F453115
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 485 | 292 | 484 | 176 |
Family's Representative Sequence
| Representative Sequence | 3300025916|Ga0207663_10369561|Ga0207663_103695612 |
| Length | 212 |
| Sequence | MPFTIAIIGRPNVGKSTLFNRLVGQKLALVDDEPGVTRDRREGEARLGDLEFTIIDTAGLDEGAKGSLTLAIKSGIKVVQQDKHLEVQASSTAEGLNAIAGATRAHLANMVTGVTKGYEKKLELVGVGYRAAVQAKSLTLTLGFSHLINFAIPDGITIEAPSQTEIIVKGIDRQRVGQTAAEIRGFRPPEPYKGKGVKYSDEKISLKEAKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 57 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 58 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 86 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 134 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 135 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 149 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 150 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 151 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 153 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 158 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 167 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 180 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 181 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 182 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 183 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 184 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 185 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 186 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 187 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 230 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 231 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 232 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 236 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 237 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 238 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 241 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 242 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 243 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 244 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 283 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 284 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 285 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 292 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.49 |
| Metatranscriptomes | 3.3 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.82 |
| Nodule | 0 |
| Rhizoplane | 7.63 |
| Rhizosphere | 84.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1003798 | 3300000546 | Bacteria | 1712 |
| 2 | LJNas_1018000 | 3300000546 | Bacteria | 752 |
| 3 | Ga0058863_11971832 | 3300004799 | Bacteria | 3216 |
| 4 | Ga0065707_10173760 | 3300005295 | Bacteria | 1466 |
| 5 | Ga0070670_100042316 | 3300005331 | Bacteria | 3915 |
| 6 | Ga0068869_101163005 | 3300005334 | Bacteria | 677 |
| 7 | Ga0070666_10001446 | 3300005335 | Bacteria | 14396 |
| 8 | Ga0070680_100262924 | 3300005336 | Bacteria | 1460 |
| 9 | Ga0068868_100008294 | 3300005338 | Bacteria | 7438 |
| 10 | Ga0070675_100227307 | 3300005354 | Bacteria | 1627 |
| 11 | Ga0070671_100003161 | 3300005355 | Bacteria | 12839 |
| 12 | Ga0070671_100005400 | 3300005355 | Bacteria | 10190 |
| 13 | Ga0070667_100012347 | 3300005367 | Bacteria | 7064 |
| 14 | Ga0070667_100055472 | 3300005367 | Bacteria | 3346 |
| 15 | Ga0070709_10009928 | 3300005434 | Bacteria | 5262 |
| 16 | Ga0070709_10015515 | 3300005434 | Bacteria | 4337 |
| 17 | Ga0070709_10121175 | 3300005434 | Bacteria | 1773 |
| 18 | Ga0070714_100009500 | 3300005435 | Bacteria | 7649 |
| 19 | Ga0070714_100032759 | 3300005435 | Bacteria | 4340 |
| 20 | Ga0070713_100001795 | 3300005436 | Bacteria | 13831 |
| 21 | Ga0070713_100006105 | 3300005436 | Bacteria | 8311 |
| 22 | Ga0070713_100409524 | 3300005436 | Bacteria | 1268 |
| 23 | Ga0070710_10254165 | 3300005437 | Bacteria | 1131 |
| 24 | Ga0070711_100001465 | 3300005439 | Bacteria | 12963 |
| 25 | Ga0070711_100025752 | 3300005439 | Bacteria | 3851 |
| 26 | Ga0070711_100054156 | 3300005439 | Bacteria | 2768 |
| 27 | Ga0070711_100152918 | 3300005439 | Bacteria | 1742 |
| 28 | Ga0070705_100281745 | 3300005440 | Bacteria | 1182 |
| 29 | Ga0070663_100042078 | 3300005455 | Bacteria | 3208 |
| 30 | Ga0070663_101024477 | 3300005455 | Bacteria | 719 |
| 31 | Ga0070678_100002594 | 3300005456 | Bacteria | 9934 |
| 32 | Ga0070681_10035786 | 3300005458 | Bacteria | 4988 |
| 33 | Ga0070681_10281253 | 3300005458 | Bacteria | 1574 |
| 34 | Ga0068867_100034823 | 3300005459 | Bacteria | 3651 |
| 35 | Ga0070699_100038586 | 3300005518 | Bacteria | 4136 |
| 36 | Ga0070679_100017288 | 3300005530 | Bacteria | 6978 |
| 37 | Ga0068853_100093611 | 3300005539 | Bacteria | 2646 |
| 38 | Ga0068853_100303829 | 3300005539 | Bacteria | 1475 |
| 39 | Ga0070672_100123866 | 3300005543 | Bacteria | 2119 |
| 40 | Ga0070686_100067091 | 3300005544 | Bacteria | 2336 |
| 41 | Ga0070695_100002554 | 3300005545 | Bacteria | 10512 |
| 42 | Ga0070696_100001443 | 3300005546 | Bacteria | 15552 |
| 43 | Ga0070665_100005442 | 3300005548 | Bacteria | 13132 |
| 44 | Ga0070665_100014481 | 3300005548 | Bacteria | 7909 |
| 45 | Ga0070665_100045273 | 3300005548 | Bacteria | 4419 |
| 46 | Ga0070665_100047121 | 3300005548 | Bacteria | 4327 |
| 47 | Ga0068855_100032357 | 3300005563 | Bacteria | 6245 |
| 48 | Ga0068855_100114994 | 3300005563 | Bacteria | 3084 |
| 49 | Ga0068855_100285468 | 3300005563 | Bacteria | 1831 |
| 50 | Ga0070664_100082104 | 3300005564 | Bacteria | 2779 |
| 51 | Ga0068854_100104735 | 3300005578 | Bacteria | 2126 |
| 52 | Ga0068856_100006458 | 3300005614 | Bacteria | 11500 |
| 53 | Ga0068856_100042931 | 3300005614 | Bacteria | 4449 |
| 54 | Ga0068856_100161497 | 3300005614 | Bacteria | 2251 |
| 55 | Ga0070702_100447944 | 3300005615 | Bacteria | 936 |
| 56 | Ga0068852_100874579 | 3300005616 | Bacteria | 915 |
| 57 | Ga0068859_100000641 | 3300005617 | Bacteria | 34946 |
| 58 | Ga0068859_100056515 | 3300005617 | Bacteria | 3950 |
| 59 | Ga0068866_10002031 | 3300005718 | Bacteria | 8429 |
| 60 | Ga0068863_100008761 | 3300005841 | Bacteria | 9878 |
| 61 | Ga0068858_100000125 | 3300005842 | Bacteria | 79795 |
| 62 | Ga0068858_100004270 | 3300005842 | Bacteria | 14053 |
| 63 | Ga0068858_100054829 | 3300005842 | Bacteria | 3686 |
| 64 | Ga0068858_100364805 | 3300005842 | Bacteria | 1385 |
| 65 | Ga0068860_100006244 | 3300005843 | Bacteria | 11972 |
| 66 | Ga0068860_100009263 | 3300005843 | Bacteria | 9789 |
| 67 | Ga0068860_100010872 | 3300005843 | Bacteria | 8977 |
| 68 | Ga0068862_100117477 | 3300005844 | Bacteria | 2341 |
| 69 | Ga0081455_10000719 | 3300005937 | Bacteria | 42956 |
| 70 | Ga0081455_10423156 | 3300005937 | Bacteria | 918 |
| 71 | Ga0070717_10213898 | 3300006028 | Bacteria | 1693 |
| 72 | Ga0070715_10000668 | 3300006163 | Bacteria | 9167 |
| 73 | Ga0070715_10032786 | 3300006163 | Bacteria | 2118 |
| 74 | Ga0070716_100034519 | 3300006173 | Bacteria | 2774 |
| 75 | Ga0070716_100069198 | 3300006173 | Bacteria | 2068 |
| 76 | Ga0070712_100001456 | 3300006175 | Bacteria | 14428 |
| 77 | Ga0070712_100057768 | 3300006175 | Bacteria | 2727 |
| 78 | Ga0070712_100250139 | 3300006175 | Bacteria | 1416 |
| 79 | Ga0097621_100003525 | 3300006237 | Bacteria | 10812 |
| 80 | Ga0068871_100044280 | 3300006358 | Bacteria | 3578 |
| 81 | Ga0075428_100792515 | 3300006844 | Bacteria | 1007 |
| 82 | Ga0075428_101643673 | 3300006844 | Bacteria | 671 |
| 83 | Ga0075430_100302524 | 3300006846 | Bacteria | 1323 |
| 84 | Ga0075429_100025759 | 3300006880 | Bacteria | 5107 |
| 85 | Ga0068865_100001214 | 3300006881 | Bacteria | 15025 |
| 86 | Ga0075436_100243591 | 3300006914 | Bacteria | 1279 |
| 87 | Ga0097620_100000641 | 3300006931 | Bacteria | 34946 |
| 88 | Ga0097620_100056514 | 3300006931 | Bacteria | 3950 |
| 89 | Ga0099794_10054040 | 3300007265 | Bacteria | 1938 |
| 90 | Ga0099794_10137971 | 3300007265 | Bacteria | 1234 |
| 91 | Ga0099795_10000254 | 3300007788 | Bacteria | 9508 |
| 92 | Ga0099795_10046176 | 3300007788 | Bacteria | 1569 |
| 93 | Ga0105250_10072284 | 3300009092 | Bacteria | 1394 |
| 94 | Ga0105240_10065094 | 3300009093 | Bacteria | 4526 |
| 95 | Ga0105240_10086135 | 3300009093 | Bacteria | 3848 |
| 96 | Ga0105240_10459695 | 3300009093 | Bacteria | 1423 |
| 97 | Ga0105240_10496035 | 3300009093 | Bacteria | 1358 |
| 98 | Ga0111539_10575152 | 3300009094 | Bacteria | 1312 |
| 99 | Ga0105245_10099675 | 3300009098 | Bacteria | 2686 |
| 100 | Ga0105247_10002466 | 3300009101 | Bacteria | 12578 |
| 101 | Ga0105247_10015909 | 3300009101 | Bacteria | 4504 |
| 102 | Ga0105241_10011879 | 3300009174 | Bacteria | 6399 |
| 103 | Ga0105242_10003628 | 3300009176 | Bacteria | 12013 |
| 104 | Ga0105248_10003146 | 3300009177 | Bacteria | 18265 |
| 105 | Ga0105248_10005842 | 3300009177 | Bacteria | 13527 |
| 106 | Ga0105248_10260281 | 3300009177 | Bacteria | 1953 |
| 107 | Ga0105237_10096005 | 3300009545 | Bacteria | 2955 |
| 108 | Ga0105237_10099219 | 3300009545 | Bacteria | 2904 |
| 109 | Ga0105238_10022279 | 3300009551 | Bacteria | 6457 |
| 110 | Ga0105238_10248804 | 3300009551 | Bacteria | 1755 |
| 111 | Ga0105238_10337205 | 3300009551 | Bacteria | 1495 |
| 112 | Ga0105249_10014582 | 3300009553 | Bacteria | 6947 |
| 113 | Ga0105249_10115367 | 3300009553 | Bacteria | 2545 |
| 114 | Ga0105249_10690590 | 3300009553 | Bacteria | 1080 |
| 115 | Ga0099796_10005277 | 3300010159 | Bacteria | 3211 |
| 116 | Ga0099796_10161632 | 3300010159 | Bacteria | 888 |
| 117 | Ga0105246_10036204 | 3300011119 | Bacteria | 3305 |
| 118 | Ga0157373_10448086 | 3300013100 | Bacteria | 929 |
| 119 | Ga0157370_10253845 | 3300013104 | Bacteria | 1626 |
| 120 | Ga0157370_10343782 | 3300013104 | Bacteria | 1375 |
| 121 | Ga0157369_10015323 | 3300013105 | Bacteria | 8645 |
| 122 | Ga0157369_10051835 | 3300013105 | Bacteria | 4441 |
| 123 | Ga0157369_10988423 | 3300013105 | Bacteria | 862 |
| 124 | Ga0157374_10002813 | 3300013296 | Bacteria | 14598 |
| 125 | Ga0157374_10361226 | 3300013296 | Bacteria | 1444 |
| 126 | Ga0157378_10006374 | 3300013297 | Bacteria | 10319 |
| 127 | Ga0163162_10006236 | 3300013306 | Bacteria | 11558 |
| 128 | Ga0163162_10026596 | 3300013306 | Bacteria | 5720 |
| 129 | Ga0163162_10096841 | 3300013306 | Bacteria | 3039 |
| 130 | Ga0157372_10049576 | 3300013307 | Bacteria | 4669 |
| 131 | Ga0157375_10006856 | 3300013308 | Bacteria | 9930 |
| 132 | Ga0163163_10007457 | 3300014325 | Bacteria | 9652 |
| 133 | Ga0163163_10171101 | 3300014325 | Bacteria | 2219 |
| 134 | Ga0157379_10006918 | 3300014968 | Bacteria | 9807 |
| 135 | Ga0157379_10055138 | 3300014968 | Bacteria | 3552 |
| 136 | Ga0157379_10082681 | 3300014968 | Bacteria | 2877 |
| 137 | Ga0157379_10104840 | 3300014968 | Bacteria | 2537 |
| 138 | Ga0157376_10131141 | 3300014969 | Bacteria | 2236 |
| 139 | Ga0206351_10700694 | 3300020077 | Bacteria | 1521 |
| 140 | Ga0206354_10785729 | 3300020081 | Bacteria | 1051 |
| 141 | Ga0206353_11779741 | 3300020082 | Bacteria | 1147 |
| 142 | Ga0213874_10021138 | 3300021377 | Bacteria | 1791 |
| 143 | Ga0213874_10153789 | 3300021377 | Bacteria | 804 |
| 144 | Ga0213871_10014920 | 3300021441 | Bacteria | 1850 |
| 145 | Ga0207692_10065245 | 3300025898 | Bacteria | 1898 |
| 146 | Ga0207642_10016853 | 3300025899 | Bacteria | 2764 |
| 147 | Ga0207710_10000332 | 3300025900 | Bacteria | 35424 |
| 148 | Ga0207710_10009562 | 3300025900 | Bacteria | 4077 |
| 149 | Ga0207710_10010376 | 3300025900 | Bacteria | 3923 |
| 150 | Ga0207710_10056714 | 3300025900 | Bacteria | 1768 |
| 151 | Ga0207680_10009301 | 3300025903 | Bacteria | 4869 |
| 152 | Ga0207680_10063035 | 3300025903 | Bacteria | 2267 |
| 153 | Ga0207680_10264563 | 3300025903 | Bacteria | 1191 |
| 154 | Ga0207685_10000121 | 3300025905 | Bacteria | 11820 |
| 155 | Ga0207685_10032092 | 3300025905 | Bacteria | 1887 |
| 156 | Ga0207699_10051184 | 3300025906 | Bacteria | 2439 |
| 157 | Ga0207654_10034349 | 3300025911 | Bacteria | 2817 |
| 158 | Ga0207707_10000276 | 3300025912 | Bacteria | 55321 |
| 159 | Ga0207707_10000410 | 3300025912 | Bacteria | 44977 |
| 160 | Ga0207707_10025066 | 3300025912 | Bacteria | 5218 |
| 161 | Ga0207707_10181062 | 3300025912 | Bacteria | 1840 |
| 162 | Ga0207695_10052562 | 3300025913 | Bacteria | 4267 |
| 163 | Ga0207695_10072121 | 3300025913 | Bacteria | 3525 |
| 164 | Ga0207695_10234878 | 3300025913 | Bacteria | 1736 |
| 165 | Ga0207671_10010563 | 3300025914 | Bacteria | 7600 |
| 166 | Ga0207671_10073947 | 3300025914 | Bacteria | 2546 |
| 167 | Ga0207671_10340351 | 3300025914 | Bacteria | 1189 |
| 168 | Ga0207671_10466977 | 3300025914 | Bacteria | 1006 |
| 169 | Ga0207693_10000448 | 3300025915 | Bacteria | 37696 |
| 170 | Ga0207693_10096881 | 3300025915 | Bacteria | 2313 |
| 171 | Ga0207693_10172430 | 3300025915 | Bacteria | 1703 |
| 172 | Ga0207663_10046147 | 3300025916 | Bacteria | 2683 |
| 173 | Ga0207663_10369561 | 3300025916 | Bacteria | 1090 |
| 174 | Ga0207660_10002217 | 3300025917 | Bacteria | 12862 |
| 175 | Ga0207657_10063277 | 3300025919 | Bacteria | 3164 |
| 176 | Ga0207649_11013164 | 3300025920 | Bacteria | 654 |
| 177 | Ga0207652_10003383 | 3300025921 | Bacteria | 13178 |
| 178 | Ga0207694_10003326 | 3300025924 | Bacteria | 12785 |
| 179 | Ga0207650_10025940 | 3300025925 | Bacteria | 4177 |
| 180 | Ga0207687_10076669 | 3300025927 | Bacteria | 2402 |
| 181 | Ga0207700_10003609 | 3300025928 | Bacteria | 9016 |
| 182 | Ga0207700_10030554 | 3300025928 | Bacteria | 3817 |
| 183 | Ga0207700_10098071 | 3300025928 | Bacteria | 2330 |
| 184 | Ga0207664_10007010 | 3300025929 | Bacteria | 7803 |
| 185 | Ga0207664_10040627 | 3300025929 | Bacteria | 3619 |
| 186 | Ga0207644_10000428 | 3300025931 | Bacteria | 27319 |
| 187 | Ga0207644_10004012 | 3300025931 | Bacteria | 9557 |
| 188 | Ga0207686_10007583 | 3300025934 | Bacteria | 5844 |
| 189 | Ga0207709_10529278 | 3300025935 | Bacteria | 924 |
| 190 | Ga0207704_10002424 | 3300025938 | Bacteria | 8388 |
| 191 | Ga0207665_10122982 | 3300025939 | Bacteria | 1835 |
| 192 | Ga0207691_10122749 | 3300025940 | Bacteria | 2300 |
| 193 | Ga0207711_10004185 | 3300025941 | Bacteria | 12357 |
| 194 | Ga0207711_10078295 | 3300025941 | Bacteria | 2884 |
| 195 | Ga0207711_10147675 | 3300025941 | Bacteria | 2119 |
| 196 | Ga0207679_10093035 | 3300025945 | Bacteria | 2337 |
| 197 | Ga0207667_10008242 | 3300025949 | Bacteria | 12403 |
| 198 | Ga0207667_10034654 | 3300025949 | Bacteria | 5419 |
| 199 | Ga0207667_10048865 | 3300025949 | Bacteria | 4472 |
| 200 | Ga0207667_11412403 | 3300025949 | Bacteria | 669 |
| 201 | Ga0207651_10007788 | 3300025960 | Bacteria | 5729 |
| 202 | Ga0207712_10093330 | 3300025961 | Bacteria | 2221 |
| 203 | Ga0207712_10293331 | 3300025961 | Bacteria | 1332 |
| 204 | Ga0207712_10968991 | 3300025961 | Bacteria | 754 |
| 205 | Ga0207640_11644916 | 3300025981 | Bacteria | 579 |
| 206 | Ga0207658_10004751 | 3300025986 | Bacteria | 9405 |
| 207 | Ga0207677_10017062 | 3300026023 | Bacteria | 4318 |
| 208 | Ga0207703_10001524 | 3300026035 | Bacteria | 21042 |
| 209 | Ga0207703_10019203 | 3300026035 | Bacteria | 5338 |
| 210 | Ga0207703_10024678 | 3300026035 | Bacteria | 4730 |
| 211 | Ga0207678_10005556 | 3300026067 | Bacteria | 11267 |
| 212 | Ga0207702_10043700 | 3300026078 | Bacteria | 3764 |
| 213 | Ga0207641_10002325 | 3300026088 | Bacteria | 17632 |
| 214 | Ga0207641_10010988 | 3300026088 | Bacteria | 7422 |
| 215 | Ga0207648_10052141 | 3300026089 | Bacteria | 3577 |
| 216 | Ga0207676_10141379 | 3300026095 | Bacteria | 2061 |
| 217 | Ga0207675_100447158 | 3300026118 | Bacteria | 1280 |
| 218 | Ga0207675_101157852 | 3300026118 | Bacteria | 793 |
| 219 | Ga0207683_10002499 | 3300026121 | Bacteria | 16042 |
| 220 | Ga0207698_10869311 | 3300026142 | Bacteria | 907 |
| 221 | Ga0210000_1009803 | 3300027462 | Bacteria | 1413 |
| 222 | Ga0207428_10117654 | 3300027907 | Bacteria | 2040 |
| 223 | Ga0265354_1003002 | 3300028016 | Bacteria | 1956 |
| 224 | Ga0265356_1000652 | 3300028017 | Bacteria | 6018 |
| 225 | Ga0265355_1001301 | 3300028036 | Bacteria | 1594 |
| 226 | Ga0268266_10000943 | 3300028379 | Bacteria | 37110 |
| 227 | Ga0268266_10010307 | 3300028379 | Bacteria | 8174 |
| 228 | Ga0268266_10018044 | 3300028379 | Bacteria | 6013 |
| 229 | Ga0268266_10078059 | 3300028379 | Bacteria | 2880 |
| 230 | Ga0268266_11518098 | 3300028379 | Bacteria | 645 |
| 231 | Ga0268265_10131702 | 3300028380 | Bacteria | 2079 |
| 232 | Ga0268265_11267149 | 3300028380 | Bacteria | 736 |
| 233 | Ga0268264_10000102 | 3300028381 | Bacteria | 222526 |
| 234 | Ga0268264_10011424 | 3300028381 | Bacteria | 7332 |
| 235 | Ga0268264_10013393 | 3300028381 | Bacteria | 6749 |
| 236 | Ga0307515_10194780 | 3300028794 | Bacteria | 1923 |
| 237 | Ga0265338_10005919 | 3300028800 | Bacteria | 15752 |
| 238 | Ga0265338_10049050 | 3300028800 | Bacteria | 3832 |
| 239 | Ga0265338_10095180 | 3300028800 | Bacteria | 2448 |
| 240 | Ga0265338_10200568 | 3300028800 | Bacteria | 1505 |
| 241 | Ga0265763_1001367 | 3300030763 | Bacteria | 1730 |
| 242 | Ga0265770_1000452 | 3300030878 | Bacteria | 5652 |
| 243 | Ga0265768_101041 | 3300030963 | Bacteria | 1237 |
| 244 | Ga0265760_10001436 | 3300031090 | Bacteria | 7017 |
| 245 | Ga0265760_10016486 | 3300031090 | Bacteria | 2120 |
| 246 | Ga0265320_10230536 | 3300031240 | Bacteria | 824 |
| 247 | Ga0265340_10140260 | 3300031247 | Bacteria | 1106 |
| 248 | Ga0265316_10470706 | 3300031344 | Bacteria | 900 |
| 249 | Ga0307509_10186885 | 3300031507 | Bacteria | 1929 |
| 250 | Ga0307509_10280952 | 3300031507 | Bacteria | 1426 |
| 251 | Ga0316575_10009147 | 3300031665 | Bacteria | 3624 |
| 252 | Ga0316575_10016662 | 3300031665 | Bacteria | 2784 |
| 253 | Ga0316579_10031893 | 3300031691 | Bacteria | 2415 |
| 254 | Ga0265342_10501765 | 3300031712 | Bacteria | 619 |
| 255 | Ga0316576_10011141 | 3300031727 | Bacteria | 5876 |
| 256 | Ga0316576_10118356 | 3300031727 | Bacteria | 1988 |
| 257 | Ga0316578_10026381 | 3300031728 | Bacteria | 3277 |
| 258 | Ga0316578_10078056 | 3300031728 | Bacteria | 1967 |
| 259 | Ga0307516_10001316 | 3300031730 | Bacteria | 34466 |
| 260 | Ga0307416_100101875 | 3300032002 | Bacteria | 2502 |
| 261 | Ga0307416_100612891 | 3300032002 | Bacteria | 1170 |
| 262 | Ga0316593_10005115 | 3300032168 | Bacteria | 3430 |
| 263 | Ga0316593_10115806 | 3300032168 | Bacteria | 960 |
| 264 | Ga0307510_10000006 | 3300033180 | Bacteria | 566474 |
| 265 | Ga0307510_10029950 | 3300033180 | Bacteria | 6180 |
| 266 | Ga0307510_10083840 | 3300033180 | Bacteria | 3074 |
| 267 | Ga0316596_1004126 | 3300033541 | Bacteria | 3230 |
| 268 | Ga0316596_1023684 | 3300033541 | Bacteria | 1574 |
| 269 | Ga0373926_0022611 | 3300035083 | Bacteria | 2181 |
| 270 | Ga0373923_0030963 | 3300035111 | Bacteria | 2154 |
| 271 | Ga0373923_0108715 | 3300035111 | Bacteria | 1229 |
| 272 | Ga0373954_0076921 | 3300035118 | Bacteria | 1591 |
| 273 | Ga0373956_0089228 | 3300035119 | Bacteria | 1421 |
| 274 | Ga0373957_0089402 | 3300035120 | Bacteria | 1223 |
| 275 | Ga0373946_0049639 | 3300035171 | Bacteria | 1750 |
| 276 | Ga0373955_0018691 | 3300035172 | Bacteria | 3452 |
| 277 | Ga0373955_0046500 | 3300035172 | Bacteria | 2346 |
| 278 | Ga0316574_0024069 | 3300035398 | Bacteria | 3640 |
| 279 | Ga0316574_0037387 | 3300035398 | Bacteria | 2977 |
| 280 | Ga0316574_0038892 | 3300035398 | Bacteria | 2922 |
| 281 | Ga0316574_0260206 | 3300035398 | Bacteria | 1108 |
| 282 | Ga0373924_0068613 | 3300035410 | Bacteria | 1493 |
| 283 | Ga0373935_0124420 | 3300035692 | Bacteria | 1726 |
| 284 | Ga0373935_0382277 | 3300035692 | Bacteria | 1008 |
| 285 | Ga0373927_0009161 | 3300035695 | Bacteria | 6644 |
| 286 | Ga0373933_0019812 | 3300035724 | Bacteria | 3807 |
| 287 | Ga0373933_0121455 | 3300035724 | Bacteria | 1636 |
| 288 | Ga0373937_0069392 | 3300036401 | Bacteria | 3250 |
| 289 | Ga0373937_0086972 | 3300036401 | Bacteria | 2892 |
| 290 | Ga0373937_0114140 | 3300036401 | Bacteria | 2514 |
| 291 | Ga0316584_0248223 | 3300036712 | Unclassified | 1301 |
| 292 | Ga0316584_0293643 | 3300036712 | Bacteria | 1179 |
| 293 | Ga0373925_0026649 | 3300037068 | Bacteria | 4230 |
| 294 | Ga0373925_0492416 | 3300037068 | Bacteria | 1006 |
| 295 | Ga0373925_0714458 | 3300037068 | Bacteria | 826 |
| 296 | Ga0395900_0328446 | 3300037418 | Bacteria | 1508 |
| 297 | Ga0395898_0014841 | 3300037466 | Bacteria | 7998 |
| 298 | Ga0395898_0266406 | 3300037466 | Bacteria | 1634 |
| 299 | Ga0395898_0740577 | 3300037466 | Bacteria | 924 |
| 300 | Ga0436364_1319238 | 3300037853 | Bacteria | 2301 |
| 301 | Ga0436364_1434626 | 3300037853 | Bacteria | 789 |
| 302 | Ga0395901_0563062 | 3300038443 | Bacteria | 1154 |
| 303 | Ga0436365_0032067 | 3300039437 | Bacteria | 3787 |
| 304 | Ga0436365_0123496 | 3300039437 | Bacteria | 3393 |
| 305 | Ga0436360_0007268 | 3300039438 | Bacteria | 1005 |
| 306 | Ga0436360_0226775 | 3300039438 | Bacteria | 2277 |
| 307 | Ga0436360_0858685 | 3300039438 | Bacteria | 1021 |
| 308 | Ga0436360_1071583 | 3300039438 | Bacteria | 1472 |
| 309 | Ga0436361_0054611 | 3300039447 | Bacteria | 2385 |
| 310 | Ga0436361_0201021 | 3300039447 | Bacteria | 2204 |
| 311 | Ga0436361_0725603 | 3300039447 | Bacteria | 876 |
| 312 | Ga0436363_0251444 | 3300039450 | Bacteria | 1083 |
| 313 | Ga0436363_0498253 | 3300039450 | Bacteria | 9613 |
| 314 | Ga0436363_0854207 | 3300039450 | Bacteria | 3337 |
| 315 | Ga0436363_1530821 | 3300039450 | Bacteria | 2990 |
| 316 | Ga0436362_0226664 | 3300039453 | Bacteria | 2693 |
| 317 | Ga0436362_0485101 | 3300039453 | Bacteria | 1888 |
| 318 | Ga0436362_0693496 | 3300039453 | Bacteria | 3146 |
| 319 | Ga0436362_0892755 | 3300039453 | Bacteria | 928 |
| 320 | Ga0451807_0310094 | 3300041486 | Bacteria | 1035 |
| 321 | Ga0466966_0002570 | 3300044684 | Bacteria | 11886 |
| 322 | Ga0466964_0000625 | 3300044706 | Bacteria | 11251 |
| 323 | Ga0466971_0001102 | 3300044719 | Bacteria | 11213 |
| 324 | Ga0466968_0018375 | 3300044735 | Bacteria | 2804 |
| 325 | Ga0466970_0013525 | 3300044765 | Bacteria | 4185 |
| 326 | Ga0466957_0529047 | 3300044842 | Bacteria | 820 |
| 327 | Ga0466960_0071463 | 3300044901 | Bacteria | 1728 |
| 328 | Ga0466959_0103445 | 3300045049 | Bacteria | 2037 |
| 329 | Ga0466959_0473198 | 3300045049 | Bacteria | 848 |
| 330 | Ga0451576_0079035 | 3300045051 | Bacteria | 3422 |
| 331 | Ga0451576_1572370 | 3300045051 | Bacteria | 682 |
| 332 | Ga0495591_012181 | 3300046458 | Bacteria | 3213 |
| 333 | Ga0495580_0110709 | 3300046472 | Bacteria | 1907 |
| 334 | Ga0495580_0256741 | 3300046472 | Bacteria | 1195 |
| 335 | Ga0495580_0262299 | 3300046472 | Bacteria | 1181 |
| 336 | Ga0495582_0021138 | 3300046473 | Bacteria | 3564 |
| 337 | Ga0495639_0038324 | 3300046475 | Bacteria | 2152 |
| 338 | Ga0495606_0121762 | 3300046507 | Bacteria | 1561 |
| 339 | Ga0495606_0178577 | 3300046507 | Bacteria | 1226 |
| 340 | Ga0495606_0302734 | 3300046507 | Bacteria | 866 |
| 341 | Ga0495618_0218792 | 3300046514 | Bacteria | 1202 |
| 342 | Ga0495628_0371882 | 3300046516 | Bacteria | 1048 |
| 343 | Ga0495630_0140489 | 3300046517 | Bacteria | 1836 |
| 344 | Ga0495630_0553636 | 3300046517 | Bacteria | 882 |
| 345 | Ga0495643_0036660 | 3300046522 | Bacteria | 2693 |
| 346 | Ga0495644_0042747 | 3300046523 | Bacteria | 1706 |
| 347 | Ga0495663_0172354 | 3300046525 | Bacteria | 746 |
| 348 | Ga0495666_0151868 | 3300046526 | Bacteria | 1077 |
| 349 | Ga0495642_0041099 | 3300046528 | Bacteria | 1880 |
| 350 | Ga0495640_0102492 | 3300046533 | Bacteria | 1878 |
| 351 | Ga0495598_0000303 | 3300046537 | Bacteria | 8829 |
| 352 | Ga0495609_0106656 | 3300046538 | Bacteria | 1211 |
| 353 | Ga0495645_0126845 | 3300046543 | Bacteria | 1793 |
| 354 | Ga0495645_0396572 | 3300046543 | Bacteria | 880 |
| 355 | Ga0495633_0031438 | 3300046558 | Bacteria | 2573 |
| 356 | Ga0495656_0017671 | 3300046615 | Bacteria | 2724 |
| 357 | Ga0495611_0045842 | 3300046648 | Bacteria | 1959 |
| 358 | Ga0495625_0070385 | 3300046660 | Bacteria | 2456 |
| 359 | Ga0495647_0006386 | 3300046681 | Bacteria | 3900 |
| 360 | Ga0495647_0032589 | 3300046681 | Bacteria | 1943 |
| 361 | Ga0495658_0027808 | 3300046683 | Bacteria | 3046 |
| 362 | Ga0495658_0027894 | 3300046683 | Bacteria | 3043 |
| 363 | Ga0495658_0184027 | 3300046683 | Bacteria | 1297 |
| 364 | Ga0495671_0133944 | 3300046692 | Bacteria | 1208 |
| 365 | Ga0495649_0078294 | 3300046694 | Bacteria | 1769 |
| 366 | Ga0495660_0135192 | 3300046810 | Bacteria | 1232 |
| 367 | Ga0495604_0208301 | 3300047317 | Bacteria | 1352 |
| 368 | Ga0495680_0151453 | 3300047322 | Bacteria | 1691 |
| 369 | Ga0495683_0162856 | 3300047323 | Bacteria | 1030 |
| 370 | Ga0495681_0005696 | 3300047470 | Bacteria | 8291 |
| 371 | Ga0495686_0195418 | 3300047472 | Bacteria | 1164 |
| 372 | Ga0496100_0003550 | 3300048903 | Bacteria | 8145 |
| 373 | Ga0496100_0035274 | 3300048903 | Bacteria | 3145 |
| 374 | Ga0496100_0271449 | 3300048903 | Bacteria | 1261 |
| 375 | Ga0496101_0018936 | 3300048904 | Bacteria | 4690 |
| 376 | Ga0496101_0048517 | 3300048904 | Bacteria | 3052 |
| 377 | Ga0496101_0088368 | 3300048904 | Bacteria | 2302 |
| 378 | Ga0496101_0329075 | 3300048904 | Bacteria | 1199 |
| 379 | Ga0496102_0003295 | 3300048905 | Bacteria | 13691 |
| 380 | Ga0496102_0006276 | 3300048905 | Bacteria | 10133 |
| 381 | Ga0496102_0091759 | 3300048905 | Bacteria | 2812 |
| 382 | Ga0496102_0120316 | 3300048905 | Bacteria | 2452 |
| 383 | Ga0496102_0162163 | 3300048905 | Bacteria | 2103 |
| 384 | Ga0496103_0004906 | 3300048906 | Bacteria | 8077 |
| 385 | Ga0496104_0016622 | 3300048907 | Bacteria | 6686 |
| 386 | Ga0496104_0043605 | 3300048907 | Bacteria | 4212 |
| 387 | Ga0496105_0003469 | 3300048908 | Bacteria | 11665 |
| 388 | Ga0496105_0010900 | 3300048908 | Bacteria | 7160 |
| 389 | Ga0496105_0078997 | 3300048908 | Bacteria | 2717 |
| 390 | Ga0496106_0004678 | 3300048909 | Bacteria | 10148 |
| 391 | Ga0496106_0066543 | 3300048909 | Bacteria | 2745 |
| 392 | Ga0496107_0001576 | 3300048910 | Bacteria | 14181 |
| 393 | Ga0496107_0039998 | 3300048910 | Bacteria | 3365 |
| 394 | Ga0496107_0095607 | 3300048910 | Bacteria | 2174 |
| 395 | Ga0496107_0179047 | 3300048910 | Bacteria | 1574 |
| 396 | Ga0496108_0002086 | 3300048911 | Bacteria | 15999 |
| 397 | Ga0496109_0006030 | 3300048912 | Bacteria | 10183 |
| 398 | Ga0496110_0005639 | 3300048913 | Bacteria | 9824 |
| 399 | Ga0496111_0003878 | 3300048914 | Bacteria | 9354 |
| 400 | Ga0496112_0009054 | 3300048915 | Bacteria | 8943 |
| 401 | Ga0496113_0106557 | 3300048916 | Bacteria | 2177 |
| 402 | Ga0496114_0002220 | 3300048917 | Bacteria | 14800 |
| 403 | Ga0496114_0017246 | 3300048917 | Bacteria | 5825 |
| 404 | Ga0496115_0005471 | 3300048918 | Bacteria | 9241 |
| 405 | Ga0496115_0126283 | 3300048918 | Bacteria | 2107 |
| 406 | Ga0496115_0137279 | 3300048918 | Bacteria | 2016 |
| 407 | Ga0496115_0885551 | 3300048918 | Bacteria | 689 |
| 408 | Ga0496116_0024881 | 3300048919 | Bacteria | 4415 |
| 409 | Ga0496117_0000787 | 3300048920 | Bacteria | 49745 |
| 410 | Ga0496117_0073497 | 3300048920 | Bacteria | 2281 |
| 411 | Ga0496118_0000032 | 3300048921 | Bacteria | 330072 |
| 412 | Ga0496118_0013267 | 3300048921 | Bacteria | 7811 |
| 413 | Ga0496119_0052426 | 3300048922 | Bacteria | 2498 |
| 414 | Ga0496120_0020312 | 3300048923 | Bacteria | 4225 |
| 415 | Ga0496120_0175802 | 3300048923 | Bacteria | 1055 |
| 416 | Ga0496121_0000704 | 3300048924 | Bacteria | 62218 |
| 417 | Ga0496121_0192815 | 3300048924 | Bacteria | 1459 |
| 418 | Ga0496124_0006228 | 3300048927 | Bacteria | 13069 |
| 419 | Ga0496125_0001378 | 3300048928 | Bacteria | 35674 |
| 420 | Ga0496125_0005100 | 3300048928 | Bacteria | 14779 |
| 421 | Ga0496125_0081233 | 3300048928 | Bacteria | 2477 |
| 422 | Ga0496125_0279403 | 3300048928 | Bacteria | 1035 |
| 423 | Ga0496126_0011396 | 3300048929 | Bacteria | 9209 |
| 424 | Ga0496126_0404154 | 3300048929 | Bacteria | 1107 |
| 425 | Ga0496126_0999333 | 3300048929 | Bacteria | 628 |
| 426 | Ga0495682_0111199 | 3300049460 | Bacteria | 982 |
| 427 | Ga0501031_0121777 | 3300049568 | Bacteria | 1704 |
| 428 | Ga0501032_0186579 | 3300049569 | Bacteria | 1356 |
| 429 | Ga0501033_0106171 | 3300049570 | Bacteria | 2046 |
| 430 | Ga0501036_0048255 | 3300049572 | Bacteria | 3605 |
| 431 | Ga0501037_0024581 | 3300049573 | Bacteria | 4455 |
| 432 | Ga0501038_0090870 | 3300049574 | Bacteria | 2558 |
| 433 | Ga0501040_0008066 | 3300049576 | Bacteria | 6839 |
| 434 | Ga0501041_0119305 | 3300049577 | Bacteria | 1638 |
| 435 | Ga0501042_0158721 | 3300049578 | Bacteria | 1631 |
| 436 | Ga0501043_0255676 | 3300049579 | Bacteria | 1348 |
| 437 | Ga0501046_0105554 | 3300049580 | Bacteria | 2157 |
| 438 | Ga0501048_0067468 | 3300049582 | Bacteria | 2528 |
| 439 | Ga0501068_0026867 | 3300049584 | Bacteria | 3395 |
| 440 | Ga0501070_0044235 | 3300049586 | Bacteria | 3706 |
| 441 | Ga0501070_0311987 | 3300049586 | Bacteria | 1280 |
| 442 | Ga0501070_0808365 | 3300049586 | Bacteria | 736 |
| 443 | Ga0501071_0003527 | 3300049587 | Bacteria | 9786 |
| 444 | Ga0501071_0046738 | 3300049587 | Bacteria | 3109 |
| 445 | Ga0501072_0025385 | 3300049588 | Bacteria | 4617 |
| 446 | Ga0501072_0284010 | 3300049588 | Bacteria | 1316 |
| 447 | Ga0501073_0089829 | 3300049589 | Bacteria | 2136 |
| 448 | Ga0501075_0055471 | 3300049591 | Bacteria | 2981 |
| 449 | Ga0501075_0277299 | 3300049591 | Bacteria | 1278 |
| 450 | Ga0501076_0022764 | 3300049592 | Bacteria | 4818 |
| 451 | Ga0501077_0029086 | 3300049593 | Bacteria | 3512 |
| 452 | Ga0501077_0059648 | 3300049593 | Bacteria | 2422 |
| 453 | Ga0501077_0121296 | 3300049593 | Bacteria | 1657 |
| 454 | Ga0501080_0037660 | 3300049742 | Bacteria | 4517 |
| 455 | Ga0501081_0018126 | 3300049743 | Bacteria | 4672 |
| 456 | Ga0501083_0067453 | 3300049744 | Bacteria | 2382 |
| 457 | Ga0501083_0079781 | 3300049744 | Bacteria | 2170 |
| 458 | Ga0501035_0180906 | 3300049822 | Bacteria | 1816 |
| 459 | Ga0501044_0260398 | 3300049823 | Bacteria | 1673 |
| 460 | Ga0501045_0084307 | 3300049824 | Bacteria | 2344 |
| 461 | Ga0501045_0649723 | 3300049824 | Bacteria | 780 |
| 462 | nmdc:mga09592_8260_c1 | 3300050508 | Bacteria | 8468 |
| 463 | nmdc:mga08y16_15367_c1 | 3300050511 | Bacteria | 8050 |
| 464 | nmdc:mga08x19_29504_c1 | 3300050514 | Bacteria | 3440 |
| 465 | Ga0495601_0083233 | 3300053077 | Bacteria | 2055 |
| 466 | Ga0495612_0085153 | 3300053078 | Bacteria | 1332 |
| 467 | Ga0495612_0109745 | 3300053078 | Bacteria | 1180 |
| 468 | Ga0495612_0302336 | 3300053078 | Bacteria | 718 |
| 469 | Ga0495619_0091313 | 3300053085 | Bacteria | 2062 |
| 470 | Ga0500583_0052059 | 3300053092 | Bacteria | 1904 |
| 471 | Ga0500558_173529 | 3300053106 | Bacteria | 777 |
| 472 | Ga0500591_078333 | 3300053115 | Bacteria | 1477 |
| 473 | Ga0500616_0007626 | 3300053153 | Bacteria | 6839 |
| 474 | Ga0501084_0144399 | 3300054114 | Bacteria | 2004 |
| 475 | Ga0501084_0997132 | 3300054114 | Bacteria | 704 |
| 476 | Ga0587082_085789 | 3300059504 | Bacteria | 664 |
| 477 | Ga0587067_027451 | 3300059640 | Bacteria | 1027 |
| 478 | Ga0587076_086292 | 3300059645 | Bacteria | 678 |
| 479 | Ga0501082_0087089 | 3300060353 | Bacteria | 2694 |
| 480 | Ga0501082_0679045 | 3300060353 | Bacteria | 901 |
| 481 | Ga0466962_0001207 | 3300061719 | Bacteria | 11873 |
| 482 | Ga0530510_0078825 | 3300061734 | Bacteria | 2396 |
| 483 | Ga0530510_0119058 | 3300061734 | Bacteria | 1938 |
| 484 | Ga0530510_0170978 | 3300061734 | Bacteria | 1609 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300060353 | Ga0501082_0679045 | Ga0501082_0679045_12_512 | 163 |
| 2 | 3300005548 | Ga0070665_100047121 | Ga0070665_1000471218 | 165 |
| 3 | 3300028379 | Ga0268266_10078059 | Ga0268266_100780594 | 165 |
| 4 | 3300049577 | Ga0501041_0119305 | Ga0501041_0119305_1109_1624 | 165 |
| 5 | 3300005937 | Ga0081455_10000719 | Ga0081455_1000071948 | 169 |
| 6 | 3300025935 | Ga0207709_10529278 | Ga0207709_105292781 | 169 |
| 7 | 3300028380 | Ga0268265_11267149 | Ga0268265_112671492 | 169 |
| 8 | 3300031507 | Ga0307509_10280952 | Ga0307509_102809522 | 169 |
| 9 | 3300039438 | Ga0436360_1071583 | Ga0436360_1071583_373_900 | 169 |
| 10 | 3300039447 | Ga0436361_0054611 | Ga0436361_0054611_1216_1743 | 169 |
| 11 | 3300039453 | Ga0436362_0226664 | Ga0436362_0226664_1901_2428 | 169 |
| 12 | 3300044901 | Ga0466960_0071463 | Ga0466960_0071463_747_1274 | 169 |
| 13 | 3300049586 | Ga0501070_0311987 | Ga0501070_0311987_116_643 | 169 |
| 14 | 3300049586 | Ga0501070_0808365 | Ga0501070_0808365_19_546 | 169 |
| 15 | 3300049587 | Ga0501071_0046738 | Ga0501071_0046738_2445_2972 | 169 |
| 16 | 3300049593 | Ga0501077_0059648 | Ga0501077_0059648_745_1272 | 169 |
| 17 | 3300049744 | Ga0501083_0067453 | Ga0501083_0067453_1193_1720 | 169 |
| 18 | 3300049824 | Ga0501045_0649723 | Ga0501045_0649723_230_757 | 169 |
| 19 | 3300053153 | Ga0500616_0007626 | Ga0500616_0007626_1972_2499 | 169 |
| 20 | 3300004799 | Ga0058863_11971832 | Ga0058863_119718328 | 170 |
| 21 | 3300005331 | Ga0070670_100042316 | Ga0070670_1000423166 | 170 |
| 22 | 3300005334 | Ga0068869_101163005 | Ga0068869_1011630051 | 170 |
| 23 | 3300005335 | Ga0070666_10001446 | Ga0070666_1000144618 | 170 |
| 24 | 3300005336 | Ga0070680_100262924 | Ga0070680_1002629242 | 170 |
| 25 | 3300005338 | Ga0068868_100008294 | Ga0068868_1000082943 | 170 |
| 26 | 3300005355 | Ga0070671_100003161 | Ga0070671_1000031619 | 170 |
| 27 | 3300005355 | Ga0070671_100005400 | Ga0070671_10000540017 | 170 |
| 28 | 3300005367 | Ga0070667_100012347 | Ga0070667_10001234713 | 170 |
| 29 | 3300005367 | Ga0070667_100055472 | Ga0070667_1000554724 | 170 |
| 30 | 3300005434 | Ga0070709_10009928 | Ga0070709_100099289 | 170 |
| 31 | 3300005434 | Ga0070709_10015515 | Ga0070709_100155157 | 170 |
| 32 | 3300005434 | Ga0070709_10121175 | Ga0070709_101211751 | 170 |
| 33 | 3300005435 | Ga0070714_100009500 | Ga0070714_10000950011 | 170 |
| 34 | 3300005435 | Ga0070714_100032759 | Ga0070714_1000327592 | 170 |
| 35 | 3300005436 | Ga0070713_100001795 | Ga0070713_10000179519 | 170 |
| 36 | 3300005436 | Ga0070713_100006105 | Ga0070713_10000610518 | 170 |
| 37 | 3300005436 | Ga0070713_100409524 | Ga0070713_1004095241 | 170 |
| 38 | 3300005437 | Ga0070710_10254165 | Ga0070710_102541652 | 170 |
| 39 | 3300005439 | Ga0070711_100001465 | Ga0070711_10000146512 | 170 |
| 40 | 3300005439 | Ga0070711_100054156 | Ga0070711_1000541562 | 170 |
| 41 | 3300005439 | Ga0070711_100152918 | Ga0070711_1001529183 | 170 |
| 42 | 3300005440 | Ga0070705_100281745 | Ga0070705_1002817452 | 170 |
| 43 | 3300005455 | Ga0070663_100042078 | Ga0070663_1000420783 | 170 |
| 44 | 3300005455 | Ga0070663_101024477 | Ga0070663_1010244771 | 170 |
| 45 | 3300005456 | Ga0070678_100002594 | Ga0070678_10000259410 | 170 |
| 46 | 3300005458 | Ga0070681_10035786 | Ga0070681_100357869 | 170 |
| 47 | 3300005458 | Ga0070681_10281253 | Ga0070681_102812532 | 170 |
| 48 | 3300005459 | Ga0068867_100034823 | Ga0068867_1000348239 | 170 |
| 49 | 3300005518 | Ga0070699_100038586 | Ga0070699_1000385866 | 170 |
| 50 | 3300005530 | Ga0070679_100017288 | Ga0070679_1000172884 | 170 |
| 51 | 3300005539 | Ga0068853_100093611 | Ga0068853_1000936115 | 170 |
| 52 | 3300005539 | Ga0068853_100303829 | Ga0068853_1003038293 | 170 |
| 53 | 3300005543 | Ga0070672_100123866 | Ga0070672_1001238662 | 170 |
| 54 | 3300005544 | Ga0070686_100067091 | Ga0070686_1000670914 | 170 |
| 55 | 3300005545 | Ga0070695_100002554 | Ga0070695_1000025543 | 170 |
| 56 | 3300005548 | Ga0070665_100005442 | Ga0070665_10000544211 | 170 |
| 57 | 3300005548 | Ga0070665_100014481 | Ga0070665_1000144819 | 170 |
| 58 | 3300005548 | Ga0070665_100045273 | Ga0070665_1000452736 | 170 |
| 59 | 3300005563 | Ga0068855_100032357 | Ga0068855_1000323574 | 170 |
| 60 | 3300005563 | Ga0068855_100114994 | Ga0068855_1001149947 | 170 |
| 61 | 3300005563 | Ga0068855_100285468 | Ga0068855_1002854683 | 170 |
| 62 | 3300005564 | Ga0070664_100082104 | Ga0070664_1000821042 | 170 |
| 63 | 3300005578 | Ga0068854_100104735 | Ga0068854_1001047355 | 170 |
| 64 | 3300005614 | Ga0068856_100006458 | Ga0068856_10000645821 | 170 |
| 65 | 3300005614 | Ga0068856_100042931 | Ga0068856_1000429316 | 170 |
| 66 | 3300005614 | Ga0068856_100161497 | Ga0068856_1001614973 | 170 |
| 67 | 3300005615 | Ga0070702_100447944 | Ga0070702_1004479441 | 170 |
| 68 | 3300005616 | Ga0068852_100874579 | Ga0068852_1008745792 | 170 |
| 69 | 3300005617 | Ga0068859_100000641 | Ga0068859_10000064118 | 170 |
| 70 | 3300005617 | Ga0068859_100056515 | Ga0068859_1000565157 | 170 |
| 71 | 3300005718 | Ga0068866_10002031 | Ga0068866_100020319 | 170 |
| 72 | 3300005841 | Ga0068863_100008761 | Ga0068863_10000876113 | 170 |
| 73 | 3300005842 | Ga0068858_100000125 | Ga0068858_10000012550 | 170 |
| 74 | 3300005842 | Ga0068858_100004270 | Ga0068858_10000427016 | 170 |
| 75 | 3300005842 | Ga0068858_100054829 | Ga0068858_1000548299 | 170 |
| 76 | 3300005842 | Ga0068858_100364805 | Ga0068858_1003648053 | 170 |
| 77 | 3300005843 | Ga0068860_100006244 | Ga0068860_10000624410 | 170 |
| 78 | 3300005843 | Ga0068860_100009263 | Ga0068860_10000926319 | 170 |
| 79 | 3300005843 | Ga0068860_100010872 | Ga0068860_10001087211 | 170 |
| 80 | 3300005844 | Ga0068862_100117477 | Ga0068862_1001174775 | 170 |
| 81 | 3300006028 | Ga0070717_10213898 | Ga0070717_102138983 | 170 |
| 82 | 3300006163 | Ga0070715_10000668 | Ga0070715_1000066813 | 170 |
| 83 | 3300006163 | Ga0070715_10032786 | Ga0070715_100327863 | 170 |
| 84 | 3300006173 | Ga0070716_100034519 | Ga0070716_1000345196 | 170 |
| 85 | 3300006173 | Ga0070716_100069198 | Ga0070716_1000691982 | 170 |
| 86 | 3300006175 | Ga0070712_100001456 | Ga0070712_10000145612 | 170 |
| 87 | 3300006175 | Ga0070712_100057768 | Ga0070712_1000577684 | 170 |
| 88 | 3300006175 | Ga0070712_100250139 | Ga0070712_1002501393 | 170 |
| 89 | 3300006237 | Ga0097621_100003525 | Ga0097621_10000352511 | 170 |
| 90 | 3300006358 | Ga0068871_100044280 | Ga0068871_1000442802 | 170 |
| 91 | 3300006881 | Ga0068865_100001214 | Ga0068865_10000121418 | 170 |
| 92 | 3300006914 | Ga0075436_100243591 | Ga0075436_1002435912 | 170 |
| 93 | 3300006931 | Ga0097620_100000641 | Ga0097620_10000064118 | 170 |
| 94 | 3300006931 | Ga0097620_100056514 | Ga0097620_1000565145 | 170 |
| 95 | 3300007265 | Ga0099794_10054040 | Ga0099794_100540402 | 170 |
| 96 | 3300009092 | Ga0105250_10072284 | Ga0105250_100722841 | 170 |
| 97 | 3300009093 | Ga0105240_10065094 | Ga0105240_100650946 | 170 |
| 98 | 3300009093 | Ga0105240_10086135 | Ga0105240_100861356 | 170 |
| 99 | 3300009093 | Ga0105240_10459695 | Ga0105240_104596952 | 170 |
| 100 | 3300009093 | Ga0105240_10496035 | Ga0105240_104960352 | 170 |
| 101 | 3300009098 | Ga0105245_10099675 | Ga0105245_100996753 | 170 |
| 102 | 3300009101 | Ga0105247_10002466 | Ga0105247_1000246618 | 170 |
| 103 | 3300009101 | Ga0105247_10015909 | Ga0105247_100159099 | 170 |
| 104 | 3300009174 | Ga0105241_10011879 | Ga0105241_100118798 | 170 |
| 105 | 3300009176 | Ga0105242_10003628 | Ga0105242_1000362815 | 170 |
| 106 | 3300009177 | Ga0105248_10003146 | Ga0105248_1000314618 | 170 |
| 107 | 3300009177 | Ga0105248_10005842 | Ga0105248_1000584216 | 170 |
| 108 | 3300009177 | Ga0105248_10260281 | Ga0105248_102602814 | 170 |
| 109 | 3300009545 | Ga0105237_10096005 | Ga0105237_100960057 | 170 |
| 110 | 3300009545 | Ga0105237_10099219 | Ga0105237_100992195 | 170 |
| 111 | 3300009551 | Ga0105238_10022279 | Ga0105238_100222795 | 170 |
| 112 | 3300009551 | Ga0105238_10248804 | Ga0105238_102488043 | 170 |
| 113 | 3300009551 | Ga0105238_10337205 | Ga0105238_103372053 | 170 |
| 114 | 3300009553 | Ga0105249_10014582 | Ga0105249_100145829 | 170 |
| 115 | 3300009553 | Ga0105249_10115367 | Ga0105249_101153674 | 170 |
| 116 | 3300009553 | Ga0105249_10690590 | Ga0105249_106905902 | 170 |
| 117 | 3300011119 | Ga0105246_10036204 | Ga0105246_100362045 | 170 |
| 118 | 3300013100 | Ga0157373_10448086 | Ga0157373_104480862 | 170 |
| 119 | 3300013104 | Ga0157370_10253845 | Ga0157370_102538453 | 170 |
| 120 | 3300013104 | Ga0157370_10343782 | Ga0157370_103437822 | 170 |
| 121 | 3300013105 | Ga0157369_10015323 | Ga0157369_100153233 | 170 |
| 122 | 3300013105 | Ga0157369_10051835 | Ga0157369_100518356 | 170 |
| 123 | 3300013105 | Ga0157369_10988423 | Ga0157369_109884232 | 170 |
| 124 | 3300013296 | Ga0157374_10002813 | Ga0157374_1000281316 | 170 |
| 125 | 3300013296 | Ga0157374_10361226 | Ga0157374_103612262 | 170 |
| 126 | 3300013297 | Ga0157378_10006374 | Ga0157378_100063746 | 170 |
| 127 | 3300013306 | Ga0163162_10006236 | Ga0163162_1000623618 | 170 |
| 128 | 3300013306 | Ga0163162_10026596 | Ga0163162_100265966 | 170 |
| 129 | 3300013306 | Ga0163162_10096841 | Ga0163162_100968416 | 170 |
| 130 | 3300013307 | Ga0157372_10049576 | Ga0157372_100495768 | 170 |
| 131 | 3300013308 | Ga0157375_10006856 | Ga0157375_100068569 | 170 |
| 132 | 3300014325 | Ga0163163_10007457 | Ga0163163_1000745713 | 170 |
| 133 | 3300014325 | Ga0163163_10171101 | Ga0163163_101711012 | 170 |
| 134 | 3300014968 | Ga0157379_10006918 | Ga0157379_1000691815 | 170 |
| 135 | 3300014968 | Ga0157379_10055138 | Ga0157379_100551388 | 170 |
| 136 | 3300014968 | Ga0157379_10082681 | Ga0157379_100826816 | 170 |
| 137 | 3300014968 | Ga0157379_10104840 | Ga0157379_101048404 | 170 |
| 138 | 3300014969 | Ga0157376_10131141 | Ga0157376_101311412 | 170 |
| 139 | 3300020077 | Ga0206351_10700694 | Ga0206351_107006944 | 170 |
| 140 | 3300020081 | Ga0206354_10785729 | Ga0206354_107857291 | 170 |
| 141 | 3300020082 | Ga0206353_11779741 | Ga0206353_117797413 | 170 |
| 142 | 3300021377 | Ga0213874_10021138 | Ga0213874_100211382 | 170 |
| 143 | 3300021377 | Ga0213874_10153789 | Ga0213874_101537892 | 170 |
| 144 | 3300021441 | Ga0213871_10014920 | Ga0213871_100149204 | 170 |
| 145 | 3300025898 | Ga0207692_10065245 | Ga0207692_100652452 | 170 |
| 146 | 3300025899 | Ga0207642_10016853 | Ga0207642_100168534 | 170 |
| 147 | 3300025900 | Ga0207710_10000332 | Ga0207710_1000033237 | 170 |
| 148 | 3300025900 | Ga0207710_10009562 | Ga0207710_100095626 | 170 |
| 149 | 3300025900 | Ga0207710_10010376 | Ga0207710_100103768 | 170 |
| 150 | 3300025900 | Ga0207710_10056714 | Ga0207710_100567142 | 170 |
| 151 | 3300025903 | Ga0207680_10009301 | Ga0207680_100093019 | 170 |
| 152 | 3300025903 | Ga0207680_10063035 | Ga0207680_100630352 | 170 |
| 153 | 3300025903 | Ga0207680_10264563 | Ga0207680_102645633 | 170 |
| 154 | 3300025905 | Ga0207685_10000121 | Ga0207685_1000012112 | 170 |
| 155 | 3300025905 | Ga0207685_10032092 | Ga0207685_100320921 | 170 |
| 156 | 3300025906 | Ga0207699_10051184 | Ga0207699_100511846 | 170 |
| 157 | 3300025911 | Ga0207654_10034349 | Ga0207654_100343496 | 170 |
| 158 | 3300025912 | Ga0207707_10000276 | Ga0207707_1000027630 | 170 |
| 159 | 3300025912 | Ga0207707_10000410 | Ga0207707_1000041033 | 170 |
| 160 | 3300025912 | Ga0207707_10025066 | Ga0207707_100250669 | 170 |
| 161 | 3300025912 | Ga0207707_10181062 | Ga0207707_101810622 | 170 |
| 162 | 3300025913 | Ga0207695_10052562 | Ga0207695_100525627 | 170 |
| 163 | 3300025913 | Ga0207695_10072121 | Ga0207695_100721218 | 170 |
| 164 | 3300025913 | Ga0207695_10234878 | Ga0207695_102348782 | 170 |
| 165 | 3300025914 | Ga0207671_10010563 | Ga0207671_100105639 | 170 |
| 166 | 3300025914 | Ga0207671_10073947 | Ga0207671_100739475 | 170 |
| 167 | 3300025914 | Ga0207671_10340351 | Ga0207671_103403512 | 170 |
| 168 | 3300025914 | Ga0207671_10466977 | Ga0207671_104669772 | 170 |
| 169 | 3300025915 | Ga0207693_10000448 | Ga0207693_1000044818 | 170 |
| 170 | 3300025915 | Ga0207693_10096881 | Ga0207693_100968815 | 170 |
| 171 | 3300025915 | Ga0207693_10172430 | Ga0207693_101724303 | 170 |
| 172 | 3300025916 | Ga0207663_10046147 | Ga0207663_100461471 | 170 |
| 173 | 3300025917 | Ga0207660_10002217 | Ga0207660_100022174 | 170 |
| 174 | 3300025919 | Ga0207657_10063277 | Ga0207657_100632774 | 170 |
| 175 | 3300025920 | Ga0207649_11013164 | Ga0207649_110131642 | 170 |
| 176 | 3300025921 | Ga0207652_10003383 | Ga0207652_1000338312 | 170 |
| 177 | 3300025924 | Ga0207694_10003326 | Ga0207694_1000332610 | 170 |
| 178 | 3300025925 | Ga0207650_10025940 | Ga0207650_100259407 | 170 |
| 179 | 3300025927 | Ga0207687_10076669 | Ga0207687_100766695 | 170 |
| 180 | 3300025928 | Ga0207700_10003609 | Ga0207700_1000360911 | 170 |
| 181 | 3300025928 | Ga0207700_10030554 | Ga0207700_100305542 | 170 |
| 182 | 3300025929 | Ga0207664_10007010 | Ga0207664_100070106 | 170 |
| 183 | 3300025929 | Ga0207664_10040627 | Ga0207664_100406273 | 170 |
| 184 | 3300025931 | Ga0207644_10000428 | Ga0207644_1000042816 | 170 |
| 185 | 3300025931 | Ga0207644_10004012 | Ga0207644_1000401212 | 170 |
| 186 | 3300025934 | Ga0207686_10007583 | Ga0207686_100075836 | 170 |
| 187 | 3300025938 | Ga0207704_10002424 | Ga0207704_100024245 | 170 |
| 188 | 3300025939 | Ga0207665_10122982 | Ga0207665_101229823 | 170 |
| 189 | 3300025940 | Ga0207691_10122749 | Ga0207691_101227493 | 170 |
| 190 | 3300025941 | Ga0207711_10004185 | Ga0207711_1000418512 | 170 |
| 191 | 3300025941 | Ga0207711_10078295 | Ga0207711_100782952 | 170 |
| 192 | 3300025941 | Ga0207711_10147675 | Ga0207711_101476755 | 170 |
| 193 | 3300025945 | Ga0207679_10093035 | Ga0207679_100930353 | 170 |
| 194 | 3300025949 | Ga0207667_10008242 | Ga0207667_1000824218 | 170 |
| 195 | 3300025949 | Ga0207667_10034654 | Ga0207667_1003465410 | 170 |
| 196 | 3300025949 | Ga0207667_10048865 | Ga0207667_1004886511 | 170 |
| 197 | 3300025960 | Ga0207651_10007788 | Ga0207651_100077885 | 170 |
| 198 | 3300025961 | Ga0207712_10093330 | Ga0207712_100933305 | 170 |
| 199 | 3300025961 | Ga0207712_10293331 | Ga0207712_102933312 | 170 |
| 200 | 3300025961 | Ga0207712_10968991 | Ga0207712_109689912 | 170 |
| 201 | 3300025981 | Ga0207640_11644916 | Ga0207640_116449161 | 170 |
| 202 | 3300025986 | Ga0207658_10004751 | Ga0207658_100047519 | 170 |
| 203 | 3300026023 | Ga0207677_10017062 | Ga0207677_100170629 | 170 |
| 204 | 3300026035 | Ga0207703_10001524 | Ga0207703_1000152417 | 170 |
| 205 | 3300026035 | Ga0207703_10019203 | Ga0207703_1001920310 | 170 |
| 206 | 3300026035 | Ga0207703_10024678 | Ga0207703_100246785 | 170 |
| 207 | 3300026067 | Ga0207678_10005556 | Ga0207678_100055569 | 170 |
| 208 | 3300026078 | Ga0207702_10043700 | Ga0207702_100437005 | 170 |
| 209 | 3300026088 | Ga0207641_10002325 | Ga0207641_1000232518 | 170 |
| 210 | 3300026088 | Ga0207641_10010988 | Ga0207641_100109885 | 170 |
| 211 | 3300026089 | Ga0207648_10052141 | Ga0207648_100521413 | 170 |
| 212 | 3300026095 | Ga0207676_10141379 | Ga0207676_101413792 | 170 |
| 213 | 3300026118 | Ga0207675_100447158 | Ga0207675_1004471582 | 170 |
| 214 | 3300026121 | Ga0207683_10002499 | Ga0207683_1000249913 | 170 |
| 215 | 3300026142 | Ga0207698_10869311 | Ga0207698_108693112 | 170 |
| 216 | 3300028379 | Ga0268266_10000943 | Ga0268266_1000094317 | 170 |
| 217 | 3300028379 | Ga0268266_10010307 | Ga0268266_100103076 | 170 |
| 218 | 3300028379 | Ga0268266_10018044 | Ga0268266_100180449 | 170 |
| 219 | 3300028379 | Ga0268266_11518098 | Ga0268266_115180981 | 170 |
| 220 | 3300028380 | Ga0268265_10131702 | Ga0268265_101317022 | 170 |
| 221 | 3300028381 | Ga0268264_10000102 | Ga0268264_1000010218 | 170 |
| 222 | 3300028381 | Ga0268264_10011424 | Ga0268264_100114246 | 170 |
| 223 | 3300028381 | Ga0268264_10013393 | Ga0268264_1001339310 | 170 |
| 224 | 3300028794 | Ga0307515_10194780 | Ga0307515_101947802 | 170 |
| 225 | 3300028800 | Ga0265338_10005919 | Ga0265338_1000591913 | 170 |
| 226 | 3300028800 | Ga0265338_10049050 | Ga0265338_100490502 | 170 |
| 227 | 3300031507 | Ga0307509_10186885 | Ga0307509_101868854 | 170 |
| 228 | 3300032002 | Ga0307416_100101875 | Ga0307416_1001018753 | 170 |
| 229 | 3300033180 | Ga0307510_10000006 | Ga0307510_10000006349 | 170 |
| 230 | 3300033180 | Ga0307510_10029950 | Ga0307510_1002995010 | 170 |
| 231 | 3300035083 | Ga0373926_0022611 | Ga0373926_0022611_525_1058 | 170 |
| 232 | 3300035111 | Ga0373923_0030963 | Ga0373923_0030963_1304_1834 | 170 |
| 233 | 3300035171 | Ga0373946_0049639 | Ga0373946_0049639_126_656 | 170 |
| 234 | 3300035172 | Ga0373955_0018691 | Ga0373955_0018691_1796_2326 | 170 |
| 235 | 3300035692 | Ga0373935_0124420 | Ga0373935_0124420_218_748 | 170 |
| 236 | 3300035692 | Ga0373935_0382277 | Ga0373935_0382277_266_796 | 170 |
| 237 | 3300035695 | Ga0373927_0009161 | Ga0373927_0009161_1978_2508 | 170 |
| 238 | 3300036401 | Ga0373937_0086972 | Ga0373937_0086972_1459_1989 | 170 |
| 239 | 3300037068 | Ga0373925_0026649 | Ga0373925_0026649_1633_2163 | 170 |
| 240 | 3300037068 | Ga0373925_0714458 | Ga0373925_0714458_173_703 | 170 |
| 241 | 3300037418 | Ga0395900_0328446 | Ga0395900_0328446_198_728 | 170 |
| 242 | 3300037466 | Ga0395898_0014841 | Ga0395898_0014841_3660_4190 | 170 |
| 243 | 3300037466 | Ga0395898_0266406 | Ga0395898_0266406_75_605 | 170 |
| 244 | 3300037466 | Ga0395898_0740577 | Ga0395898_0740577_14_544 | 170 |
| 245 | 3300037853 | Ga0436364_1319238 | Ga0436364_1319238_958_1488 | 170 |
| 246 | 3300038443 | Ga0395901_0563062 | Ga0395901_0563062_214_744 | 170 |
| 247 | 3300039437 | Ga0436365_0032067 | Ga0436365_0032067_1035_1565 | 170 |
| 248 | 3300039437 | Ga0436365_0123496 | Ga0436365_0123496_1672_2202 | 170 |
| 249 | 3300039438 | Ga0436360_0007268 | Ga0436360_0007268_236_766 | 170 |
| 250 | 3300039438 | Ga0436360_0226775 | Ga0436360_0226775_437_967 | 170 |
| 251 | 3300039438 | Ga0436360_0858685 | Ga0436360_0858685_360_890 | 170 |
| 252 | 3300039447 | Ga0436361_0201021 | Ga0436361_0201021_129_659 | 170 |
| 253 | 3300039447 | Ga0436361_0725603 | Ga0436361_0725603_36_566 | 170 |
| 254 | 3300039450 | Ga0436363_0251444 | Ga0436363_0251444_209_739 | 170 |
| 255 | 3300039450 | Ga0436363_0498253 | Ga0436363_0498253_5539_6069 | 170 |
| 256 | 3300039450 | Ga0436363_0854207 | Ga0436363_0854207_1990_2520 | 170 |
| 257 | 3300039450 | Ga0436363_1530821 | Ga0436363_1530821_1719_2249 | 170 |
| 258 | 3300039453 | Ga0436362_0485101 | Ga0436362_0485101_567_1097 | 170 |
| 259 | 3300039453 | Ga0436362_0693496 | Ga0436362_0693496_1652_2182 | 170 |
| 260 | 3300039453 | Ga0436362_0892755 | Ga0436362_0892755_257_787 | 170 |
| 261 | 3300041486 | Ga0451807_0310094 | Ga0451807_0310094_488_1018 | 170 |
| 262 | 3300044684 | Ga0466966_0002570 | Ga0466966_0002570_8498_9028 | 170 |
| 263 | 3300044706 | Ga0466964_0000625 | Ga0466964_0000625_5384_5914 | 170 |
| 264 | 3300044719 | Ga0466971_0001102 | Ga0466971_0001102_6594_7124 | 170 |
| 265 | 3300044735 | Ga0466968_0018375 | Ga0466968_0018375_841_1371 | 170 |
| 266 | 3300044765 | Ga0466970_0013525 | Ga0466970_0013525_2946_3476 | 170 |
| 267 | 3300044842 | Ga0466957_0529047 | Ga0466957_0529047_189_719 | 170 |
| 268 | 3300045049 | Ga0466959_0103445 | Ga0466959_0103445_1404_1934 | 170 |
| 269 | 3300045049 | Ga0466959_0473198 | Ga0466959_0473198_161_691 | 170 |
| 270 | 3300046458 | Ga0495591_012181 | Ga0495591_012181_2113_2643 | 170 |
| 271 | 3300046472 | Ga0495580_0110709 | Ga0495580_0110709_796_1326 | 170 |
| 272 | 3300046472 | Ga0495580_0256741 | Ga0495580_0256741_404_934 | 170 |
| 273 | 3300046472 | Ga0495580_0262299 | Ga0495580_0262299_271_801 | 170 |
| 274 | 3300046473 | Ga0495582_0021138 | Ga0495582_0021138_298_828 | 170 |
| 275 | 3300046475 | Ga0495639_0038324 | Ga0495639_0038324_657_1187 | 170 |
| 276 | 3300046507 | Ga0495606_0121762 | Ga0495606_0121762_18_548 | 170 |
| 277 | 3300046507 | Ga0495606_0178577 | Ga0495606_0178577_444_974 | 170 |
| 278 | 3300046507 | Ga0495606_0302734 | Ga0495606_0302734_79_609 | 170 |
| 279 | 3300046514 | Ga0495618_0218792 | Ga0495618_0218792_226_756 | 170 |
| 280 | 3300046517 | Ga0495630_0140489 | Ga0495630_0140489_130_660 | 170 |
| 281 | 3300046517 | Ga0495630_0553636 | Ga0495630_0553636_211_741 | 170 |
| 282 | 3300046522 | Ga0495643_0036660 | Ga0495643_0036660_387_917 | 170 |
| 283 | 3300046523 | Ga0495644_0042747 | Ga0495644_0042747_1123_1653 | 170 |
| 284 | 3300046525 | Ga0495663_0172354 | Ga0495663_0172354_18_548 | 170 |
| 285 | 3300046526 | Ga0495666_0151868 | Ga0495666_0151868_152_682 | 170 |
| 286 | 3300046528 | Ga0495642_0041099 | Ga0495642_0041099_547_1077 | 170 |
| 287 | 3300046533 | Ga0495640_0102492 | Ga0495640_0102492_222_752 | 170 |
| 288 | 3300046537 | Ga0495598_0000303 | Ga0495598_0000303_2194_2724 | 170 |
| 289 | 3300046538 | Ga0495609_0106656 | Ga0495609_0106656_118_648 | 170 |
| 290 | 3300046543 | Ga0495645_0126845 | Ga0495645_0126845_76_606 | 170 |
| 291 | 3300046543 | Ga0495645_0396572 | Ga0495645_0396572_118_648 | 170 |
| 292 | 3300046558 | Ga0495633_0031438 | Ga0495633_0031438_1419_1949 | 170 |
| 293 | 3300046615 | Ga0495656_0017671 | Ga0495656_0017671_751_1281 | 170 |
| 294 | 3300046648 | Ga0495611_0045842 | Ga0495611_0045842_761_1291 | 170 |
| 295 | 3300046660 | Ga0495625_0070385 | Ga0495625_0070385_308_838 | 170 |
| 296 | 3300046681 | Ga0495647_0006386 | Ga0495647_0006386_49_579 | 170 |
| 297 | 3300046683 | Ga0495658_0027808 | Ga0495658_0027808_1287_1817 | 170 |
| 298 | 3300046683 | Ga0495658_0027894 | Ga0495658_0027894_1196_1726 | 170 |
| 299 | 3300046692 | Ga0495671_0133944 | Ga0495671_0133944_375_905 | 170 |
| 300 | 3300046694 | Ga0495649_0078294 | Ga0495649_0078294_1075_1605 | 170 |
| 301 | 3300046810 | Ga0495660_0135192 | Ga0495660_0135192_132_662 | 170 |
| 302 | 3300047317 | Ga0495604_0208301 | Ga0495604_0208301_62_592 | 170 |
| 303 | 3300047322 | Ga0495680_0151453 | Ga0495680_0151453_463_993 | 170 |
| 304 | 3300047323 | Ga0495683_0162856 | Ga0495683_0162856_413_943 | 170 |
| 305 | 3300047470 | Ga0495681_0005696 | Ga0495681_0005696_4235_4765 | 170 |
| 306 | 3300047472 | Ga0495686_0195418 | Ga0495686_0195418_590_1120 | 170 |
| 307 | 3300048903 | Ga0496100_0003550 | Ga0496100_0003550_4699_5229 | 170 |
| 308 | 3300048903 | Ga0496100_0271449 | Ga0496100_0271449_245_775 | 170 |
| 309 | 3300048904 | Ga0496101_0018936 | Ga0496101_0018936_1343_1873 | 170 |
| 310 | 3300048904 | Ga0496101_0048517 | Ga0496101_0048517_753_1283 | 170 |
| 311 | 3300048904 | Ga0496101_0088368 | Ga0496101_0088368_677_1207 | 170 |
| 312 | 3300048905 | Ga0496102_0003295 | Ga0496102_0003295_11335_11865 | 170 |
| 313 | 3300048905 | Ga0496102_0006276 | Ga0496102_0006276_8167_8697 | 170 |
| 314 | 3300048905 | Ga0496102_0091759 | Ga0496102_0091759_467_997 | 170 |
| 315 | 3300048905 | Ga0496102_0120316 | Ga0496102_0120316_164_694 | 170 |
| 316 | 3300048905 | Ga0496102_0162163 | Ga0496102_0162163_1276_1806 | 170 |
| 317 | 3300048906 | Ga0496103_0004906 | Ga0496103_0004906_2841_3371 | 170 |
| 318 | 3300048907 | Ga0496104_0043605 | Ga0496104_0043605_1007_1537 | 170 |
| 319 | 3300048908 | Ga0496105_0003469 | Ga0496105_0003469_3493_4023 | 170 |
| 320 | 3300048908 | Ga0496105_0078997 | Ga0496105_0078997_568_1098 | 170 |
| 321 | 3300048909 | Ga0496106_0004678 | Ga0496106_0004678_2948_3478 | 170 |
| 322 | 3300048909 | Ga0496106_0066543 | Ga0496106_0066543_740_1270 | 170 |
| 323 | 3300048910 | Ga0496107_0001576 | Ga0496107_0001576_11495_12025 | 170 |
| 324 | 3300048910 | Ga0496107_0095607 | Ga0496107_0095607_1582_2112 | 170 |
| 325 | 3300048910 | Ga0496107_0179047 | Ga0496107_0179047_684_1214 | 170 |
| 326 | 3300048911 | Ga0496108_0002086 | Ga0496108_0002086_2356_2886 | 170 |
| 327 | 3300048912 | Ga0496109_0006030 | Ga0496109_0006030_6496_7026 | 170 |
| 328 | 3300048913 | Ga0496110_0005639 | Ga0496110_0005639_2828_3358 | 170 |
| 329 | 3300048914 | Ga0496111_0003878 | Ga0496111_0003878_5581_6111 | 170 |
| 330 | 3300048915 | Ga0496112_0009054 | Ga0496112_0009054_2134_2664 | 170 |
| 331 | 3300048916 | Ga0496113_0106557 | Ga0496113_0106557_31_561 | 170 |
| 332 | 3300048917 | Ga0496114_0017246 | Ga0496114_0017246_3719_4249 | 170 |
| 333 | 3300048918 | Ga0496115_0126283 | Ga0496115_0126283_1406_1936 | 170 |
| 334 | 3300048918 | Ga0496115_0137279 | Ga0496115_0137279_310_840 | 170 |
| 335 | 3300048919 | Ga0496116_0024881 | Ga0496116_0024881_1270_1800 | 170 |
| 336 | 3300048920 | Ga0496117_0000787 | Ga0496117_0000787_18468_18998 | 170 |
| 337 | 3300048920 | Ga0496117_0073497 | Ga0496117_0073497_258_788 | 170 |
| 338 | 3300048921 | Ga0496118_0000032 | Ga0496118_0000032_240556_241086 | 170 |
| 339 | 3300048921 | Ga0496118_0013267 | Ga0496118_0013267_1676_2206 | 170 |
| 340 | 3300048922 | Ga0496119_0052426 | Ga0496119_0052426_1909_2439 | 170 |
| 341 | 3300048923 | Ga0496120_0020312 | Ga0496120_0020312_2920_3450 | 170 |
| 342 | 3300048923 | Ga0496120_0175802 | Ga0496120_0175802_47_577 | 170 |
| 343 | 3300048924 | Ga0496121_0000704 | Ga0496121_0000704_59204_59734 | 170 |
| 344 | 3300048924 | Ga0496121_0192815 | Ga0496121_0192815_404_934 | 170 |
| 345 | 3300048927 | Ga0496124_0006228 | Ga0496124_0006228_4597_5127 | 170 |
| 346 | 3300048928 | Ga0496125_0001378 | Ga0496125_0001378_7830_8360 | 170 |
| 347 | 3300048928 | Ga0496125_0005100 | Ga0496125_0005100_13096_13626 | 170 |
| 348 | 3300048928 | Ga0496125_0081233 | Ga0496125_0081233_1127_1657 | 170 |
| 349 | 3300048928 | Ga0496125_0279403 | Ga0496125_0279403_335_865 | 170 |
| 350 | 3300048929 | Ga0496126_0011396 | Ga0496126_0011396_7741_8271 | 170 |
| 351 | 3300048929 | Ga0496126_0404154 | Ga0496126_0404154_397_927 | 170 |
| 352 | 3300048929 | Ga0496126_0999333 | Ga0496126_0999333_83_613 | 170 |
| 353 | 3300050514 | nmdc:mga08x19_29504_c1 | nmdc:mga08x19_29504_c1_454_984 | 170 |
| 354 | 3300053078 | Ga0495612_0109745 | Ga0495612_0109745_173_703 | 170 |
| 355 | 3300053078 | Ga0495612_0302336 | Ga0495612_0302336_158_688 | 170 |
| 356 | 3300053092 | Ga0500583_0052059 | Ga0500583_0052059_864_1394 | 170 |
| 357 | 3300053106 | Ga0500558_173529 | Ga0500558_173529_36_566 | 170 |
| 358 | 3300053115 | Ga0500591_078333 | Ga0500591_078333_525_1055 | 170 |
| 359 | 3300059504 | Ga0587082_085789 | Ga0587082_085789_40_552 | 170 |
| 360 | 3300059640 | Ga0587067_027451 | Ga0587067_027451_190_720 | 170 |
| 361 | 3300059645 | Ga0587076_086292 | Ga0587076_086292_11_541 | 170 |
| 362 | 3300061719 | Ga0466962_0001207 | Ga0466962_0001207_2874_3404 | 170 |
| 363 | iso_pu_bacteria | 2600255067 | 2600813797 | 170 |
| 364 | 3300000546 | LJNas_1003798 | LJNas_10037984 | 171 |
| 365 | 3300000546 | LJNas_1018000 | LJNas_10180001 | 171 |
| 366 | 3300005295 | Ga0065707_10173760 | Ga0065707_101737602 | 171 |
| 367 | 3300005354 | Ga0070675_100227307 | Ga0070675_1002273073 | 171 |
| 368 | 3300005439 | Ga0070711_100025752 | Ga0070711_1000257523 | 171 |
| 369 | 3300005546 | Ga0070696_100001443 | Ga0070696_10000144318 | 171 |
| 370 | 3300005937 | Ga0081455_10423156 | Ga0081455_104231562 | 171 |
| 371 | 3300006844 | Ga0075428_100792515 | Ga0075428_1007925152 | 171 |
| 372 | 3300006844 | Ga0075428_101643673 | Ga0075428_1016436731 | 171 |
| 373 | 3300006846 | Ga0075430_100302524 | Ga0075430_1003025242 | 171 |
| 374 | 3300006880 | Ga0075429_100025759 | Ga0075429_10002575911 | 171 |
| 375 | 3300007265 | Ga0099794_10137971 | Ga0099794_101379713 | 171 |
| 376 | 3300007788 | Ga0099795_10000254 | Ga0099795_1000025414 | 171 |
| 377 | 3300007788 | Ga0099795_10046176 | Ga0099795_100461764 | 171 |
| 378 | 3300009094 | Ga0111539_10575152 | Ga0111539_105751522 | 171 |
| 379 | 3300010159 | Ga0099796_10005277 | Ga0099796_100052777 | 171 |
| 380 | 3300010159 | Ga0099796_10161632 | Ga0099796_101616321 | 171 |
| 381 | 3300025916 | Ga0207663_10369561 | Ga0207663_103695612 | 171 |
| 382 | 3300025928 | Ga0207700_10098071 | Ga0207700_100980716 | 171 |
| 383 | 3300025949 | Ga0207667_11412403 | Ga0207667_114124032 | 171 |
| 384 | 3300026118 | Ga0207675_101157852 | Ga0207675_1011578521 | 171 |
| 385 | 3300027462 | Ga0210000_1009803 | Ga0210000_10098032 | 171 |
| 386 | 3300027907 | Ga0207428_10117654 | Ga0207428_101176543 | 171 |
| 387 | 3300028016 | Ga0265354_1003002 | Ga0265354_10030022 | 171 |
| 388 | 3300028017 | Ga0265356_1000652 | Ga0265356_100065214 | 171 |
| 389 | 3300028036 | Ga0265355_1001301 | Ga0265355_10013013 | 171 |
| 390 | 3300028800 | Ga0265338_10095180 | Ga0265338_100951806 | 171 |
| 391 | 3300028800 | Ga0265338_10200568 | Ga0265338_102005682 | 171 |
| 392 | 3300030763 | Ga0265763_1001367 | Ga0265763_10013672 | 171 |
| 393 | 3300030878 | Ga0265770_1000452 | Ga0265770_10004525 | 171 |
| 394 | 3300030963 | Ga0265768_101041 | Ga0265768_1010412 | 171 |
| 395 | 3300031090 | Ga0265760_10001436 | Ga0265760_100014368 | 171 |
| 396 | 3300031090 | Ga0265760_10016486 | Ga0265760_100164865 | 171 |
| 397 | 3300031240 | Ga0265320_10230536 | Ga0265320_102305362 | 171 |
| 398 | 3300031247 | Ga0265340_10140260 | Ga0265340_101402602 | 171 |
| 399 | 3300031344 | Ga0265316_10470706 | Ga0265316_104707062 | 171 |
| 400 | 3300031665 | Ga0316575_10009147 | Ga0316575_100091473 | 171 |
| 401 | 3300031665 | Ga0316575_10016662 | Ga0316575_100166626 | 171 |
| 402 | 3300031691 | Ga0316579_10031893 | Ga0316579_100318935 | 171 |
| 403 | 3300031712 | Ga0265342_10501765 | Ga0265342_105017652 | 171 |
| 404 | 3300031727 | Ga0316576_10011141 | Ga0316576_100111415 | 171 |
| 405 | 3300031727 | Ga0316576_10118356 | Ga0316576_101183565 | 171 |
| 406 | 3300031728 | Ga0316578_10026381 | Ga0316578_100263816 | 171 |
| 407 | 3300031728 | Ga0316578_10078056 | Ga0316578_100780561 | 171 |
| 408 | 3300031730 | Ga0307516_10001316 | Ga0307516_1000131629 | 171 |
| 409 | 3300032002 | Ga0307416_100612891 | Ga0307416_1006128912 | 171 |
| 410 | 3300032168 | Ga0316593_10005115 | Ga0316593_100051154 | 171 |
| 411 | 3300032168 | Ga0316593_10115806 | Ga0316593_101158062 | 171 |
| 412 | 3300033180 | Ga0307510_10083840 | Ga0307510_100838405 | 171 |
| 413 | 3300033541 | Ga0316596_1004126 | Ga0316596_10041266 | 171 |
| 414 | 3300033541 | Ga0316596_1023684 | Ga0316596_10236842 | 171 |
| 415 | 3300035111 | Ga0373923_0108715 | Ga0373923_0108715_641_1156 | 171 |
| 416 | 3300035118 | Ga0373954_0076921 | Ga0373954_0076921_760_1275 | 171 |
| 417 | 3300035119 | Ga0373956_0089228 | Ga0373956_0089228_607_1122 | 171 |
| 418 | 3300035120 | Ga0373957_0089402 | Ga0373957_0089402_49_564 | 171 |
| 419 | 3300035172 | Ga0373955_0046500 | Ga0373955_0046500_376_891 | 171 |
| 420 | 3300035398 | Ga0316574_0024069 | Ga0316574_0024069_1116_1649 | 171 |
| 421 | 3300035398 | Ga0316574_0037387 | Ga0316574_0037387_2387_2926 | 171 |
| 422 | 3300035398 | Ga0316574_0038892 | Ga0316574_0038892_306_839 | 171 |
| 423 | 3300035398 | Ga0316574_0260206 | Ga0316574_0260206_130_672 | 171 |
| 424 | 3300035410 | Ga0373924_0068613 | Ga0373924_0068613_216_731 | 171 |
| 425 | 3300035724 | Ga0373933_0019812 | Ga0373933_0019812_1577_2110 | 171 |
| 426 | 3300035724 | Ga0373933_0121455 | Ga0373933_0121455_512_1027 | 171 |
| 427 | 3300036401 | Ga0373937_0069392 | Ga0373937_0069392_1983_2516 | 171 |
| 428 | 3300036401 | Ga0373937_0114140 | Ga0373937_0114140_254_769 | 171 |
| 429 | 3300036712 | Ga0316584_0248223 | Ga0316584_0248223_97_630 | 171 |
| 430 | 3300036712 | Ga0316584_0293643 | Ga0316584_0293643_400_942 | 171 |
| 431 | 3300037068 | Ga0373925_0492416 | Ga0373925_0492416_87_602 | 171 |
| 432 | 3300037853 | Ga0436364_1434626 | Ga0436364_1434626_235_768 | 171 |
| 433 | 3300045051 | Ga0451576_0079035 | Ga0451576_0079035_1696_2232 | 171 |
| 434 | 3300045051 | Ga0451576_1572370 | Ga0451576_1572370_91_624 | 171 |
| 435 | 3300046516 | Ga0495628_0371882 | Ga0495628_0371882_62_577 | 171 |
| 436 | 3300046681 | Ga0495647_0032589 | Ga0495647_0032589_1066_1581 | 171 |
| 437 | 3300046683 | Ga0495658_0184027 | Ga0495658_0184027_37_552 | 171 |
| 438 | 3300048903 | Ga0496100_0035274 | Ga0496100_0035274_2387_2902 | 171 |
| 439 | 3300048904 | Ga0496101_0329075 | Ga0496101_0329075_183_698 | 171 |
| 440 | 3300048907 | Ga0496104_0016622 | Ga0496104_0016622_125_640 | 171 |
| 441 | 3300048908 | Ga0496105_0010900 | Ga0496105_0010900_1850_2365 | 171 |
| 442 | 3300048910 | Ga0496107_0039998 | Ga0496107_0039998_1462_1977 | 171 |
| 443 | 3300048917 | Ga0496114_0002220 | Ga0496114_0002220_7731_8246 | 171 |
| 444 | 3300048918 | Ga0496115_0005471 | Ga0496115_0005471_2210_2725 | 171 |
| 445 | 3300048918 | Ga0496115_0885551 | Ga0496115_0885551_118_633 | 171 |
| 446 | 3300049460 | Ga0495682_0111199 | Ga0495682_0111199_84_620 | 171 |
| 447 | 3300049568 | Ga0501031_0121777 | Ga0501031_0121777_880_1413 | 171 |
| 448 | 3300049569 | Ga0501032_0186579 | Ga0501032_0186579_654_1187 | 171 |
| 449 | 3300049570 | Ga0501033_0106171 | Ga0501033_0106171_1047_1580 | 171 |
| 450 | 3300049572 | Ga0501036_0048255 | Ga0501036_0048255_1903_2436 | 171 |
| 451 | 3300049573 | Ga0501037_0024581 | Ga0501037_0024581_2742_3275 | 171 |
| 452 | 3300049574 | Ga0501038_0090870 | Ga0501038_0090870_1082_1615 | 171 |
| 453 | 3300049576 | Ga0501040_0008066 | Ga0501040_0008066_4631_5164 | 171 |
| 454 | 3300049578 | Ga0501042_0158721 | Ga0501042_0158721_887_1420 | 171 |
| 455 | 3300049579 | Ga0501043_0255676 | Ga0501043_0255676_243_776 | 171 |
| 456 | 3300049580 | Ga0501046_0105554 | Ga0501046_0105554_1544_2077 | 171 |
| 457 | 3300049582 | Ga0501048_0067468 | Ga0501048_0067468_1512_2045 | 171 |
| 458 | 3300049584 | Ga0501068_0026867 | Ga0501068_0026867_2432_2965 | 171 |
| 459 | 3300049586 | Ga0501070_0044235 | Ga0501070_0044235_2424_2957 | 171 |
| 460 | 3300049587 | Ga0501071_0003527 | Ga0501071_0003527_7876_8409 | 171 |
| 461 | 3300049588 | Ga0501072_0025385 | Ga0501072_0025385_3064_3597 | 171 |
| 462 | 3300049588 | Ga0501072_0284010 | Ga0501072_0284010_519_1052 | 171 |
| 463 | 3300049589 | Ga0501073_0089829 | Ga0501073_0089829_11_544 | 171 |
| 464 | 3300049591 | Ga0501075_0055471 | Ga0501075_0055471_559_1092 | 171 |
| 465 | 3300049591 | Ga0501075_0277299 | Ga0501075_0277299_583_1125 | 171 |
| 466 | 3300049592 | Ga0501076_0022764 | Ga0501076_0022764_1159_1692 | 171 |
| 467 | 3300049593 | Ga0501077_0029086 | Ga0501077_0029086_1109_1642 | 171 |
| 468 | 3300049593 | Ga0501077_0121296 | Ga0501077_0121296_520_1062 | 171 |
| 469 | 3300049742 | Ga0501080_0037660 | Ga0501080_0037660_2830_3363 | 171 |
| 470 | 3300049743 | Ga0501081_0018126 | Ga0501081_0018126_1109_1642 | 171 |
| 471 | 3300049744 | Ga0501083_0079781 | Ga0501083_0079781_859_1392 | 171 |
| 472 | 3300049822 | Ga0501035_0180906 | Ga0501035_0180906_642_1175 | 171 |
| 473 | 3300049823 | Ga0501044_0260398 | Ga0501044_0260398_1068_1601 | 171 |
| 474 | 3300049824 | Ga0501045_0084307 | Ga0501045_0084307_1295_1828 | 171 |
| 475 | 3300050508 | nmdc:mga09592_8260_c1 | nmdc:mga09592_8260_c1_7475_8008 | 171 |
| 476 | 3300050511 | nmdc:mga08y16_15367_c1 | nmdc:mga08y16_15367_c1_6804_7337 | 171 |
| 477 | 3300053077 | Ga0495601_0083233 | Ga0495601_0083233_71_586 | 171 |
| 478 | 3300053078 | Ga0495612_0085153 | Ga0495612_0085153_692_1207 | 171 |
| 479 | 3300053085 | Ga0495619_0091313 | Ga0495619_0091313_1420_1935 | 171 |
| 480 | 3300054114 | Ga0501084_0144399 | Ga0501084_0144399_1182_1715 | 171 |
| 481 | 3300054114 | Ga0501084_0997132 | Ga0501084_0997132_80_622 | 171 |
| 482 | 3300060353 | Ga0501082_0087089 | Ga0501082_0087089_1520_2053 | 171 |
| 483 | 3300061734 | Ga0530510_0078825 | Ga0530510_0078825_1006_1548 | 171 |
| 484 | 3300061734 | Ga0530510_0119058 | Ga0530510_0119058_837_1370 | 171 |
| 485 | 3300061734 | Ga0530510_0170978 | Ga0530510_0170978_1038_1571 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fn2-assembly1.cif.gz_H | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9604 | 1 | 169 |
| 8cgk-assembly1.cif.gz_g | lincomycin and avilamycin bound to the 50s subunit | 0.9603 | 1 | 168 |
| 8cgv-assembly1.cif.gz_g | tiamulin bound to the 50s subunit | 0.9587 | 1 | 171 |
| 6v3b-assembly1.cif.gz_G | cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state | 0.9551 | 1 | 169 |
| 8ceu-assembly1.cif.gz_g | retapamulin and capreomycin bound to the 50s subunit | 0.9548 | 1 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q09865_118_210_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9435 | 77 | 168 | 3.90.930.12 |
| af_O21037_77_170_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9395 | 77 | 169 | 3.90.930.12 |
| 5x8tG01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9386 | 1 | 76 | 3.90.930.12 |
| af_Q6AU10_7_103_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9322 | 79 | 171 | 3.90.930.12 |
| 2awbG02 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9322 | 77 | 171 | 3.90.930.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T4CLW1-F1-model_v4 | 50S ribosomal protein L6 | 0.9815 | 1 | 150 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A2J1D431-F1-model_v4 | deleted | 0.9767 | 67 | 162 |
|
| AF-A0A6A5L2Q1-F1-model_v4 | deleted | 0.9733 | 1 | 166 |
|
| AF-A0A352Q4J4-F1-model_v4 | 50S ribosomal protein L6 | 0.9731 | 1 | 143 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A6A5LCT1-F1-model_v4 | deleted | 0.972 | 2 | 163 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar