F453095

General Info

Members Datasets Scaffolds Average Seq Length
485 290 970 245

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10129317|Ga0105246_101293173
Length 269
Sequence MYRMVRQRHPVGNRLSASYGATMTRRAFDLWSPAVGGSGGVLAYGTWGRPVLVFPSEAGKASDFESNGMVDAIADLLDAGRVKLYCVDSYDSASWSDRGIPLEERARRHGAYESWILDQVAPWIHDDCGGPLPILTLGASMGAYHAANFALRRADLFPQALCLSGNYDPSTWHGWGEQGDALYYQNPTAYVANLHGDHLAWLRHHVHLTLVCGQGMWEDTTGAQASTRKLAGLLAEKDIPHELDVWGHDVAHDWPWWRRQLTHHLSAMS

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
103 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
194 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
224 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
225 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
226 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
227 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
228 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
229 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
230 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
231 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
276 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
277 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
289 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
290 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.41
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 5.77
Rhizosphere 89.48
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10129317 3300011119 Bacteria 1883
2 JGI25404J52841_10002154 3300003659 Bacteria 3674
3 JGI25405J52794_10029790 3300003911 Bacteria 1130
4 Ga0070658_10285506 3300005327 Bacteria 1405
5 Ga0070676_10504206 3300005328 Bacteria 860
6 Ga0070683_100000838 3300005329 Bacteria 22807
7 Ga0070670_100358826 3300005331 Bacteria 1281
8 Ga0068869_100184290 3300005334 Bacteria 1638
9 Ga0070666_10047520 3300005335 Bacteria 2881
10 Ga0070666_10061118 3300005335 Bacteria 2550
11 Ga0070680_100089831 3300005336 Bacteria 2542
12 Ga0070682_100048588 3300005337 Bacteria 2642
13 Ga0070682_100064254 3300005337 Bacteria 2329
14 Ga0070682_100141928 3300005337 Bacteria 1638
15 Ga0070682_100169093 3300005337 Bacteria 1517
16 Ga0070682_100278560 3300005337 Bacteria 1218
17 Ga0070682_100403405 3300005337 Bacteria 1034
18 Ga0070660_100022057 3300005339 Bacteria 4704
19 Ga0070660_100028728 3300005339 Bacteria 4163
20 Ga0070689_100032317 3300005340 Bacteria 3979
21 Ga0070689_100065746 3300005340 Bacteria 2825
22 Ga0070691_10080679 3300005341 Bacteria 1592
23 Ga0070691_10104728 3300005341 Bacteria 1409
24 Ga0070661_100042663 3300005344 Bacteria 3311
25 Ga0070661_100130564 3300005344 Bacteria 1886
26 Ga0070661_100375215 3300005344 Bacteria 1120
27 Ga0070692_10070638 3300005345 Bacteria 1859
28 Ga0070692_10122125 3300005345 Bacteria 1454
29 Ga0070668_100094717 3300005347 Bacteria 2358
30 Ga0070668_100123922 3300005347 Bacteria 2068
31 Ga0070669_100181271 3300005353 Bacteria 1648
32 Ga0070669_100520713 3300005353 Bacteria 989
33 Ga0070675_100110840 3300005354 Bacteria 2321
34 Ga0070675_100119285 3300005354 Bacteria 2240
35 Ga0070671_100124623 3300005355 Bacteria 2169
36 Ga0070671_100392429 3300005355 Bacteria 1187
37 Ga0070674_100015544 3300005356 Bacteria 4753
38 Ga0070674_100033620 3300005356 Bacteria 3415
39 Ga0070673_100021002 3300005364 Bacteria 4722
40 Ga0070673_100022760 3300005364 Bacteria 4567
41 Ga0070673_100182986 3300005364 Bacteria 1795
42 Ga0070659_100011248 3300005366 Bacteria 6611
43 Ga0070667_100027816 3300005367 Bacteria 4706
44 Ga0070667_100070070 3300005367 Bacteria 2985
45 Ga0070709_10043859 3300005434 Bacteria 2767
46 Ga0070709_10073938 3300005434 Bacteria 2208
47 Ga0070714_100026049 3300005435 Bacteria 4831
48 Ga0070714_100153425 3300005435 Bacteria 2077
49 Ga0070714_100365803 3300005435 Bacteria 1357
50 Ga0070713_100166858 3300005436 Bacteria 1969
51 Ga0070713_100171340 3300005436 Bacteria 1945
52 Ga0070713_100556118 3300005436 Bacteria 1087
53 Ga0070710_10026660 3300005437 Bacteria 3073
54 Ga0070710_10154011 3300005437 Bacteria 1420
55 Ga0070701_10158409 3300005438 Bacteria 1309
56 Ga0070711_100014605 3300005439 Bacteria 4949
57 Ga0070711_100018217 3300005439 Bacteria 4480
58 Ga0070705_100041278 3300005440 Bacteria 2629
59 Ga0070700_100028288 3300005441 Bacteria 3332
60 Ga0070663_100016253 3300005455 Bacteria 4827
61 Ga0070678_100018429 3300005456 Bacteria 4523
62 Ga0070678_100451102 3300005456 Bacteria 1126
63 Ga0070662_100057315 3300005457 Bacteria 2831
64 Ga0070662_100164452 3300005457 Bacteria 1738
65 Ga0070681_10113311 3300005458 Bacteria 2651
66 Ga0068867_100068955 3300005459 Bacteria 2640
67 Ga0070685_10154119 3300005466 Bacteria 1459
68 Ga0070706_100136900 3300005467 Bacteria 2286
69 Ga0070679_100080220 3300005530 Bacteria 3252
70 Ga0070684_100002112 3300005535 Bacteria 14646
71 Ga0070684_100032575 3300005535 Bacteria 4442
72 Ga0070684_100214378 3300005535 Bacteria 1755
73 Ga0070697_100056457 3300005536 Bacteria 3195
74 Ga0068853_100021234 3300005539 Bacteria 5409
75 Ga0068853_100069790 3300005539 Bacteria 3058
76 Ga0070672_100069350 3300005543 Bacteria 2799
77 Ga0070672_100076155 3300005543 Bacteria 2680
78 Ga0070686_100253753 3300005544 Bacteria 1286
79 Ga0070695_100379222 3300005545 Bacteria 1066
80 Ga0070696_100061356 3300005546 Bacteria 2630
81 Ga0070693_100005265 3300005547 Bacteria 6194
82 Ga0070693_100026933 3300005547 Bacteria 3108
83 Ga0070665_100219140 3300005548 Bacteria 1903
84 Ga0070704_100107592 3300005549 Bacteria 2115
85 Ga0070704_100283108 3300005549 Bacteria 1374
86 Ga0070664_100094378 3300005564 Bacteria 2594
87 Ga0070664_100247552 3300005564 Bacteria 1601
88 Ga0068857_100143737 3300005577 Bacteria 2158
89 Ga0068854_100011823 3300005578 Bacteria 5699
90 Ga0068854_100175235 3300005578 Bacteria 1671
91 Ga0068856_100036503 3300005614 Bacteria 4818
92 Ga0070702_100001720 3300005615 Bacteria 9089
93 Ga0070702_100004631 3300005615 Bacteria 6306
94 Ga0070702_100191358 3300005615 Bacteria 1347
95 Ga0068859_100053587 3300005617 Bacteria 4057
96 Ga0068859_100221137 3300005617 Bacteria 1981
97 Ga0068859_101018376 3300005617 Bacteria 910
98 Ga0068864_100100041 3300005618 Bacteria 2570
99 Ga0068864_100114256 3300005618 Bacteria 2407
100 Ga0068866_10093132 3300005718 Bacteria 1645
101 Ga0068861_100037809 3300005719 Bacteria 3589
102 Ga0068861_100038802 3300005719 Bacteria 3551
103 Ga0068851_10054886 3300005834 Bacteria 2030
104 Ga0068870_10193304 3300005840 Bacteria 1229
105 Ga0068870_10417669 3300005840 Bacteria 877
106 Ga0068863_100114640 3300005841 Bacteria 2567
107 Ga0068858_100038963 3300005842 Bacteria 4408
108 Ga0068860_100028370 3300005843 Bacteria 5387
109 Ga0068860_100090534 3300005843 Bacteria 2914
110 Ga0068862_100157928 3300005844 Bacteria 2023
111 Ga0068862_100260939 3300005844 Bacteria 1581
112 Ga0081455_10001637 3300005937 Bacteria 27271
113 Ga0081455_10003623 3300005937 Bacteria 17700
114 Ga0081455_10007123 3300005937 Bacteria 11841
115 Ga0081455_10083244 3300005937 Bacteria 2615
116 Ga0081538_10000703 3300005981 Bacteria 36689
117 Ga0081540_1000424 3300005983 Bacteria 41696
118 Ga0081539_10003082 3300005985 Bacteria 21449
119 Ga0070717_10023709 3300006028 Bacteria 4865
120 Ga0075365_10149151 3300006038 Bacteria 1626
121 Ga0075363_100020684 3300006048 Bacteria 3304
122 Ga0075364_10319816 3300006051 Bacteria 1057
123 Ga0075432_10000302 3300006058 Bacteria 13803
124 Ga0075432_10018467 3300006058 Bacteria 2379
125 Ga0070715_10035018 3300006163 Bacteria 2062
126 Ga0070716_100088305 3300006173 Bacteria 1870
127 Ga0070712_100081298 3300006175 Bacteria 2347
128 Ga0070712_100211877 3300006175 Bacteria 1528
129 Ga0097621_100024855 3300006237 Bacteria 4683
130 Ga0097621_100103356 3300006237 Bacteria 2400
131 Ga0097621_100300026 3300006237 Bacteria 1419
132 Ga0068871_100021850 3300006358 Bacteria 4926
133 Ga0068871_100136904 3300006358 Bacteria 2080
134 Ga0075428_100012923 3300006844 Bacteria 9288
135 Ga0075428_100204408 3300006844 Unclassified 2135
136 Ga0075430_100615794 3300006846 Bacteria 896
137 Ga0075431_100073057 3300006847 Bacteria 3539
138 Ga0075433_10005821 3300006852 Bacteria 9707
139 Ga0075433_10039254 3300006852 Bacteria 4092
140 Ga0075434_100017460 3300006871 Bacteria 6915
141 Ga0075434_100051097 3300006871 Bacteria 4107
142 Ga0075429_100273651 3300006880 Bacteria 1479
143 Ga0075429_100376056 3300006880 Bacteria 1244
144 Ga0075429_100659362 3300006880 Bacteria 917
145 Ga0068865_100055107 3300006881 Bacteria 2765
146 Ga0068865_100057211 3300006881 Bacteria 2720
147 Ga0075436_100001626 3300006914 Bacteria 15378
148 Ga0075436_100056396 3300006914 Bacteria 2713
149 Ga0097620_100053586 3300006931 Bacteria 4057
150 Ga0097620_100221128 3300006931 Bacteria 1981
151 Ga0097620_101018463 3300006931 Bacteria 910
152 Ga0075435_100117314 3300007076 Bacteria 2218
153 Ga0075435_100188905 3300007076 Bacteria 1743
154 Ga0105251_10009229 3300009011 Bacteria 5847
155 Ga0105240_10025974 3300009093 Bacteria 7692
156 Ga0105240_10122036 3300009093 Bacteria 3136
157 Ga0111539_10006133 3300009094 Bacteria 15519
158 Ga0111539_10025829 3300009094 Bacteria 7192
159 Ga0111539_10738242 3300009094 Bacteria 1146
160 Ga0105245_10071217 3300009098 Bacteria 3157
161 Ga0105247_10006468 3300009101 Bacteria 7252
162 Ga0105247_10043435 3300009101 Bacteria 2753
163 Ga0105247_10187651 3300009101 Bacteria 1383
164 Ga0105247_10220354 3300009101 Bacteria 1284
165 Ga0114129_10127169 3300009147 Bacteria 3503
166 Ga0114129_10799083 3300009147 Bacteria 1203
167 Ga0105243_10117919 3300009148 Bacteria 2233
168 Ga0105243_10147876 3300009148 Bacteria 2012
169 Ga0105243_10245130 3300009148 Bacteria 1597
170 Ga0105241_10005218 3300009174 Bacteria 9592
171 Ga0105241_10138397 3300009174 Bacteria 1979
172 Ga0105242_10166706 3300009176 Bacteria 1933
173 Ga0105242_10471677 3300009176 Bacteria 1187
174 Ga0105237_10047022 3300009545 Bacteria 4338
175 Ga0105237_10280967 3300009545 Bacteria 1667
176 Ga0105238_10507708 3300009551 Bacteria 1207
177 Ga0105238_10516716 3300009551 Bacteria 1196
178 Ga0105249_10005082 3300009553 Bacteria 11336
179 Ga0105249_10146872 3300009553 Bacteria 2266
180 Ga0105246_10044963 3300011119 Bacteria 3004
181 Ga0157344_1000314 3300012476 Bacteria 1791
182 Ga0157338_1005923 3300012515 Bacteria 1115
183 Ga0157371_10017191 3300013102 Bacteria 5378
184 Ga0157371_10075763 3300013102 Bacteria 2382
185 Ga0157371_10241202 3300013102 Bacteria 1300
186 Ga0157371_10426328 3300013102 Bacteria 973
187 Ga0157370_10017343 3300013104 Bacteria 7267
188 Ga0157370_10239300 3300013104 Bacteria 1680
189 Ga0157369_10200984 3300013105 Bacteria 2092
190 Ga0157369_10267396 3300013105 Bacteria 1782
191 Ga0157369_10323158 3300013105 Bacteria 1604
192 Ga0157369_10325278 3300013105 Bacteria 1598
193 Ga0157374_10168405 3300013296 Bacteria 2136
194 Ga0157374_10585697 3300013296 Bacteria 1125
195 Ga0157378_10101907 3300013297 Bacteria 2622
196 Ga0157372_10013332 3300013307 Bacteria 8775
197 Ga0157372_10367968 3300013307 Bacteria 1675
198 Ga0157375_10435674 3300013308 Bacteria 1477
199 Ga0157375_10719298 3300013308 Bacteria 1151
200 Ga0163163_10088524 3300014325 Bacteria 3107
201 Ga0157380_10120832 3300014326 Bacteria 2219
202 Ga0157377_10009394 3300014745 Bacteria 4796
203 Ga0157377_10032273 3300014745 Bacteria 2851
204 Ga0157377_10385637 3300014745 Bacteria 950
205 Ga0157379_10119656 3300014968 Bacteria 2368
206 Ga0157376_10308201 3300014969 Bacteria 1501
207 Ga0182005_1051301 3300015265 Bacteria 1122
208 Ga0163161_10006095 3300017792 Bacteria 8353
209 Ga0163161_10057748 3300017792 Bacteria 2820
210 Ga0163161_10122335 3300017792 Bacteria 1956
211 Ga0206353_11525011 3300020082 Bacteria 1564
212 Ga0213875_10001625 3300021388 Bacteria 14192
213 Ga0213875_10004624 3300021388 Bacteria 7510
214 Ga0213875_10050786 3300021388 Bacteria 1943
215 Ga0224712_10005649 3300022467 Bacteria 3507
216 Ga0207426_1024553 3300025302 Bacteria 2043
217 Ga0207656_10055696 3300025321 Bacteria 1722
218 Ga0207656_10068926 3300025321 Bacteria 1568
219 Ga0207653_10005210 3300025885 Bacteria 4063
220 Ga0207642_10029927 3300025899 Bacteria 2262
221 Ga0207642_10149615 3300025899 Bacteria 1241
222 Ga0207710_10039429 3300025900 Bacteria 2091
223 Ga0207688_10001078 3300025901 Bacteria 13975
224 Ga0207688_10002565 3300025901 Bacteria 9828
225 Ga0207680_10010079 3300025903 Bacteria 4714
226 Ga0207647_10089450 3300025904 Bacteria 1838
227 Ga0207685_10005018 3300025905 Bacteria 3442
228 Ga0207699_10001180 3300025906 Bacteria 12366
229 Ga0207699_10033395 3300025906 Bacteria 2908
230 Ga0207643_10010726 3300025908 Bacteria 4937
231 Ga0207654_10039214 3300025911 Bacteria 2663
232 Ga0207695_10256601 3300025913 Bacteria 1647
233 Ga0207671_10119451 3300025914 Bacteria 2014
234 Ga0207693_10001733 3300025915 Bacteria 19144
235 Ga0207693_10008332 3300025915 Bacteria 8484
236 Ga0207693_10376212 3300025915 Bacteria 1111
237 Ga0207663_10414142 3300025916 Bacteria 1033
238 Ga0207660_10083419 3300025917 Bacteria 2353
239 Ga0207660_10282858 3300025917 Bacteria 1317
240 Ga0207662_10405257 3300025918 Bacteria 925
241 Ga0207657_10005808 3300025919 Bacteria 12856
242 Ga0207657_10032899 3300025919 Bacteria 4678
243 Ga0207657_10033192 3300025919 Bacteria 4655
244 Ga0207649_10435122 3300025920 Bacteria 987
245 Ga0207652_10780068 3300025921 Bacteria 849
246 Ga0207681_10198863 3300025923 Bacteria 1538
247 Ga0207694_10367144 3300025924 Bacteria 1193
248 Ga0207694_10402580 3300025924 Bacteria 1138
249 Ga0207687_10117024 3300025927 Bacteria 1988
250 Ga0207687_10174196 3300025927 Bacteria 1662
251 Ga0207700_10044988 3300025928 Bacteria 3254
252 Ga0207700_10474016 3300025928 Bacteria 1105
253 Ga0207700_10540320 3300025928 Bacteria 1034
254 Ga0207664_10037552 3300025929 Bacteria 3750
255 Ga0207664_10319549 3300025929 Bacteria 1370
256 Ga0207664_10392393 3300025929 Bacteria 1233
257 Ga0207644_10116103 3300025931 Bacteria 2031
258 Ga0207644_10116393 3300025931 Bacteria 2028
259 Ga0207690_10141241 3300025932 Bacteria 1774
260 Ga0207706_10009802 3300025933 Bacteria 8789
261 Ga0207706_10042371 3300025933 Bacteria 4034
262 Ga0207706_10149128 3300025933 Bacteria 2057
263 Ga0207709_10330957 3300025935 Bacteria 1143
264 Ga0207709_10658176 3300025935 Bacteria 835
265 Ga0207670_10216563 3300025936 Bacteria 1463
266 Ga0207670_10374941 3300025936 Bacteria 1132
267 Ga0207669_10072950 3300025937 Bacteria 2164
268 Ga0207669_10191317 3300025937 Bacteria 1476
269 Ga0207669_10308814 3300025937 Bacteria 1205
270 Ga0207704_10071084 3300025938 Bacteria 2207
271 Ga0207704_10129557 3300025938 Bacteria 1744
272 Ga0207704_10149664 3300025938 Bacteria 1645
273 Ga0207665_10001334 3300025939 Bacteria 16625
274 Ga0207691_10034660 3300025940 Bacteria 4692
275 Ga0207691_10081886 3300025940 Bacteria 2900
276 Ga0207711_10139103 3300025941 Bacteria 2183
277 Ga0207689_10018207 3300025942 Bacteria 5929
278 Ga0207689_10027491 3300025942 Bacteria 4760
279 Ga0207689_10157063 3300025942 Bacteria 1875
280 Ga0207689_10352871 3300025942 Bacteria 1223
281 Ga0207661_10007946 3300025944 Bacteria 7563
282 Ga0207667_10014793 3300025949 Bacteria 8878
283 Ga0207667_10103372 3300025949 Bacteria 2938
284 Ga0207667_10130073 3300025949 Bacteria 2593
285 Ga0207651_10063699 3300025960 Bacteria 2576
286 Ga0207651_10088197 3300025960 Bacteria 2261
287 Ga0207651_10286962 3300025960 Bacteria 1363
288 Ga0207712_10074508 3300025961 Bacteria 2451
289 Ga0207712_10086081 3300025961 Bacteria 2302
290 Ga0207712_10181731 3300025961 Bacteria 1653
291 Ga0207668_10211255 3300025972 Bacteria 1552
292 Ga0207668_10211846 3300025972 Bacteria 1550
293 Ga0207640_10137388 3300025981 Bacteria 1776
294 Ga0207640_10365430 3300025981 Bacteria 1164
295 Ga0207677_10034196 3300026023 Bacteria 3289
296 Ga0207677_10213630 3300026023 Bacteria 1542
297 Ga0207703_10216264 3300026035 Bacteria 1711
298 Ga0207639_10019553 3300026041 Bacteria 4832
299 Ga0207639_10406815 3300026041 Bacteria 1227
300 Ga0207639_10497958 3300026041 Bacteria 1113
301 Ga0207678_10005489 3300026067 Bacteria 11334
302 Ga0207678_10101278 3300026067 Bacteria 2460
303 Ga0207708_10039538 3300026075 Bacteria 3594
304 Ga0207708_10102498 3300026075 Bacteria 2216
305 Ga0207702_10020887 3300026078 Bacteria 5417
306 Ga0207702_10037548 3300026078 Unclassified 4055
307 Ga0207702_10059391 3300026078 Bacteria 3257
308 Ga0207641_10155237 3300026088 Bacteria 2076
309 Ga0207648_10032203 3300026089 Bacteria 4630
310 Ga0207648_10210006 3300026089 Bacteria 1728
311 Ga0207676_10185020 3300026095 Bacteria 1827
312 Ga0207674_10004108 3300026116 Bacteria 17631
313 Ga0207674_10104607 3300026116 Bacteria 2809
314 Ga0207674_10494380 3300026116 Bacteria 1182
315 Ga0207674_10586480 3300026116 Bacteria 1077
316 Ga0207674_10644202 3300026116 Bacteria 1023
317 Ga0207675_100011497 3300026118 Bacteria 8282
318 Ga0207675_100013260 3300026118 Bacteria 7694
319 Ga0207675_100051279 3300026118 Bacteria 3849
320 Ga0207683_10007708 3300026121 Bacteria 9220
321 Ga0207683_10021718 3300026121 Bacteria 5501
322 Ga0207428_10032155 3300027907 Bacteria 4319
323 Ga0268266_10122939 3300028379 Bacteria 2311
324 Ga0268265_10140894 3300028380 Bacteria 2019
325 Ga0268264_10203626 3300028381 Bacteria 1812
326 Ga0307513_10017450 3300031456 Bacteria 8607
327 Ga0307408_100600159 3300031548 Unclassified 978
328 Ga0307405_10025828 3300031731 Bacteria 3377
329 Ga0307413_10005292 3300031824 Bacteria 5738
330 Ga0307410_10020758 3300031852 Bacteria 4027
331 Ga0307410_10169987 3300031852 Bacteria 1641
332 Ga0307406_10000224 3300031901 Bacteria 34452
333 Ga0307406_10038976 3300031901 Bacteria 2944
334 Ga0307406_10067018 3300031901 Bacteria 2339
335 Ga0307407_10191165 3300031903 Bacteria 1364
336 Ga0307407_10539481 3300031903 Bacteria 861
337 Ga0307412_10040183 3300031911 Bacteria 3026
338 Ga0307412_10352127 3300031911 Bacteria 1183
339 Ga0307409_100000129 3300031995 Bacteria 28229
340 Ga0307409_100023998 3300031995 Bacteria 4242
341 Ga0307409_100103607 3300031995 Bacteria 2367
342 Ga0307409_100107517 3300031995 Bacteria 2330
343 Ga0307409_100159311 3300031995 Bacteria 1971
344 Ga0307409_100309078 3300031995 Bacteria 1474
345 Ga0307416_100000332 3300032002 Bacteria 24390
346 Ga0307416_100016098 3300032002 Bacteria 5184
347 Ga0307416_100046400 3300032002 Bacteria 3428
348 Ga0307416_100074004 3300032002 Bacteria 2843
349 Ga0307416_100127241 3300032002 Bacteria 2284
350 Ga0307414_10015366 3300032004 Bacteria 4620
351 Ga0307414_10093723 3300032004 Bacteria 2239
352 Ga0307414_10186432 3300032004 Bacteria 1674
353 Ga0307411_10088863 3300032005 Bacteria 2150
354 Ga0307415_100000723 3300032126 Bacteria 14791
355 Ga0307415_100006695 3300032126 Bacteria 6240
356 Ga0307415_100020075 3300032126 Bacteria 4071
357 Ga0307415_100027177 3300032126 Bacteria 3622
358 Ga0307415_100107545 3300032126 Bacteria 2061
359 Ga0307415_100120134 3300032126 Bacteria 1968
360 Ga0307415_100424153 3300032126 Bacteria 1142
361 Ga0316214_1000450 3300033545 Bacteria 4183
362 Ga0373930_0007867 3300034816 Bacteria 1848
363 Ga0373930_0061180 3300034816 Bacteria 840
364 Ga0373934_0000078 3300035086 Bacteria 34263
365 Ga0373940_0003816 3300035088 Bacteria 3121
366 Ga0373949_0034914 3300035090 Bacteria 1214
367 Ga0373923_0071125 3300035111 Bacteria 1494
368 Ga0373932_0001219 3300035112 Bacteria 7299
369 Ga0373936_0006922 3300035113 Bacteria 4267
370 Ga0373939_0014244 3300035114 Bacteria 2060
371 Ga0373941_0005886 3300035115 Bacteria 2918
372 Ga0373945_0036775 3300035116 Bacteria 1755
373 Ga0373953_0000181 3300035117 Bacteria 16763
374 Ga0373954_0010105 3300035118 Bacteria 4159
375 Ga0373956_0000098 3300035119 Bacteria 29655
376 Ga0373957_0000011 3300035120 Bacteria 47051
377 Ga0373960_0040848 3300035121 Bacteria 1340
378 Ga0373943_0004883 3300035170 Bacteria 6061
379 Ga0373955_0000060 3300035172 Bacteria 42697
380 Ga0373961_0008541 3300035241 Bacteria 2492
381 Ga0373962_0007363 3300035242 Bacteria 2695
382 Ga0373962_0009146 3300035242 Bacteria 2448
383 Ga0373924_0000070 3300035410 Bacteria 27222
384 Ga0373924_0001632 3300035410 Bacteria 7362
385 Ga0373931_0059776 3300035691 Bacteria 2051
386 Ga0373933_0000009 3300035724 Bacteria 112662
387 Ga0373937_0000110 3300036401 Bacteria 77832
388 Ga0373925_0137156 3300037068 Bacteria 1912
389 Ga0436364_0180450 3300037853 Bacteria 44360
390 Ga0436364_0577320 3300037853 Bacteria 7514
391 Ga0436364_0736983 3300037853 Bacteria 1242
392 Ga0395901_0134744 3300038443 Bacteria 2596
393 Ga0436365_1396317 3300039437 Bacteria 14894
394 Ga0436363_0536993 3300039450 Bacteria 3709
395 Ga0436362_1149216 3300039453 Bacteria 975
396 Ga0451791_0719303 3300041451 Bacteria 1901
397 Ga0451841_0678703 3300041498 Bacteria 1289
398 Ga0451841_0999285 3300041498 Bacteria 956
399 Ga0451849_0046291 3300041505 Unclassified 1111
400 Ga0451843_1776865 3300041509 Unclassified 927
401 Ga0439455_0045078 3300042012 Bacteria 1139
402 Ga0439463_036893 3300042016 Bacteria 1239
403 Ga0439444_0025815 3300042437 Bacteria 1071
404 Ga0439464_0010644 3300042439 Bacteria 2429
405 Ga0439460_0054197 3300042461 Bacteria 1209
406 Ga0466963_0406257 3300044694 Bacteria 960
407 Ga0466963_0512658 3300044694 Bacteria 847
408 Ga0466970_0299356 3300044765 Bacteria 907
409 Ga0466967_0182202 3300045976 Bacteria 1982
410 Ga0495592_0000049 3300046454 Bacteria 113704
411 Ga0495651_0000007 3300046462 Bacteria 158577
412 Ga0495651_0077632 3300046462 Bacteria 2513
413 Ga0495653_0000996 3300046463 Bacteria 21820
414 Ga0495639_0008360 3300046475 Bacteria 4438
415 Ga0495594_0123122 3300046499 Bacteria 1466
416 Ga0495608_0000076 3300046511 Bacteria 74854
417 Ga0495628_0034024 3300046516 Bacteria 4102
418 Ga0495652_0000168 3300046529 Bacteria 74913
419 Ga0495665_0008942 3300046531 Bacteria 5434
420 Ga0495640_0021791 3300046533 Bacteria 4693
421 Ga0495587_0000032 3300046536 Bacteria 124143
422 Ga0495645_0060446 3300046543 Bacteria 2746
423 Ga0495645_0167309 3300046543 Bacteria 1515
424 Ga0495622_0106251 3300046557 Bacteria 1286
425 Ga0495667_0000072 3300046559 Bacteria 75080
426 Ga0495635_0035646 3300046663 Bacteria 3449
427 Ga0495657_0000424 3300046675 Bacteria 39370
428 Ga0495599_0000062 3300046678 Bacteria 74940
429 Ga0495646_0018348 3300046680 Bacteria 4431
430 Ga0495658_0014458 3300046683 Bacteria 4034
431 Ga0495600_0000743 3300046809 Bacteria 17166
432 Ga0495600_0044654 3300046809 Bacteria 2890
433 Ga0495604_0000062 3300047317 Bacteria 93264
434 Ga0495680_0000101 3300047322 Bacteria 78550
435 Ga0495675_0000116 3300047444 Bacteria 57631
436 Ga0495602_0000115 3300048088 Bacteria 75982
437 Ga0496101_0132833 3300048904 Bacteria 1891
438 Ga0496101_0632759 3300048904 Bacteria 845
439 Ga0496102_0060047 3300048905 Bacteria 3478
440 Ga0496102_0077932 3300048905 Bacteria 3050
441 Ga0496103_0053250 3300048906 Bacteria 2507
442 Ga0496104_0019808 3300048907 Bacteria 6160
443 Ga0496104_0040531 3300048907 Bacteria 4365
444 Ga0496104_0673695 3300048907 Bacteria 943
445 Ga0496105_0020698 3300048908 Bacteria 5318
446 Ga0496105_0084720 3300048908 Bacteria 2618
447 Ga0496106_0299494 3300048909 Bacteria 1289
448 Ga0496107_0013473 3300048910 Bacteria 5716
449 Ga0496108_0018702 3300048911 Bacteria 5677
450 Ga0496109_0008734 3300048912 Bacteria 8626
451 Ga0496110_0039368 3300048913 Bacteria 4115
452 Ga0496110_0550039 3300048913 Bacteria 1049
453 Ga0496111_0048932 3300048914 Bacteria 3047
454 Ga0496111_0066677 3300048914 Bacteria 2614
455 Ga0496111_0254556 3300048914 Bacteria 1303
456 Ga0496112_0129213 3300048915 Bacteria 2497
457 Ga0496112_0170911 3300048915 Bacteria 2139
458 Ga0496113_0008204 3300048916 Bacteria 6788
459 Ga0496114_0012758 3300048917 Bacteria 6729
460 Ga0496114_0158380 3300048917 Bacteria 1967
461 Ga0496114_0458302 3300048917 Bacteria 1129
462 Ga0496115_0164165 3300048918 Bacteria 1836
463 Ga0496115_0373531 3300048918 Bacteria 1160
464 Ga0496126_0038279 3300048929 Bacteria 4465
465 Ga0501217_014618 3300049661 Bacteria 1777
466 Ga0501247_013301 3300049677 Unclassified 1011
467 nmdc:mga03n38_193641_c1 3300050490 Bacteria 1048
468 nmdc:mga05p37_1032333_c1 3300050507 Bacteria 869
469 nmdc:mga05p37_382689_c1 3300050507 Bacteria 1648
470 nmdc:mga09592_216765_c2 3300050508 Bacteria 1257
471 nmdc:mga08y16_11330_c1 3300050511 Bacteria 9369
472 nmdc:mga0n895_1019_c1 3300050512 Bacteria 20374
473 nmdc:mga0n895_67052_c1 3300050512 Bacteria 3554
474 nmdc:mga0rr50_248070_c1 3300050513 Bacteria 1478
475 nmdc:mga08x19_1165_c1 3300050514 Bacteria 16461
476 nmdc:mga08x19_54667_c1 3300050514 Bacteria 2571
477 nmdc:mga0a205_10905_c1 3300050515 Bacteria 5601
478 nmdc:mga0a205_88642_c1 3300050515 Bacteria 2990
479 Ga0495612_0008139 3300053078 Bacteria 4264
480 Ga0495595_0000198 3300053084 Bacteria 24262
481 Ga0495619_0119880 3300053085 Bacteria 1803
482 Ga0495619_0175354 3300053085 Bacteria 1483
483 Ga0500644_0000185 3300053088 Bacteria 39629
484 Ga0500630_104190 3300053159 Bacteria 1287
485 2644498049 2643221689 Bacteria 6042950
486 Ga0105246_10129317
487 JGI25404J52841_10002154
488 JGI25405J52794_10029790
489 Ga0070658_10285506
490 Ga0070676_10504206
491 Ga0070683_100000838
492 Ga0070670_100358826
493 Ga0068869_100184290
494 Ga0070666_10047520
495 Ga0070666_10061118
496 Ga0070680_100089831
497 Ga0070682_100048588
498 Ga0070682_100064254
499 Ga0070682_100141928
500 Ga0070682_100169093
501 Ga0070682_100278560
502 Ga0070682_100403405
503 Ga0070660_100022057
504 Ga0070660_100028728
505 Ga0070689_100032317
506 Ga0070689_100065746
507 Ga0070691_10080679
508 Ga0070691_10104728
509 Ga0070661_100042663
510 Ga0070661_100130564
511 Ga0070661_100375215
512 Ga0070692_10070638
513 Ga0070692_10122125
514 Ga0070668_100094717
515 Ga0070668_100123922
516 Ga0070669_100181271
517 Ga0070669_100520713
518 Ga0070675_100110840
519 Ga0070675_100119285
520 Ga0070671_100124623
521 Ga0070671_100392429
522 Ga0070674_100015544
523 Ga0070674_100033620
524 Ga0070673_100021002
525 Ga0070673_100022760
526 Ga0070673_100182986
527 Ga0070659_100011248
528 Ga0070667_100027816
529 Ga0070667_100070070
530 Ga0070709_10043859
531 Ga0070709_10073938
532 Ga0070714_100026049
533 Ga0070714_100153425
534 Ga0070714_100365803
535 Ga0070713_100166858
536 Ga0070713_100171340
537 Ga0070713_100556118
538 Ga0070710_10026660
539 Ga0070710_10154011
540 Ga0070701_10158409
541 Ga0070711_100014605
542 Ga0070711_100018217
543 Ga0070705_100041278
544 Ga0070700_100028288
545 Ga0070663_100016253
546 Ga0070678_100018429
547 Ga0070678_100451102
548 Ga0070662_100057315
549 Ga0070662_100164452
550 Ga0070681_10113311
551 Ga0068867_100068955
552 Ga0070685_10154119
553 Ga0070706_100136900
554 Ga0070679_100080220
555 Ga0070684_100002112
556 Ga0070684_100032575
557 Ga0070684_100214378
558 Ga0070697_100056457
559 Ga0068853_100021234
560 Ga0068853_100069790
561 Ga0070672_100069350
562 Ga0070672_100076155
563 Ga0070686_100253753
564 Ga0070695_100379222
565 Ga0070696_100061356
566 Ga0070693_100005265
567 Ga0070693_100026933
568 Ga0070665_100219140
569 Ga0070704_100107592
570 Ga0070704_100283108
571 Ga0070664_100094378
572 Ga0070664_100247552
573 Ga0068857_100143737
574 Ga0068854_100011823
575 Ga0068854_100175235
576 Ga0068856_100036503
577 Ga0070702_100001720
578 Ga0070702_100004631
579 Ga0070702_100191358
580 Ga0068859_100053587
581 Ga0068859_100221137
582 Ga0068859_101018376
583 Ga0068864_100100041
584 Ga0068864_100114256
585 Ga0068866_10093132
586 Ga0068861_100037809
587 Ga0068861_100038802
588 Ga0068851_10054886
589 Ga0068870_10193304
590 Ga0068870_10417669
591 Ga0068863_100114640
592 Ga0068858_100038963
593 Ga0068860_100028370
594 Ga0068860_100090534
595 Ga0068862_100157928
596 Ga0068862_100260939
597 Ga0081455_10001637
598 Ga0081455_10003623
599 Ga0081455_10007123
600 Ga0081455_10083244
601 Ga0081538_10000703
602 Ga0081540_1000424
603 Ga0081539_10003082
604 Ga0070717_10023709
605 Ga0075365_10149151
606 Ga0075363_100020684
607 Ga0075364_10319816
608 Ga0075432_10000302
609 Ga0075432_10018467
610 Ga0070715_10035018
611 Ga0070716_100088305
612 Ga0070712_100081298
613 Ga0070712_100211877
614 Ga0097621_100024855
615 Ga0097621_100103356
616 Ga0097621_100300026
617 Ga0068871_100021850
618 Ga0068871_100136904
619 Ga0075428_100012923
620 Ga0075428_100204408
621 Ga0075430_100615794
622 Ga0075431_100073057
623 Ga0075433_10005821
624 Ga0075433_10039254
625 Ga0075434_100017460
626 Ga0075434_100051097
627 Ga0075429_100273651
628 Ga0075429_100376056
629 Ga0075429_100659362
630 Ga0068865_100055107
631 Ga0068865_100057211
632 Ga0075436_100001626
633 Ga0075436_100056396
634 Ga0097620_100053586
635 Ga0097620_100221128
636 Ga0097620_101018463
637 Ga0075435_100117314
638 Ga0075435_100188905
639 Ga0105251_10009229
640 Ga0105240_10025974
641 Ga0105240_10122036
642 Ga0111539_10006133
643 Ga0111539_10025829
644 Ga0111539_10738242
645 Ga0105245_10071217
646 Ga0105247_10006468
647 Ga0105247_10043435
648 Ga0105247_10187651
649 Ga0105247_10220354
650 Ga0114129_10127169
651 Ga0114129_10799083
652 Ga0105243_10117919
653 Ga0105243_10147876
654 Ga0105243_10245130
655 Ga0105241_10005218
656 Ga0105241_10138397
657 Ga0105242_10166706
658 Ga0105242_10471677
659 Ga0105237_10047022
660 Ga0105237_10280967
661 Ga0105238_10507708
662 Ga0105238_10516716
663 Ga0105249_10005082
664 Ga0105249_10146872
665 Ga0105246_10044963
666 Ga0157344_1000314
667 Ga0157338_1005923
668 Ga0157371_10017191
669 Ga0157371_10075763
670 Ga0157371_10241202
671 Ga0157371_10426328
672 Ga0157370_10017343
673 Ga0157370_10239300
674 Ga0157369_10200984
675 Ga0157369_10267396
676 Ga0157369_10323158
677 Ga0157369_10325278
678 Ga0157374_10168405
679 Ga0157374_10585697
680 Ga0157378_10101907
681 Ga0157372_10013332
682 Ga0157372_10367968
683 Ga0157375_10435674
684 Ga0157375_10719298
685 Ga0163163_10088524
686 Ga0157380_10120832
687 Ga0157377_10009394
688 Ga0157377_10032273
689 Ga0157377_10385637
690 Ga0157379_10119656
691 Ga0157376_10308201
692 Ga0182005_1051301
693 Ga0163161_10006095
694 Ga0163161_10057748
695 Ga0163161_10122335
696 Ga0206353_11525011
697 Ga0213875_10001625
698 Ga0213875_10004624
699 Ga0213875_10050786
700 Ga0224712_10005649
701 Ga0207426_1024553
702 Ga0207656_10055696
703 Ga0207656_10068926
704 Ga0207653_10005210
705 Ga0207642_10029927
706 Ga0207642_10149615
707 Ga0207710_10039429
708 Ga0207688_10001078
709 Ga0207688_10002565
710 Ga0207680_10010079
711 Ga0207647_10089450
712 Ga0207685_10005018
713 Ga0207699_10001180
714 Ga0207699_10033395
715 Ga0207643_10010726
716 Ga0207654_10039214
717 Ga0207695_10256601
718 Ga0207671_10119451
719 Ga0207693_10001733
720 Ga0207693_10008332
721 Ga0207693_10376212
722 Ga0207663_10414142
723 Ga0207660_10083419
724 Ga0207660_10282858
725 Ga0207662_10405257
726 Ga0207657_10005808
727 Ga0207657_10032899
728 Ga0207657_10033192
729 Ga0207649_10435122
730 Ga0207652_10780068
731 Ga0207681_10198863
732 Ga0207694_10367144
733 Ga0207694_10402580
734 Ga0207687_10117024
735 Ga0207687_10174196
736 Ga0207700_10044988
737 Ga0207700_10474016
738 Ga0207700_10540320
739 Ga0207664_10037552
740 Ga0207664_10319549
741 Ga0207664_10392393
742 Ga0207644_10116103
743 Ga0207644_10116393
744 Ga0207690_10141241
745 Ga0207706_10009802
746 Ga0207706_10042371
747 Ga0207706_10149128
748 Ga0207709_10330957
749 Ga0207709_10658176
750 Ga0207670_10216563
751 Ga0207670_10374941
752 Ga0207669_10072950
753 Ga0207669_10191317
754 Ga0207669_10308814
755 Ga0207704_10071084
756 Ga0207704_10129557
757 Ga0207704_10149664
758 Ga0207665_10001334
759 Ga0207691_10034660
760 Ga0207691_10081886
761 Ga0207711_10139103
762 Ga0207689_10018207
763 Ga0207689_10027491
764 Ga0207689_10157063
765 Ga0207689_10352871
766 Ga0207661_10007946
767 Ga0207667_10014793
768 Ga0207667_10103372
769 Ga0207667_10130073
770 Ga0207651_10063699
771 Ga0207651_10088197
772 Ga0207651_10286962
773 Ga0207712_10074508
774 Ga0207712_10086081
775 Ga0207712_10181731
776 Ga0207668_10211255
777 Ga0207668_10211846
778 Ga0207640_10137388
779 Ga0207640_10365430
780 Ga0207677_10034196
781 Ga0207677_10213630
782 Ga0207703_10216264
783 Ga0207639_10019553
784 Ga0207639_10406815
785 Ga0207639_10497958
786 Ga0207678_10005489
787 Ga0207678_10101278
788 Ga0207708_10039538
789 Ga0207708_10102498
790 Ga0207702_10020887
791 Ga0207702_10037548
792 Ga0207702_10059391
793 Ga0207641_10155237
794 Ga0207648_10032203
795 Ga0207648_10210006
796 Ga0207676_10185020
797 Ga0207674_10004108
798 Ga0207674_10104607
799 Ga0207674_10494380
800 Ga0207674_10586480
801 Ga0207674_10644202
802 Ga0207675_100011497
803 Ga0207675_100013260
804 Ga0207675_100051279
805 Ga0207683_10007708
806 Ga0207683_10021718
807 Ga0207428_10032155
808 Ga0268266_10122939
809 Ga0268265_10140894
810 Ga0268264_10203626
811 Ga0307513_10017450
812 Ga0307408_100600159
813 Ga0307405_10025828
814 Ga0307413_10005292
815 Ga0307410_10020758
816 Ga0307410_10169987
817 Ga0307406_10000224
818 Ga0307406_10038976
819 Ga0307406_10067018
820 Ga0307407_10191165
821 Ga0307407_10539481
822 Ga0307412_10040183
823 Ga0307412_10352127
824 Ga0307409_100000129
825 Ga0307409_100023998
826 Ga0307409_100103607
827 Ga0307409_100107517
828 Ga0307409_100159311
829 Ga0307409_100309078
830 Ga0307416_100000332
831 Ga0307416_100016098
832 Ga0307416_100046400
833 Ga0307416_100074004
834 Ga0307416_100127241
835 Ga0307414_10015366
836 Ga0307414_10093723
837 Ga0307414_10186432
838 Ga0307411_10088863
839 Ga0307415_100000723
840 Ga0307415_100006695
841 Ga0307415_100020075
842 Ga0307415_100027177
843 Ga0307415_100107545
844 Ga0307415_100120134
845 Ga0307415_100424153
846 Ga0316214_1000450
847 Ga0373930_0007867
848 Ga0373930_0061180
849 Ga0373934_0000078
850 Ga0373940_0003816
851 Ga0373949_0034914
852 Ga0373923_0071125
853 Ga0373932_0001219
854 Ga0373936_0006922
855 Ga0373939_0014244
856 Ga0373941_0005886
857 Ga0373945_0036775
858 Ga0373953_0000181
859 Ga0373954_0010105
860 Ga0373956_0000098
861 Ga0373957_0000011
862 Ga0373960_0040848
863 Ga0373943_0004883
864 Ga0373955_0000060
865 Ga0373961_0008541
866 Ga0373962_0007363
867 Ga0373962_0009146
868 Ga0373924_0000070
869 Ga0373924_0001632
870 Ga0373931_0059776
871 Ga0373933_0000009
872 Ga0373937_0000110
873 Ga0373925_0137156
874 Ga0436364_0180450
875 Ga0436364_0577320
876 Ga0436364_0736983
877 Ga0395901_0134744
878 Ga0436365_1396317
879 Ga0436363_0536993
880 Ga0436362_1149216
881 Ga0451791_0719303
882 Ga0451841_0678703
883 Ga0451841_0999285
884 Ga0451849_0046291
885 Ga0451843_1776865
886 Ga0439455_0045078
887 Ga0439463_036893
888 Ga0439444_0025815
889 Ga0439464_0010644
890 Ga0439460_0054197
891 Ga0466963_0406257
892 Ga0466963_0512658
893 Ga0466970_0299356
894 Ga0466967_0182202
895 Ga0495592_0000049
896 Ga0495651_0000007
897 Ga0495651_0077632
898 Ga0495653_0000996
899 Ga0495639_0008360
900 Ga0495594_0123122
901 Ga0495608_0000076
902 Ga0495628_0034024
903 Ga0495652_0000168
904 Ga0495665_0008942
905 Ga0495640_0021791
906 Ga0495587_0000032
907 Ga0495645_0060446
908 Ga0495645_0167309
909 Ga0495622_0106251
910 Ga0495667_0000072
911 Ga0495635_0035646
912 Ga0495657_0000424
913 Ga0495599_0000062
914 Ga0495646_0018348
915 Ga0495658_0014458
916 Ga0495600_0000743
917 Ga0495600_0044654
918 Ga0495604_0000062
919 Ga0495680_0000101
920 Ga0495675_0000116
921 Ga0495602_0000115
922 Ga0496101_0132833
923 Ga0496101_0632759
924 Ga0496102_0060047
925 Ga0496102_0077932
926 Ga0496103_0053250
927 Ga0496104_0019808
928 Ga0496104_0040531
929 Ga0496104_0673695
930 Ga0496105_0020698
931 Ga0496105_0084720
932 Ga0496106_0299494
933 Ga0496107_0013473
934 Ga0496108_0018702
935 Ga0496109_0008734
936 Ga0496110_0039368
937 Ga0496110_0550039
938 Ga0496111_0048932
939 Ga0496111_0066677
940 Ga0496111_0254556
941 Ga0496112_0129213
942 Ga0496112_0170911
943 Ga0496113_0008204
944 Ga0496114_0012758
945 Ga0496114_0158380
946 Ga0496114_0458302
947 Ga0496115_0164165
948 Ga0496115_0373531
949 Ga0496126_0038279
950 Ga0501217_014618
951 Ga0501247_013301
952 nmdc:mga03n38_193641_c1
953 nmdc:mga05p37_1032333_c1
954 nmdc:mga05p37_382689_c1
955 nmdc:mga09592_216765_c2
956 nmdc:mga08y16_11330_c1
957 nmdc:mga0n895_1019_c1
958 nmdc:mga0n895_67052_c1
959 nmdc:mga0rr50_248070_c1
960 nmdc:mga08x19_1165_c1
961 nmdc:mga08x19_54667_c1
962 nmdc:mga0a205_10905_c1
963 nmdc:mga0a205_88642_c1
964 Ga0495612_0008139
965 Ga0495595_0000198
966 Ga0495619_0119880
967 Ga0495619_0175354
968 Ga0500644_0000185
969 Ga0500630_104190
970 2644498049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

53

268

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vol-assembly2.cif.gz_D bacint_04212 ferulic acid esterase 0.7788 2 238
5vol-assembly1.cif.gz_C bacint_04212 ferulic acid esterase 0.7689 2 238
5vol-assembly2.cif.gz_E bacint_04212 ferulic acid esterase 0.7688 2 238
5vol-assembly2.cif.gz_D bacint_04212 ferulic acid esterase 0.7669 2 238
1r88-assembly2.cif.gz_B the crystal structure of mycobacterium tuberculosis mpt51 (fbpc1) 0.7605 1 238
ID Description Score Start End Superfamily
af_A0A0G2JYG2_4_177_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.749 3 143 3.40.50.1820
af_Q54RL8_4_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.747 3 238 3.40.50.1820
1r88A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7453 1 238 3.40.50.1820
af_P94973_191_467_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7391 27 238 3.40.50.1820
1r88A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7368 1 238 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6I1GDG3-F1-model_v4 Esterase 0.9879 17 240
AF-A0A512T551-F1-model_v4 Esterase 0.9836 1 240
AF-A0A3N5YD01-F1-model_v4 Transposase 0.9831 1 129
AF-A0A7Z9XF59-F1-model_v4 Transposase 0.983 1 147
AF-A0A4U6QJ27-F1-model_v4 Esterase 0.9824 2 240

Map