0207639_10645109 3300026041 Bacteria 979
295 Ga0207678_10000035 3300026067 Bacteria 104807
296 Ga0207678_10024086 3300026067 Bacteria 5319
297 Ga0207678_10033873 3300026067 Bacteria 4449
298 Ga0207678_10058337 3300026067 Bacteria 3321
299 Ga0207702_10026249 3300026078 Bacteria 4834
300 Ga0207702_10206904 3300026078 Bacteria 1822
301 Ga0207702_10275370 3300026078 Bacteria 1589
302 Ga0207641_10028141 3300026088 Bacteria 4642
303 Ga0207641_10056047 3300026088 Bacteria 3348
304 Ga0207641_10060774 3300026088 Bacteria 3221
305 Ga0207641_10191419 3300026088 Bacteria 1880
306 Ga0207648_10057420 3300026089 Bacteria 3396
307 Ga0207648_10097407 3300026089 Bacteria 2574
308 Ga0207676_10004232 3300026095 Bacteria 10136
309 Ga0207676_10060746 3300026095 Bacteria 2991
310 Ga0207676_10267635 3300026095 Unclassified 1546
311 Ga0207674_10001361 3300026116 Bacteria 31639
312 Ga0207674_10104996 3300026116 Bacteria 2803
313 Ga0207675_100039837 3300026118 Bacteria 4384
314 Ga0207683_10026726 3300026121 Bacteria 4985
315 Ga0207683_10029550 3300026121 Bacteria 4745
316 Ga0207683_10047621 3300026121 Bacteria 3754
317 Ga0207683_10127298 3300026121 Bacteria 2289
318 Ga0207698_10010163 3300026142 Bacteria 6031
319 Ga0207698_10025694 3300026142 Bacteria 4154
320 Ga0207698_10045485 3300026142 Bacteria 3308
321 Ga0268266_10000001 3300028379 Bacteria 4040580
322 Ga0268266_10000013 3300028379 Bacteria 649715
323 Ga0268266_10007656 3300028379 Bacteria 9712
324 Ga0268266_10077773 3300028379 Bacteria 2885
325 Ga0268266_10693524 3300028379 Bacteria 981
326 Ga0268265_10001042 3300028380 Bacteria 24942
327 Ga0268264_10009673 3300028381 Bacteria 7986
328 Ga0268264_10016619 3300028381 Bacteria 6025
329 Ga0268264_10135281 3300028381 Bacteria 2190
330 Ga0268264_10601653 3300028381 Bacteria 1083
331 Ga0307509_10118446 3300031507 Bacteria 2632
332 Ga0265313_10069956 3300031595 Bacteria 1619
333 Ga0307516_10019150 3300031730 Bacteria 7095
334 Ga0307516_10068531 3300031730 Bacteria 3416
335 Ga0373944_0002903 3300035089 Bacteria 4397
336 Ga0373923_0049174 3300035111 Bacteria 1763
337 Ga0373935_0061618 3300035692 Bacteria 2402
338 Ga0373937_0041464 3300036401 Bacteria 4198
339 Ga0451791_1508417 3300041451 Bacteria 1471
340 Ga0451793_0903364 3300041452 Bacteria 3147
341 Ga0451802_0737098 3300041460 Bacteria 1989
342 Ga0451804_0231991 3300041463 Bacteria 2534
343 Ga0451807_2221165 3300041486 Bacteria 2509
344 Ga0451851_0669231 3300041507 Bacteria 1063
345 Ga0451853_0205579 3300041512 Bacteria 2983
346 Ga0466972_0006856 3300044658 Bacteria 5716
347 Ga0466970_0003424 3300044765 Bacteria 7720
348 Ga0451576_0635429 3300045051 Bacteria 1122
349 Ga0466967_0754887 3300045976 Unclassified 965
350 Ga0495629_0264529 3300046459 Bacteria 1182
351 Ga0495582_0013180 3300046473 Bacteria 4549
352 Ga0495639_0002019 3300046475 Bacteria 8981
353 Ga0495586_0043419 3300046535 Bacteria 2422
354 Ga0495587_0359460 3300046536 Bacteria 811
355 Ga0495657_0068507 3300046675 Bacteria 2325
356 Ga0495581_0064269 3300047315 Bacteria 2120
357 Ga0495684_0079909 3300047471 Bacteria 2483
358 Ga0495686_0003123 3300047472 Bacteria 14636
359 Ga0496101_0233336 3300048904 Bacteria 1431
360 Ga0496102_0295454 3300048905 Bacteria 1527
361 Ga0496104_0000012 3300048907 Bacteria 438011
362 Ga0496105_0000011 3300048908 Bacteria 302186
363 Ga0496115_0137912 3300048918 Bacteria 2012
364 Ga0496117_0072554 3300048920 Bacteria 2300
365 Ga0496117_0136452 3300048920 Bacteria 1477
366 Ga0496117_0307559 3300048920 Bacteria 836
367 Ga0496118_0000356 3300048921 Bacteria 77474
368 Ga0496118_0012629 3300048921 Bacteria 8081
369 Ga0496121_0042942 3300048924 Bacteria 3923
370 Ga0496122_0000062 3300048925 Bacteria 241387
371 Ga0496123_0004387 3300048926 Bacteria 14875
372 Ga0496126_0334182 3300048929 Bacteria 1243
373 Ga0501031_0003044 3300049568 Bacteria 10718
374 Ga0501031_0006995 3300049568 Bacteria 7362
375 Ga0501031_0200686 3300049568 Bacteria 1301
376 Ga0501032_0000770 3300049569 Bacteria 25975
377 Ga0501032_0004115 3300049569 Bacteria 11019
378 Ga0501032_0037713 3300049569 Bacteria 3295
379 Ga0501032_0043374 3300049569 Bacteria 3047
380 Ga0501032_0053299 3300049569 Bacteria 2724
381 Ga0501033_0000634 3300049570 Bacteria 32447
382 Ga0501033_0107078 3300049570 Bacteria 2036
383 Ga0501034_0001449 3300049571 Bacteria 31438
384 Ga0501034_0012545 3300049571 Bacteria 8748
385 Ga0501034_0022631 3300049571 Bacteria 6402
386 Ga0501034_0405679 3300049571 Bacteria 1285
387 Ga0501036_0010967 3300049572 Bacteria 7493
388 Ga0501036_0052249 3300049572 Bacteria 3461
389 Ga0501036_0149893 3300049572 Bacteria 1967
390 Ga0501037_0002152 3300049573 Bacteria 14263
391 Ga0501037_0063889 3300049573 Bacteria 2683
392 Ga0501038_0007689 3300049574 Bacteria 9937
393 Ga0501038_0141910 3300049574 Bacteria 1964
394 Ga0501039_0025605 3300049575 Bacteria 4534
395 Ga0501039_0026347 3300049575 Bacteria 4467
396 Ga0501042_0186240 3300049578 Bacteria 1497
397 Ga0501043_0010157 3300049579 Bacteria 7379
398 Ga0501043_0017476 3300049579 Bacteria 5622
399 Ga0501043_0032194 3300049579 Bacteria 4121
400 Ga0501043_0041406 3300049579 Bacteria 3619
401 Ga0501043_0257395 3300049579 Bacteria 1343
402 Ga0501046_0003892 3300049580 Bacteria 13652
403 Ga0501046_0004386 3300049580 Bacteria 12826
404 Ga0501046_0006043 3300049580 Bacteria 10768
405 Ga0501046_0010702 3300049580 Bacteria 7869
406 Ga0501046_0110092 3300049580 Bacteria 2105
407 Ga0501047_0000250 3300049581 Bacteria 63699
408 Ga0501047_0002878 3300049581 Bacteria 16325
409 Ga0501047_0017238 3300049581 Bacteria 6914
410 Ga0501047_0033493 3300049581 Bacteria 4959
411 Ga0501047_0039356 3300049581 Bacteria 4574
412 Ga0501047_0110249 3300049581 Bacteria 2635
413 Ga0501047_0312048 3300049581 Bacteria 1413
414 Ga0501047_0404307 3300049581 Bacteria 1198
415 Ga0501048_0024152 3300049582 Bacteria 4437
416 Ga0501048_0032677 3300049582 Bacteria 3761
417 Ga0501048_0091969 3300049582 Bacteria 2139
418 Ga0501067_0000659 3300049583 Bacteria 18522
419 Ga0501067_0008758 3300049583 Bacteria 5605
420 Ga0501067_0227735 3300049583 Bacteria 1038
421 Ga0501068_0024565 3300049584 Bacteria 3540
422 Ga0501068_0044203 3300049584 Bacteria 2682
423 Ga0501069_0000156 3300049585 Bacteria 30035
424 Ga0501069_0005272 3300049585 Bacteria 6716
425 Ga0501069_0076598 3300049585 Bacteria 1881
426 Ga0501070_0022613 3300049586 Bacteria 5264
427 Ga0501070_0026522 3300049586 Bacteria 4860
428 Ga0501070_0043513 3300049586 Bacteria 3736
429 Ga0501070_0092526 3300049586 Bacteria 2502
430 Ga0501070_0099763 3300049586 Bacteria 2402
431 Ga0501070_0250960 3300049586 Bacteria 1447
432 Ga0501071_0018579 3300049587 Bacteria 4816
433 Ga0501071_0319436 3300049587 Bacteria 1179
434 Ga0501072_0033160 3300049588 Bacteria 4046
435 Ga0501073_0013036 3300049589 Bacteria 6062
436 Ga0501073_0047353 3300049589 Bacteria 3022
437 Ga0501073_0052804 3300049589 Bacteria 2845
438 Ga0501073_0060721 3300049589 Bacteria 2638
439 Ga0501073_0111391 3300049589 Bacteria 1898
440 Ga0501073_0145754 3300049589 Bacteria 1641
441 Ga0501074_0008498 3300049590 Bacteria 7440
442 Ga0501074_0013651 3300049590 Bacteria 5904
443 Ga0501074_0048284 3300049590 Bacteria 3075
444 Ga0501074_0051069 3300049590 Unclassified 2984
445 Ga0501074_0051608 3300049590 Bacteria 2968
446 Ga0501074_0056382 3300049590 Bacteria 2831
447 Ga0501079_0073754 3300049741 Bacteria 2638
448 Ga0501079_0092873 3300049741 Bacteria 2338
449 Ga0501079_0130367 3300049741 Bacteria 1956
450 Ga0501079_0311509 3300049741 Bacteria 1232
451 Ga0501080_0000306 3300049742 Bacteria 37439
452 Ga0501080_0000320 3300049742 Bacteria 36678
453 Ga0501080_0004331 3300049742 Bacteria 12602
454 Ga0501080_0016268 3300049742 Bacteria 6868
455 Ga0501080_0060745 3300049742 Bacteria 3518
456 Ga0501080_0161159 3300049742 Bacteria 2071
457 Ga0501080_0258360 3300049742 Bacteria 1587
458 Ga0501081_0081570 3300049743 Bacteria 2265
459 Ga0501083_0003228 3300049744 Bacteria 11370
460 Ga0501083_0027898 3300049744 Bacteria 3893
461 Ga0501083_0097391 3300049744 Bacteria 1941
462 Ga0501083_0140153 3300049744 Bacteria 1584
463 Ga0501035_0007087 3300049822 Bacteria 10481
464 Ga0501035_0032049 3300049822 Bacteria 4784
465 Ga0501035_0057411 3300049822 Bacteria 3470
466 Ga0501035_0122672 3300049822 Bacteria 2270
467 Ga0501044_0009241 3300049823 Bacteria 10765
468 Ga0501044_0034783 3300049823 Bacteria 5281
469 Ga0501044_0036920 3300049823 Bacteria 5109
470 Ga0501044_0183059 3300049823 Bacteria 2061
471 Ga0501044_0187056 3300049823 Bacteria 2035
472 Ga0501044_0391209 3300049823 Bacteria 1304
473 Ga0501045_0008982 3300049824 Bacteria 6980
474 Ga0501045_0505480 3300049824 Bacteria 897
475 Ga0500610_0005485 3300053079 Bacteria 5204
476 Ga0500651_0034143 3300053093 Bacteria 3207
477 Ga0500597_000019 3300053120 Bacteria 34589
478 Ga0500568_0001625 3300053139 Bacteria 14171
479 Ga0501084_0036048 3300054114 Bacteria 4133
480 Ga0501084_0050991 3300054114 Bacteria 3463
481 Ga0501084_0161105 3300054114 Unclassified 1893
482 Ga0501082_0000394 3300060353 Bacteria 38764
483 Ga0501082_0015773 3300060353 Bacteria 6498
484 Ga0501082_0147684 3300060353 Unclassified 2041
485 Ga0530510_0264118 3300061734 Bacteria 1284
486 Ga0105240_10001108
487 Ga0070658_10055376
488 Ga0070658_10147278
489 Ga0070683_100155257
490 Ga0070690_100103371
491 Ga0070670_100228942
492 Ga0070670_100270805
493 Ga0070670_100522372
494 Ga0068869_100029264
495 Ga0070666_10000350
496 Ga0070666_10004180
497 Ga0070666_10010272
498 Ga0070666_10030930
499 Ga0070666_10040713
500 Ga0070666_10232308
501 Ga0070680_100070734
502 Ga0070680_100272889
503 Ga0068868_100027431
504 Ga0068868_100106401
505 Ga0070689_100162476
506 Ga0070661_100049777
507 Ga0070661_100051539
508 Ga0070661_100145344
509 Ga0070661_100216186
510 Ga0070661_100398244
511 Ga0070669_100012211
512 Ga0070675_100026753
513 Ga0070671_100031998
514 Ga0070674_100216187
515 Ga0070673_100021166
516 Ga0070673_100049802
517 Ga0070673_100432451
518 Ga0070659_100120149
519 Ga0070667_100013185
520 Ga0070667_100020046
521 Ga0070667_100035954
522 Ga0070667_100130138
523 Ga0070667_100133516
524 Ga0070667_100244330
525 Ga0070667_100289896
526 Ga0070667_100302831
527 Ga0070663_100000029
528 Ga0070663_100005153
529 Ga0070663_100054907
530 Ga0070663_100175004
531 Ga0070678_100052598
532 Ga0070678_100059527
533 Ga0070662_100004053
534 Ga0070662_100329555
535 Ga0070681_10243516
536 Ga0068867_100019447
537 Ga0070685_10008593
538 Ga0070685_10143348
539 Ga0070684_100156920
540 Ga0070684_100792660
541 Ga0068853_100002537
542 Ga0068853_100033907
543 Ga0068853_100055188
544 Ga0068853_100063363
545 Ga0068853_100084095
546 Ga0068853_100102414
547 Ga0068853_100120728
548 Ga0070686_100043252
549 Ga0070693_100261801
550 Ga0070665_100000026
551 Ga0070665_100006914
552 Ga0070665_100010402
553 Ga0070665_100014732
554 Ga0070665_100023347
555 Ga0070665_100089521
556 Ga0070665_100117982
557 Ga0070665_100213401
558 Ga0070665_100500887
559 Ga0068855_100019339
560 Ga0068855_100087470
561 Ga0068855_100360917
562 Ga0068855_101080304
563 Ga0070664_100067718
564 Ga0070664_100106960
565 Ga0070664_100631607
566 Ga0068857_100084549
567 Ga0068857_100109360
568 Ga0068854_100012520
569 Ga0068856_100030997
570 Ga0068856_100156288
571 Ga0068852_100007256
572 Ga0068852_100058623
573 Ga0068852_100165405
574 Ga0068852_100209396
575 Ga0068852_100539988
576 Ga0068859_100001840
577 Ga0068859_100035642
578 Ga0068859_100091736
579 Ga0068859_100111193
580 Ga0068859_100313080
581 Ga0068859_100404674
582 Ga0068864_100007613
583 Ga0068864_100060869
584 Ga0068864_100521401
585 Ga0068861_100016689
586 Ga0068851_10000257
587 Ga0068863_100003420
588 Ga0068863_100015047
589 Ga0068863_100032202
590 Ga0068863_100054825
591 Ga0068863_100166170
592 Ga0068863_100398505
593 Ga0068863_100610877
594 Ga0068858_100089538
595 Ga0068860_100025094
596 Ga0068860_100060657
597 Ga0068860_100115366
598 Ga0068860_100207545
599 Ga0068862_100000185
600 Ga0081455_10090524
601 Ga0081540_1013631
602 Ga0070717_10463329
603 Ga0070712_100387365
604 Ga0097621_100105352
605 Ga0097621_100116278
606 Ga0097621_100138095
607 Ga0097621_100226603
608 Ga0068871_100036203
609 Ga0068871_100040939
610 Ga0068871_100073237
611 Ga0068871_100087030
612 Ga0068865_100001855
613 Ga0068865_100006246
614 Ga0068865_100018474
615 Ga0068865_100037794
616 Ga0068865_100078000
617 Ga0097620_100001840
618 Ga0097620_100035641
619 Ga0097620_100091732
620 Ga0097620_100111199
621 Ga0097620_100313097
622 Ga0097620_100404662
623 Ga0105240_10029279
624 Ga0105240_10066951
625 Ga0105240_10414510
626 Ga0105245_10191777
627 Ga0105245_10295514
628 Ga0105247_10078331
629 Ga0105241_10022873
630 Ga0105241_10050290
631 Ga0105241_10148384
632 Ga0105241_10758279
633 Ga0105242_10011540
634 Ga0105242_10137652
635 Ga0105248_10000246
636 Ga0105248_10218952
637 Ga0105237_10000231
638 Ga0105237_10008060
639 Ga0105237_10054191
640 Ga0105237_10066189
641 Ga0105237_10247667
642 Ga0105237_10470162
643 Ga0105238_10002517
644 Ga0105238_10010512
645 Ga0105238_10011232
646 Ga0105238_10021215
647 Ga0105238_10062903
648 Ga0105238_10173779
649 Ga0105238_10312464
650 Ga0105249_10001225
651 Ga0105249_10003063
652 Ga0105249_10062410
653 Ga0105249_10169495
654 Ga0105239_10006133
655 Ga0105239_10007220
656 Ga0105239_10069261
657 Ga0105239_10095752
658 Ga0105239_10145809
659 Ga0105239_10192060
660 Ga0105246_10010675
661 Ga0157373_10134699
662 Ga0157370_10240645
663 Ga0157369_10000001
664 Ga0157369_10011883
665 Ga0157369_10331284
666 Ga0157374_10050922
667 Ga0157374_10084600
668 Ga0157374_10143304
669 Ga0157378_10088515
670 Ga0157378_10092472
671 Ga0163162_10000021
672 Ga0163162_10006211
673 Ga0163162_10029580
674 Ga0163162_10614302
675 Ga0157372_10001728
676 Ga0157372_10011884
677 Ga0157372_10033755
678 Ga0157372_10104863
679 Ga0157372_10138755
680 Ga0157375_10001711
681 Ga0157375_10101345
682 Ga0163163_10001486
683 Ga0163163_10004834
684 Ga0163163_10492291
685 Ga0157379_10003069
686 Ga0157379_10034516
687 Ga0157379_10127347
688 Ga0157379_10249583
689 Ga0157376_10011316
690 Ga0157376_10029837
691 Ga0157376_10065030
692 Ga0157376_10075155
693 Ga0157376_10209990
694 Ga0157376_10350206
695 Ga0209233_1002755
696 Ga0207697_10034652
697 Ga0207656_10000343
698 Ga0207656_10015685
699 Ga0207656_10046243
700 Ga0207680_10000092
701 Ga0207680_10005480
702 Ga0207680_10081471
703 Ga0207647_10002348
704 Ga0207645_10004975
705 Ga0207705_10043041
706 Ga0207654_10029181
707 Ga0207654_10055336
708 Ga0207707_10298575
709 Ga0207695_10000032
710 Ga0207695_10000256
711 Ga0207695_10071391
712 Ga0207695_10088961
713 Ga0207695_10148675
714 Ga0207671_10004399
715 Ga0207671_10051190
716 Ga0207671_10061903
717 Ga0207671_10169072
718 Ga0207671_10257638
719 Ga0207671_10445363
720 Ga0207663_10101082
721 Ga0207663_10133130
722 Ga0207649_10001915
723 Ga0207649_10031448
724 Ga0207649_10170402
725 Ga0207694_10000926
726 Ga0207694_10001219
727 Ga0207694_10001900
728 Ga0207694_10013702
729 Ga0207694_10046534
730 Ga0207694_10084565
731 Ga0207650_10237735
732 Ga0207659_10041806
733 Ga0207706_10004125
734 Ga0207706_10304113
735 Ga0207686_10052765
736 Ga0207704_10008111
737 Ga0207704_10024249
738 Ga0207704_10028670
739 Ga0207704_10053131
740 Ga0207691_10032229
741 Ga0207691_10089244
742 Ga0207711_10002283
743 Ga0207711_10054511
744 Ga0207689_10028174
745 Ga0207689_10045113
746 Ga0207689_10059186
747 Ga0207689_10588044
748 Ga0207679_10095716
749 Ga0207679_10664819
750 Ga0207667_10012246
751 Ga0207667_10079892
752 Ga0207667_10217811
753 Ga0207667_10329783
754 Ga0207712_10000189
755 Ga0207712_10016011
756 Ga0207712_10023327
757 Ga0207712_10050533
758 Ga0207712_10186858
759 Ga0207668_10004626
760 Ga0207668_10029954
761 Ga0207668_10099587
762 Ga0207668_10120103
763 Ga0207640_10018023
764 Ga0207640_10365503
765 Ga0207658_10000013
766 Ga0207658_10020312
767 Ga0207658_10138888
768 Ga0207677_10114115
769 Ga0207677_10235524
770 Ga0207677_10409442
771 Ga0207703_10070886
772 Ga0207639_10000240
773 Ga0207639_10004037
774 Ga0207639_10005312
775 Ga0207639_10029851
776 Ga0207639_10046036
777 Ga0207639_10074828
778 Ga0207639_10440508
779 Ga0207639_10645109
780 Ga0207678_10000035
781 Ga0207678_10024086
782 Ga0207678_10033873
783 Ga0207678_10058337
784 Ga0207702_10026249
785 Ga0207702_10206904
786 Ga0207702_10275370
787 Ga0207641_10028141
788 Ga0207641_10056047
789 Ga0207641_10060774
790 Ga0207641_10191419
791 Ga0207648_10057420
792 Ga0207648_10097407
793 Ga0207676_10004232
794 Ga0207676_10060746
795 Ga0207676_10267635
796 Ga0207674_10001361
797 Ga0207674_10104996
798 Ga0207675_100039837
799 Ga0207683_10026726
800 Ga0207683_10029550
801 Ga0207683_10047621
802 Ga0207683_10127298
803 Ga0207698_10010163
804 Ga0207698_10025694
805 Ga0207698_10045485
806 Ga0268266_10000001
807 Ga0268266_10000013
808 Ga0268266_10007656
809 Ga0268266_10077773
810 Ga0268266_10693524
811 Ga0268265_10001042
812 Ga0268264_10009673
813 Ga0268264_10016619
814 Ga0268264_10135281
815 Ga0268264_10601653
816 Ga0307509_10118446
817 Ga0265313_10069956
818 Ga0307516_10019150
819 Ga0307516_10068531
820 Ga0373944_0002903
821 Ga0373923_0049174
822 Ga0373935_0061618
823 Ga0373937_0041464
824 Ga0451791_1508417
825 Ga0451793_0903364
826 Ga0451802_0737098
827 Ga0451804_0231991
828 Ga0451807_2221165
829 Ga0451851_0669231
830 Ga0451853_0205579
831 Ga0466972_0006856
832 Ga0466970_0003424
833 Ga0451576_0635429
834 Ga0466967_0754887
835 Ga0495629_0264529
836 Ga0495582_0013180
837 Ga0495639_0002019
838 Ga0495586_0043419
839 Ga0495587_0359460
840 Ga0495657_0068507
841 Ga0495581_0064269
842 Ga0495684_0079909
843 Ga0495686_0003123
844 Ga0496101_0233336
845 Ga0496102_0295454
846 Ga0496104_0000012
847 Ga0496105_0000011
848 Ga0496115_0137912
849 Ga0496117_0072554
850 Ga0496117_0136452
851 Ga0496117_0307559
852 Ga0496118_0000356
853 Ga0496118_0012629
854 Ga0496121_0042942
855 Ga0496122_0000062
856 Ga0496123_0004387
857 Ga0496126_0334182
858 Ga0501031_0003044
859 Ga0501031_0006995
860 Ga0501031_0200686
861 Ga0501032_0000770
862 Ga0501032_0004115
863 Ga0501032_0037713
864 Ga0501032_0043374
865 Ga0501032_0053299
866 Ga0501033_0000634
867 Ga0501033_0107078
868 Ga0501034_0001449
869 Ga0501034_0012545
870 Ga0501034_0022631
871 Ga0501034_0405679
872 Ga0501036_0010967
873 Ga0501036_0052249
874 Ga0501036_0149893
875 Ga0501037_0002152
876 Ga0501037_0063889
877 Ga0501038_0007689
878 Ga0501038_0141910
879 Ga0501039_0025605
880 Ga0501039_0026347
881 Ga0501042_0186240
882 Ga0501043_0010157
883 Ga0501043_0017476
884 Ga0501043_0032194
885 Ga0501043_0041406
886 Ga0501043_0257395
887 Ga0501046_0003892
888 Ga0501046_0004386
889 Ga0501046_0006043
890 Ga0501046_0010702
891 Ga0501046_0110092
892 Ga0501047_0000250
893 Ga0501047_0002878
894 Ga0501047_0017238
895 Ga0501047_0033493
896 Ga0501047_0039356
897 Ga0501047_0110249
898 Ga0501047_0312048
899 Ga0501047_0404307
900 Ga0501048_0024152
901 Ga0501048_0032677
902 Ga0501048_0091969
903 Ga0501067_0000659
904 Ga0501067_0008758
905 Ga0501067_0227735
906 Ga0501068_0024565
907 Ga0501068_0044203
908 Ga0501069_0000156
909 Ga0501069_0005272
910 Ga0501069_0076598
911 Ga0501070_0022613
912 Ga0501070_0026522
913 Ga0501070_0043513
914 Ga0501070_0092526
915 Ga0501070_0099763
916 Ga0501070_0250960
917 Ga0501071_0018579
918 Ga0501071_0319436
919 Ga0501072_0033160
920 Ga0501073_0013036
921 Ga0501073_0047353
922 Ga0501073_0052804
923 Ga0501073_0060721
924 Ga0501073_0111391
925 Ga0501073_0145754
926 Ga0501074_0008498
927 Ga0501074_0013651
928 Ga0501074_0048284
929 Ga0501074_0051069
930 Ga0501074_0051608
931 Ga0501074_0056382
932 Ga0501079_0073754
933 Ga0501079_0092873
934 Ga0501079_0130367
935 Ga0501079_0311509
936 Ga0501080_0000306
937 Ga0501080_0000320
938 Ga0501080_0004331
939 Ga0501080_0016268
940 Ga0501080_0060745
941 Ga0501080_0161159
942 Ga0501080_0258360
943 Ga0501081_0081570
944 Ga0501083_0003228
945 Ga0501083_0027898
946 Ga0501083_0097391
947 Ga0501083_0140153
948 Ga0501035_0007087
949 Ga0501035_0032049
950 Ga0501035_0057411
951 Ga0501035_0122672
952 Ga0501044_0009241
953 Ga0501044_0034783
954 Ga0501044_0036920
955 Ga0501044_0183059
956 Ga0501044_0187056
957 Ga0501044_0391209
958 Ga0501045_0008982
959 Ga0501045_0505480
960 Ga0500610_0005485
961 Ga0500651_0034143
962 Ga0500597_000019
963 Ga0500568_0001625
964 Ga0501084_0036048
965 Ga0501084_0050991
966 Ga0501084_0161105
967 Ga0501082_0000394
968 Ga0501082_0015773
969 Ga0501082_0147684
970 Ga0530510_0264118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

89

312

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.9358 21 261
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.9327 21 261
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.9261 21 261
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.9246 21 261
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.9216 21 261
ID Description Score Start End Superfamily
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9326 21 261 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9215 21 261 3.40.50.1820
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9014 21 261 3.40.50.1820
af_O17263_18_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8989 19 259 3.40.50.1820
af_Q18925_2_245_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8966 23 261 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0H2X7E6-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9728 21 262 GO:0016787
AF-A0A6N3UBH8-F1-model_v4 deleted 0.971 98 261
AF-W4SH93-F1-model_v4 Carboxymethylenebutenolidase (EC 3.1.1.45) 0.9706 22 261 GO:0008806
AF-H8FID6-F1-model_v4 deleted 0.9697 40 262
AF-A0A0L7TIQ4-F1-model_v4 DeoR faimly transcriptional regulator 0.968 142 260 GO:0016787

Map