F453137

General Info

Members Datasets Scaffolds Average Seq Length
485 291 481 69

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_1098360|Ga0451807_1098360_309_557
Length 82
Sequence VTVPPKKAFALRLDPALYAAIERAAATDLRSVNAQVECLLREALNRRGVKLAAPVRAKRGRPPKPRPGAEDEIDPFNEEETQ

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
4 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
165 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
174 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
175 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
176 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
179 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
180 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
185 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
274 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
277 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
278 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
279 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
280 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
281 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
284 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
285 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
288 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
289 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
290 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
291 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0.41
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.14
Nodule 0.62
Rhizoplane 4.74
Rhizosphere 70.1
Stem 0
Stem Tuber 0
Unclassified 6.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000396 3300001990 Bacteria 14833
2 JGI24737J22298_10000868 3300001990 Bacteria 10796
3 JGI25165J46597_1000065 3300003214 Bacteria 199761
4 JGI25153J46596_10000027 3300003215 Bacteria 210760
5 Ga0055525_1000099 3300003759 Bacteria 136491
6 Ga0055542_1000177 3300003762 Bacteria 78838
7 Ga0055529_1000350 3300003763 Bacteria 51011
8 Ga0055526_1020480 3300003771 Bacteria 2351
9 Ga0055537_1044819 3300003773 Bacteria 520
10 Ga0055536_1027127 3300003781 Bacteria 1591
11 Ga0055530_10000845 3300003791 Bacteria 25265
12 Ga0055530_10026176 3300003791 Bacteria 1616
13 Ga0055530_10030069 3300003791 Bacteria 1444
14 Ga0055531_10000073 3300003794 Bacteria 109510
15 Ga0055531_10039340 3300003794 Bacteria 1405
16 Ga0055531_10039353 3300003794 Bacteria 1405
17 Ga0065165_1004703 3300005262 Bacteria 8207
18 Ga0065165_1023697 3300005262 Bacteria 2076
19 Ga0065165_1030847 3300005262 Bacteria 1702
20 Ga0065715_10707290 3300005293 Bacteria 650
21 Ga0070658_10096143 3300005327 Bacteria 2445
22 Ga0070676_10090064 3300005328 Bacteria 1878
23 Ga0070676_10691903 3300005328 Bacteria 744
24 Ga0070677_10185060 3300005333 Bacteria 995
25 Ga0068869_100016231 3300005334 Bacteria 5015
26 Ga0068868_100000281 3300005338 Bacteria 34228
27 Ga0068868_100067006 3300005338 Bacteria 2856
28 Ga0070660_100002551 3300005339 Bacteria 12486
29 Ga0070660_100918035 3300005339 Bacteria 738
30 Ga0070661_100000113 3300005344 Bacteria 67566
31 Ga0070661_100072628 3300005344 Bacteria 2532
32 Ga0070668_101016400 3300005347 Bacteria 746
33 Ga0070669_100221189 3300005353 Bacteria 1497
34 Ga0070669_100311968 3300005353 Bacteria 1268
35 Ga0070669_101135261 3300005353 Bacteria 674
36 Ga0070675_100200493 3300005354 Bacteria 1732
37 Ga0070671_100024718 3300005355 Bacteria 4920
38 Ga0070674_100007065 3300005356 Bacteria 6600
39 Ga0070674_100044924 3300005356 Bacteria 3016
40 Ga0070673_100000005 3300005364 Bacteria 193513
41 Ga0070673_100568270 3300005364 Bacteria 1032
42 Ga0070678_100000062 3300005456 Bacteria 39682
43 Ga0070662_100543813 3300005457 Bacteria 973
44 Ga0068867_100000060 3300005459 Bacteria 67750
45 Ga0068867_100065727 3300005459 Bacteria 2700
46 Ga0070679_100058584 3300005530 Bacteria 3838
47 Ga0070684_100287844 3300005535 Bacteria 1506
48 Ga0070684_100994973 3300005535 Bacteria 787
49 Ga0070672_100171040 3300005543 Bacteria 1807
50 Ga0070665_100000257 3300005548 Bacteria 87607
51 Ga0068855_100258712 3300005563 Bacteria 1940
52 Ga0068855_100890771 3300005563 Bacteria 941
53 Ga0070664_100023385 3300005564 Bacteria 5103
54 Ga0068854_101846679 3300005578 Bacteria 555
55 Ga0068856_100137196 3300005614 Bacteria 2452
56 Ga0068856_100364594 3300005614 Bacteria 1463
57 Ga0068852_100658921 3300005616 Bacteria 1055
58 Ga0068859_101903470 3300005617 Bacteria 657
59 Ga0068859_102068246 3300005617 Bacteria 629
60 Ga0068864_100000352 3300005618 Bacteria 40434
61 Ga0068864_100460776 3300005618 Bacteria 1217
62 Ga0068866_10591781 3300005718 Bacteria 748
63 Ga0068866_10806498 3300005718 Bacteria 653
64 Ga0068861_100064577 3300005719 Bacteria 2817
65 Ga0068861_100629007 3300005719 Bacteria 989
66 Ga0068861_100946156 3300005719 Bacteria 819
67 Ga0068851_10063301 3300005834 Bacteria 1899
68 Ga0068858_100000132 3300005842 Bacteria 77767
69 Ga0068858_100000444 3300005842 Bacteria 43311
70 Ga0068860_100000609 3300005843 Bacteria 42459
71 Ga0068862_100000099 3300005844 Bacteria 103870
72 Ga0068862_100072957 3300005844 Bacteria 2966
73 Ga0081539_10013701 3300005985 Bacteria 6089
74 Ga0075369_10072999 3300006186 Bacteria 1512
75 Ga0075366_10176640 3300006195 Bacteria 1297
76 Ga0075366_10894901 3300006195 Bacteria 553
77 Ga0097621_100006422 3300006237 Bacteria 8343
78 Ga0097621_100490206 3300006237 Bacteria 1112
79 Ga0075370_10476015 3300006353 Bacteria 752
80 Ga0075431_100010549 3300006847 Bacteria 9288
81 Ga0068865_100000027 3300006881 Bacteria 92272
82 Ga0068865_100249923 3300006881 Bacteria 1399
83 Ga0068865_101254145 3300006881 Bacteria 658
84 Ga0097620_101903712 3300006931 Bacteria 657
85 Ga0097620_102067556 3300006931 Bacteria 629
86 Ga0079104_1030151 3300006946 Bacteria 1358
87 Ga0099826_10228384 3300006948 Bacteria 996
88 Ga0105240_11197338 3300009093 Bacteria 804
89 Ga0105245_10001310 3300009098 Bacteria 22494
90 Ga0105245_10056870 3300009098 Bacteria 3517
91 Ga0105243_10000180 3300009148 Bacteria 73474
92 Ga0105243_10005280 3300009148 Bacteria 10102
93 Ga0105243_10539296 3300009148 Bacteria 1113
94 Ga0105241_10000907 3300009174 Bacteria 22391
95 Ga0105242_10000077 3300009176 Bacteria 67726
96 Ga0105242_10425974 3300009176 Bacteria 1245
97 Ga0105242_10752239 3300009176 Bacteria 959
98 Ga0105248_10025301 3300009177 Bacteria 6599
99 Ga0105237_10534776 3300009545 Bacteria 1179
100 Ga0105237_11852732 3300009545 Bacteria 611
101 Ga0105238_10004794 3300009551 Bacteria 13382
102 Ga0105238_11558392 3300009551 Bacteria 690
103 Ga0105238_12411713 3300009551 Bacteria 562
104 Ga0105249_10000086 3300009553 Bacteria 132132
105 Ga0105249_10096242 3300009553 Bacteria 2777
106 Ga0105239_13473448 3300010375 Bacteria 512
107 Ga0105246_10000574 3300011119 Bacteria 20388
108 Ga0105246_10096827 3300011119 Bacteria 2140
109 Ga0157326_1004728 3300012513 Bacteria 1435
110 Ga0157373_10354274 3300013100 Bacteria 1047
111 Ga0157373_11495325 3300013100 Bacteria 515
112 Ga0157371_10000110 3300013102 Bacteria 124933
113 Ga0157370_10003802 3300013104 Bacteria 17612
114 Ga0157369_10002615 3300013105 Bacteria 21530
115 Ga0157369_10011999 3300013105 Bacteria 9842
116 Ga0157369_10068183 3300013105 Bacteria 3822
117 Ga0157369_10072392 3300013105 Bacteria 3699
118 Ga0157369_10195837 3300013105 Bacteria 2122
119 Ga0157374_10105445 3300013296 Bacteria 2707
120 Ga0157374_10193655 3300013296 Bacteria 1989
121 Ga0157378_10205471 3300013297 Bacteria 1865
122 Ga0157378_11577523 3300013297 Bacteria 702
123 Ga0157378_12544954 3300013297 Bacteria 564
124 Ga0163162_10004623 3300013306 Bacteria 13265
125 Ga0163162_10100249 3300013306 Bacteria 2987
126 Ga0163162_10654148 3300013306 Bacteria 1174
127 Ga0157372_10138582 3300013307 Bacteria 2802
128 Ga0157372_11453519 3300013307 Bacteria 790
129 Ga0157375_10000592 3300013308 Bacteria 32209
130 Ga0157375_10955487 3300013308 Bacteria 998
131 Ga0157375_12928403 3300013308 Bacteria 570
132 Ga0163163_10251054 3300014325 Bacteria 1819
133 Ga0157380_10778532 3300014326 Bacteria 971
134 Ga0157377_10139434 3300014745 Bacteria 1489
135 Ga0157376_10000095 3300014969 Bacteria 66245
136 Ga0157376_10956912 3300014969 Bacteria 877
137 Ga0163161_12024976 3300017792 Bacteria 512
138 Ga0206352_10570229 3300020078 Bacteria 754
139 Ga0206354_10898498 3300020081 Bacteria 584
140 Ga0209674_105616 3300025226 Bacteria 1820
141 Ga0209563_100081 3300025230 Bacteria 199455
142 Ga0209437_115646 3300025233 Bacteria 1032
143 Ga0207425_1000005 3300025245 Bacteria 900502
144 Ga0209677_112052 3300025253 Bacteria 1305
145 Ga0209148_1000008 3300025254 Bacteria 1504371
146 Ga0209129_1001474 3300025258 Bacteria 13094
147 Ga0209233_1000107 3300025261 Bacteria 267399
148 Ga0209565_1000209 3300025263 Bacteria 68237
149 Ga0209565_1028334 3300025263 Bacteria 1108
150 Ga0209455_1000002 3300025272 Bacteria 1505459
151 Ga0209455_1042853 3300025272 Bacteria 677
152 Ga0209673_1045003 3300025273 Bacteria 1217
153 Ga0209676_1002244 3300025292 Bacteria 14280
154 Ga0209676_1036522 3300025292 Bacteria 1429
155 Ga0209025_1000128 3300025294 Bacteria 198859
156 Ga0209564_1001366 3300025295 Bacteria 25610
157 Ga0209564_1001949 3300025295 Bacteria 18260
158 Ga0209758_1000002 3300025297 Bacteria 1400310
159 Ga0209758_1000017 3300025297 Bacteria 754393
160 Ga0209050_1000001 3300025298 Bacteria 3563507
161 Ga0209050_1000209 3300025298 Bacteria 130884
162 Ga0209050_1000707 3300025298 Bacteria 49453
163 Ga0209050_1025544 3300025298 Bacteria 2003
164 Ga0209050_1043346 3300025298 Bacteria 1217
165 Ga0207426_1089187 3300025302 Bacteria 820
166 Ga0207426_1150361 3300025302 Bacteria 543
167 Ga0209051_1000357 3300025303 Bacteria 67596
168 Ga0209257_1000027 3300025304 Bacteria 703541
169 Ga0209257_1000500 3300025304 Bacteria 70060
170 Ga0209257_1001749 3300025304 Bacteria 24096
171 Ga0209257_1151865 3300025304 Bacteria 509
172 Ga0207697_10006787 3300025315 Bacteria 5147
173 Ga0207682_10032446 3300025893 Bacteria 2099
174 Ga0207642_10006614 3300025899 Bacteria 3866
175 Ga0207710_10011316 3300025900 Bacteria 3757
176 Ga0207688_10077892 3300025901 Bacteria 1889
177 Ga0207688_10099326 3300025901 Bacteria 1679
178 Ga0207647_10009889 3300025904 Bacteria 6755
179 Ga0207645_10021501 3300025907 Bacteria 4207
180 Ga0207645_10025902 3300025907 Bacteria 3793
181 Ga0207645_10497149 3300025907 Bacteria 825
182 Ga0207705_10000134 3300025909 Bacteria 79513
183 Ga0207705_10012187 3300025909 Bacteria 6214
184 Ga0207654_10001172 3300025911 Bacteria 14044
185 Ga0207707_10613039 3300025912 Bacteria 920
186 Ga0207695_10167048 3300025913 Bacteria 2128
187 Ga0207695_10745589 3300025913 Bacteria 860
188 Ga0207671_10427955 3300025914 Bacteria 1053
189 Ga0207671_10651610 3300025914 Bacteria 839
190 Ga0207657_10008611 3300025919 Bacteria 10327
191 Ga0207657_10083546 3300025919 Bacteria 2679
192 Ga0207657_10153615 3300025919 Bacteria 1873
193 Ga0207657_11192695 3300025919 Bacteria 579
194 Ga0207649_10000089 3300025920 Bacteria 76923
195 Ga0207649_10000414 3300025920 Bacteria 31530
196 Ga0207649_10846086 3300025920 Bacteria 716
197 Ga0207649_10850174 3300025920 Bacteria 714
198 Ga0207652_10452874 3300025921 Bacteria 1157
199 Ga0207681_10084245 3300025923 Bacteria 2253
200 Ga0207681_10193887 3300025923 Bacteria 1556
201 Ga0207681_10587776 3300025923 Bacteria 919
202 Ga0207694_10066351 3300025924 Bacteria 2816
203 Ga0207694_10067907 3300025924 Bacteria 2783
204 Ga0207694_11760294 3300025924 Unclassified 521
205 Ga0207650_10501443 3300025925 Bacteria 1014
206 Ga0207659_10188659 3300025926 Bacteria 1639
207 Ga0207687_10000473 3300025927 Bacteria 27414
208 Ga0207687_10804590 3300025927 Bacteria 802
209 Ga0207644_10019894 3300025931 Bacteria 4559
210 Ga0207644_11217773 3300025931 Bacteria 633
211 Ga0207690_10048111 3300025932 Bacteria 2833
212 Ga0207690_10117210 3300025932 Bacteria 1927
213 Ga0207706_10273877 3300025933 Bacteria 1473
214 Ga0207706_11408610 3300025933 Bacteria 572
215 Ga0207686_10000866 3300025934 Bacteria 18334
216 Ga0207686_10339556 3300025934 Bacteria 1128
217 Ga0207709_10000146 3300025935 Bacteria 98521
218 Ga0207709_10000260 3300025935 Bacteria 62960
219 Ga0207709_10673394 3300025935 Bacteria 826
220 Ga0207669_10000471 3300025937 Bacteria 17580
221 Ga0207669_10004566 3300025937 Bacteria 6105
222 Ga0207669_10611901 3300025937 Bacteria 887
223 Ga0207669_11590006 3300025937 Bacteria 558
224 Ga0207704_10000064 3300025938 Bacteria 73788
225 Ga0207704_10481232 3300025938 Bacteria 997
226 Ga0207704_10484152 3300025938 Bacteria 994
227 Ga0207691_10109741 3300025940 Bacteria 2455
228 Ga0207691_10686762 3300025940 Bacteria 864
229 Ga0207711_10003598 3300025941 Bacteria 13403
230 Ga0207689_10075643 3300025942 Bacteria 2768
231 Ga0207661_10238179 3300025944 Bacteria 1614
232 Ga0207679_10194739 3300025945 Bacteria 1688
233 Ga0207667_10000001 3300025949 Bacteria 1178522
234 Ga0207667_10253459 3300025949 Bacteria 1800
235 Ga0207667_10575854 3300025949 Bacteria 1137
236 Ga0207651_10000010 3300025960 Bacteria 193754
237 Ga0207651_10148137 3300025960 Bacteria 1823
238 Ga0207651_11795357 3300025960 Bacteria 552
239 Ga0207712_10000026 3300025961 Bacteria 271237
240 Ga0207712_10404478 3300025961 Bacteria 1148
241 Ga0207668_10319978 3300025972 Bacteria 1287
242 Ga0207668_11958273 3300025972 Bacteria 528
243 Ga0207640_10020478 3300025981 Bacteria 3928
244 Ga0207640_10181970 3300025981 Bacteria 1577
245 Ga0207640_10282770 3300025981 Bacteria 1304
246 Ga0207658_10036194 3300025986 Bacteria 3539
247 Ga0207658_11208960 3300025986 Bacteria 691
248 Ga0207658_11832610 3300025986 Bacteria 553
249 Ga0207677_10000021 3300026023 Bacteria 131828
250 Ga0207677_10038594 3300026023 Bacteria 3133
251 Ga0207677_10891942 3300026023 Bacteria 801
252 Ga0207703_10000753 3300026035 Bacteria 31952
253 Ga0207703_10002023 3300026035 Bacteria 17904
254 Ga0207639_10116714 3300026041 Bacteria 2186
255 Ga0207639_10279386 3300026041 Bacteria 1468
256 Ga0207678_10065835 3300026067 Bacteria 3111
257 Ga0207702_10003541 3300026078 Bacteria 14213
258 Ga0207702_10090193 3300026078 Bacteria 2682
259 Ga0207641_10001678 3300026088 Bacteria 21545
260 Ga0207648_10000162 3300026089 Bacteria 68397
261 Ga0207648_10089296 3300026089 Bacteria 2692
262 Ga0207676_10010587 3300026095 Bacteria 6573
263 Ga0207676_10422930 3300026095 Bacteria 1250
264 Ga0207674_10644949 3300026116 Bacteria 1023
265 Ga0207675_100655745 3300026118 Bacteria 1056
266 Ga0207683_10001627 3300026121 Bacteria 20148
267 Ga0207683_11393537 3300026121 Bacteria 648
268 Ga0207698_10013588 3300026142 Bacteria 5379
269 Ga0207698_10027213 3300026142 Bacteria 4056
270 Ga0209281_1045307 3300027111 Bacteria 721
271 Ga0268266_10000036 3300028379 Bacteria 348910
272 Ga0268265_10000084 3300028380 Bacteria 119522
273 Ga0268265_10278161 3300028380 Bacteria 1496
274 Ga0268264_10001419 3300028381 Bacteria 22422
275 Ga0307517_10136482 3300028786 Bacteria 1742
276 Ga0307515_10228749 3300028794 Bacteria 1658
277 Ga0314311_1099328 3300030733 Bacteria 885
278 Ga0316182_1124187 3300030745 Bacteria 1061
279 Ga0307513_10019526 3300031456 Bacteria 8067
280 Ga0307513_10079752 3300031456 Bacteria 3380
281 Ga0307513_10229349 3300031456 Bacteria 1670
282 Ga0307513_10365332 3300031456 Bacteria 1187
283 Ga0307513_11060938 3300031456 Bacteria 521
284 Ga0307509_10260747 3300031507 Bacteria 1509
285 Ga0307412_10039619 3300031911 Bacteria 3043
286 Ga0307409_102173821 3300031995 Bacteria 584
287 Ga0307510_10170867 3300033180 Bacteria 1753
288 Ga0307510_10413711 3300033180 Bacteria 791
289 Ga0307510_10627161 3300033180 Bacteria 530
290 Ga0395905_0128047 3300037471 Bacteria 2388
291 Ga0395905_0160733 3300037471 Bacteria 2111
292 Ga0395905_1420015 3300037471 Bacteria 598
293 Ga0395901_0178992 3300038443 Bacteria 2224
294 Ga0237819_04423 3300038705 Bacteria 2312
295 Ga0439436_0057103 3300041404 Bacteria 1095
296 Ga0439453_0048333 3300041408 Bacteria 853
297 Ga0439461_0055320 3300041410 Bacteria 889
298 Ga0439465_0001974 3300041413 Bacteria 6736
299 Ga0451789_1031900 3300041443 Bacteria 511
300 Ga0451793_0275676 3300041452 Bacteria 633
301 Ga0451795_0663129 3300041456 Bacteria 580
302 Ga0451795_1567016 3300041456 Bacteria 1120
303 Ga0451800_0880592 3300041459 Bacteria 751
304 Ga0451802_0368878 3300041460 Bacteria 574
305 Ga0451807_1098360 3300041486 Bacteria 653
306 Ga0451807_1941827 3300041486 Bacteria 541
307 Ga0451833_1268577 3300041491 Bacteria 694
308 Ga0451837_0747534 3300041494 Bacteria 988
309 Ga0451837_0971247 3300041494 Bacteria 533
310 Ga0451853_1281590 3300041512 Bacteria 791
311 Ga0439431_0026860 3300041997 Bacteria 1412
312 Ga0439431_0040883 3300041997 Bacteria 1180
313 Ga0439445_0032388 3300042004 Bacteria 1362
314 Ga0439445_0080333 3300042004 Bacteria 910
315 Ga0439448_0015231 3300042005 Bacteria 2327
316 Ga0439432_066404 3300042006 Bacteria 1105
317 Ga0439457_010366 3300042014 Bacteria 2143
318 Ga0439462_0042284 3300042015 Bacteria 1217
319 Ga0450898_144764 3300042134 Bacteria 517
320 Ga0439446_0027649 3300042156 Bacteria 1629
321 Ga0439435_0100285 3300042436 Bacteria 889
322 Ga0466961_0824109 3300044693 Bacteria 554
323 Ga0466963_0142077 3300044694 Bacteria 1663
324 Ga0466963_0149990 3300044694 Bacteria 1618
325 Ga0466970_0928260 3300044765 Bacteria 512
326 Ga0466957_0684886 3300044842 Bacteria 723
327 Ga0466958_0342785 3300045836 Bacteria 961
328 Ga0495617_046761 3300046452 Bacteria 1442
329 Ga0495627_098059 3300046453 Bacteria 838
330 Ga0495592_0484158 3300046454 Bacteria 770
331 Ga0495590_0192028 3300046457 Bacteria 748
332 Ga0495590_0287382 3300046457 Bacteria 617
333 Ga0495629_0380929 3300046459 Bacteria 960
334 Ga0495638_0099733 3300046460 Bacteria 1738
335 Ga0495638_0164127 3300046460 Bacteria 1279
336 Ga0495650_0000428 3300046471 Bacteria 68082
337 Ga0495650_0172073 3300046471 Bacteria 766
338 Ga0495639_0723341 3300046475 Bacteria 515
339 Ga0495584_0078586 3300046491 Bacteria 1660
340 Ga0495585_0079003 3300046492 Bacteria 1784
341 Ga0495585_0349563 3300046492 Bacteria 718
342 Ga0495585_0459880 3300046492 Bacteria 608
343 Ga0495596_0053596 3300046500 Bacteria 1578
344 Ga0495607_0337110 3300046501 Bacteria 699
345 Ga0495583_0000613 3300046506 Bacteria 48224
346 Ga0495583_0005390 3300046506 Bacteria 8705
347 Ga0495583_0009190 3300046506 Bacteria 5935
348 Ga0495583_0032197 3300046506 Bacteria 2532
349 Ga0495583_0056784 3300046506 Bacteria 1763
350 Ga0495583_0105060 3300046506 Bacteria 1202
351 Ga0495606_0000534 3300046507 Bacteria 61311
352 Ga0495606_0052289 3300046507 Bacteria 2657
353 Ga0495606_0101561 3300046507 Bacteria 1750
354 Ga0495616_0021403 3300046513 Bacteria 3502
355 Ga0495616_0236207 3300046513 Bacteria 790
356 Ga0495631_0026437 3300046518 Bacteria 2665
357 Ga0495631_0034307 3300046518 Bacteria 2275
358 Ga0495631_0143195 3300046518 Bacteria 1026
359 Ga0495632_0095055 3300046519 Bacteria 1409
360 Ga0495637_0044255 3300046520 Bacteria 1896
361 Ga0495643_0008262 3300046522 Bacteria 6607
362 Ga0495643_0009124 3300046522 Bacteria 6205
363 Ga0495643_0058809 3300046522 Bacteria 2044
364 Ga0495643_0177901 3300046522 Bacteria 1036
365 Ga0495643_0228141 3300046522 Bacteria 879
366 Ga0495643_0416185 3300046522 Bacteria 590
367 Ga0495648_0000376 3300046524 Bacteria 48867
368 Ga0495648_0021934 3300046524 Bacteria 4411
369 Ga0495663_0001141 3300046525 Bacteria 8568
370 Ga0495663_0022362 3300046525 Bacteria 1826
371 Ga0495663_0083837 3300046525 Bacteria 1030
372 Ga0495642_0004270 3300046528 Bacteria 5555
373 Ga0495652_0297347 3300046529 Bacteria 1175
374 Ga0495587_0515661 3300046536 Bacteria 660
375 Ga0495609_0107855 3300046538 Bacteria 1203
376 Ga0495597_0105048 3300046542 Bacteria 1188
377 Ga0495597_0139519 3300046542 Bacteria 1000
378 Ga0495633_0003594 3300046558 Bacteria 10261
379 Ga0495633_0064702 3300046558 Bacteria 1709
380 Ga0495668_0000431 3300046616 Bacteria 54273
381 Ga0495668_0012280 3300046616 Bacteria 5083
382 Ga0495668_0125008 3300046616 Bacteria 1407
383 Ga0495611_0011300 3300046648 Bacteria 3785
384 Ga0495611_0130843 3300046648 Bacteria 1170
385 Ga0495625_0000584 3300046660 Bacteria 52916
386 Ga0495625_0000665 3300046660 Bacteria 48983
387 Ga0495625_0013211 3300046660 Bacteria 6648
388 Ga0495625_0041334 3300046660 Bacteria 3357
389 Ga0495625_0052191 3300046660 Bacteria 2928
390 Ga0495625_0058149 3300046660 Bacteria 2748
391 Ga0495625_0085805 3300046660 Bacteria 2184
392 Ga0495669_0000129 3300046684 Bacteria 48558
393 Ga0495670_0020544 3300046691 Bacteria 3257
394 Ga0495670_0351891 3300046691 Bacteria 793
395 Ga0495649_0015398 3300046694 Bacteria 4354
396 Ga0495649_0037865 3300046694 Bacteria 2647
397 Ga0495649_0121335 3300046694 Bacteria 1382
398 Ga0495649_0174633 3300046694 Bacteria 1123
399 Ga0495649_0232460 3300046694 Bacteria 951
400 Ga0495600_0003850 3300046809 Bacteria 8899
401 Ga0495660_0063157 3300046810 Bacteria 1984
402 Ga0495660_0114631 3300046810 Bacteria 1371
403 Ga0495660_0130232 3300046810 Bacteria 1263
404 Ga0495683_0003096 3300047323 Bacteria 9749
405 Ga0495683_0009719 3300047323 Bacteria 5114
406 Ga0495687_000109 3300047443 Bacteria 125648
407 Ga0495687_001290 3300047443 Bacteria 23529
408 Ga0495677_0012314 3300047445 Bacteria 3120
409 Ga0495677_0037301 3300047445 Bacteria 1775
410 Ga0495677_0348990 3300047445 Bacteria 584
411 Ga0495673_0090439 3300047469 Bacteria 1252
412 Ga0495681_0004372 3300047470 Bacteria 9652
413 Ga0495681_0007127 3300047470 Bacteria 7204
414 Ga0495686_0241368 3300047472 Bacteria 1019
415 Ga0495686_0249059 3300047472 Bacteria 999
416 Ga0496100_0125239 3300048903 Bacteria 1803
417 Ga0496101_0331075 3300048904 Bacteria 1195
418 Ga0496102_0000329 3300048905 Bacteria 59006
419 Ga0496103_0000164 3300048906 Bacteria 70089
420 Ga0496104_0030228 3300048907 Bacteria 5032
421 Ga0496105_0002044 3300048908 Bacteria 14589
422 Ga0496107_0353499 3300048910 Bacteria 1093
423 Ga0496107_0439489 3300048910 Bacteria 970
424 Ga0496110_0007556 3300048913 Bacteria 8682
425 Ga0496111_0004277 3300048914 Bacteria 8997
426 Ga0496113_0010663 3300048916 Bacteria 6086
427 Ga0496114_0012260 3300048917 Bacteria 6860
428 Ga0496115_0000174 3300048918 Bacteria 59745
429 Ga0496115_0016397 3300048918 Bacteria 5642
430 Ga0496116_0002115 3300048919 Bacteria 21160
431 Ga0496117_0000432 3300048920 Bacteria 69975
432 Ga0496118_0000127 3300048921 Bacteria 135377
433 Ga0496119_0045957 3300048922 Bacteria 2731
434 Ga0496120_0011068 3300048923 Bacteria 6226
435 Ga0496121_0000335 3300048924 Bacteria 98310
436 Ga0496121_0001019 3300048924 Bacteria 49980
437 Ga0496121_0223986 3300048924 Bacteria 1322
438 Ga0496122_0034395 3300048925 Bacteria 4147
439 Ga0496123_0075326 3300048926 Bacteria 2083
440 Ga0496124_0000011 3300048927 Bacteria 524145
441 Ga0496125_0000426 3300048928 Bacteria 78122
442 Ga0496126_0004692 3300048929 Bacteria 16145
443 Ga0495682_0253451 3300049460 Bacteria 622
444 Ga0501038_0547007 3300049574 Bacteria 881
445 Ga0501047_0310469 3300049581 Bacteria 1418
446 Ga0501044_0750714 3300049823 Bacteria 858
447 nmdc:mga0k408_122446_c1 3300050493 Bacteria 1541
448 nmdc:mga0k408_284239_c1 3300050493 Bacteria 987
449 nmdc:mga0sz30_443277_c1 3300050516 Bacteria 583
450 Ga0500610_0000099 3300053079 Bacteria 25819
451 Ga0500643_001568 3300053087 Bacteria 12941
452 Ga0500643_001747 3300053087 Bacteria 12029
453 Ga0500643_010010 3300053087 Bacteria 3571
454 Ga0500643_043196 3300053087 Bacteria 1315
455 Ga0500646_0365896 3300053090 Bacteria 528
456 Ga0500566_0005221 3300053094 Bacteria 7733
457 Ga0500641_0019080 3300053096 Bacteria 2589
458 Ga0500555_085882 3300053103 Bacteria 814
459 Ga0500562_019273 3300053108 Bacteria 1765
460 Ga0500562_213578 3300053108 Bacteria 522
461 Ga0500594_0130655 3300053118 Bacteria 795
462 Ga0500595_001055 3300053119 Bacteria 15345
463 Ga0500595_006368 3300053119 Bacteria 5015
464 Ga0500595_024955 3300053119 Bacteria 2080
465 Ga0500595_128730 3300053119 Bacteria 713
466 Ga0500607_082901 3300053121 Bacteria 1631
467 Ga0500642_0000631 3300053130 Bacteria 10533
468 Ga0500559_0090613 3300053136 Bacteria 1399
469 Ga0500559_0165868 3300053136 Bacteria 1038
470 Ga0500559_0209898 3300053136 Bacteria 918
471 Ga0500559_0283820 3300053136 Bacteria 778
472 Ga0500559_0356815 3300053136 Bacteria 683
473 Ga0500568_0024253 3300053139 Bacteria 2570
474 Ga0500585_208010 3300053144 Bacteria 647
475 Ga0500604_0242326 3300053151 Bacteria 623
476 Ga0500616_0074160 3300053153 Bacteria 1725
477 Ga0500619_008673 3300053154 Bacteria 2483
478 Ga0500636_0002160 3300053177 Bacteria 10856
479 Ga0500645_000001 3300053730 Bacteria 455558
480 Ga0500609_047683 3300053731 Bacteria 594
481 Ga0500661_108376 3300055283 Bacteria 531

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005535 Ga0070684_100994973 Ga0070684_1009949732 64
2 3300005614 Ga0068856_100364594 Ga0068856_1003645942 64
3 3300006847 Ga0075431_100010549 Ga0075431_1000105499 64
4 3300013100 Ga0157373_11495325 Ga0157373_114953252 64
5 3300013105 Ga0157369_10072392 Ga0157369_100723923 64
6 3300005617 Ga0068859_102068246 Ga0068859_1020682462 65
7 3300006931 Ga0097620_102067556 Ga0097620_1020675562 65
8 3300025912 Ga0207707_10613039 Ga0207707_106130392 65
9 3300025924 Ga0207694_11760294 Ga0207694_117602942 65
10 3300037471 Ga0395905_1420015 Ga0395905_1420015_89_289 65
11 3300044694 Ga0466963_0142077 Ga0466963_0142077_122_322 65
12 3300044842 Ga0466957_0684886 Ga0466957_0684886_179_379 65
13 iso_pu_bacteria 2599185354 2600203425 65
14 iso_pu_bacteria 2643221622 2644128069 65
15 iso_pu_bacteria 2751185897 2753765772 65
16 3300003214 JGI25165J46597_1000065 JGI25165J46597_100006537 66
17 3300005578 Ga0068854_101846679 Ga0068854_1018466792 66
18 3300005614 Ga0068856_100137196 Ga0068856_1001371964 66
19 3300006881 Ga0068865_101254145 Ga0068865_1012541452 66
20 3300009545 Ga0105237_10534776 Ga0105237_105347763 66
21 3300009551 Ga0105238_10004794 Ga0105238_100047944 66
22 3300013105 Ga0157369_10002615 Ga0157369_100026157 66
23 3300025233 Ga0209437_115646 Ga0209437_1156462 66
24 3300025261 Ga0209233_1000107 Ga0209233_1000107171 66
25 3300025909 Ga0207705_10012187 Ga0207705_100121875 66
26 3300025914 Ga0207671_10427955 Ga0207671_104279552 66
27 3300025919 Ga0207657_11192695 Ga0207657_111926952 66
28 3300025920 Ga0207649_10850174 Ga0207649_108501741 66
29 3300025924 Ga0207694_10066351 Ga0207694_100663513 66
30 3300025938 Ga0207704_10484152 Ga0207704_104841523 66
31 3300025981 Ga0207640_10181970 Ga0207640_101819703 66
32 3300026041 Ga0207639_10279386 Ga0207639_102793862 66
33 3300026078 Ga0207702_10090193 Ga0207702_100901932 66
34 3300026116 Ga0207674_10644949 Ga0207674_106449492 66
35 3300026142 Ga0207698_10013588 Ga0207698_100135884 66
36 3300031456 Ga0307513_10365332 Ga0307513_103653322 66
37 3300037471 Ga0395905_0128047 Ga0395905_0128047_1894_2097 66
38 3300041460 Ga0451802_0368878 Ga0451802_0368878_305_505 66
39 3300042134 Ga0450898_144764 Ga0450898_144764_244_447 66
40 iso_pu_bacteria 2879163058 2879165441 66
41 3300003791 Ga0055530_10000845 Ga0055530_1000084525 67
42 3300003794 Ga0055531_10000073 Ga0055531_10000073113 67
43 3300005262 Ga0065165_1004703 Ga0065165_10047034 67
44 3300013104 Ga0157370_10003802 Ga0157370_100038023 67
45 3300025298 Ga0209050_1000209 Ga0209050_1000209127 67
46 3300025304 Ga0209257_1000027 Ga0209257_1000027575 67
47 3300025932 Ga0207690_10117210 Ga0207690_101172102 67
48 3300025944 Ga0207661_10238179 Ga0207661_102381792 67
49 3300026041 Ga0207639_10116714 Ga0207639_101167142 67
50 3300033180 Ga0307510_10413711 Ga0307510_104137112 67
51 3300041486 Ga0451807_1941827 Ga0451807_1941827_188_391 67
52 3300044694 Ga0466963_0149990 Ga0466963_0149990_404_610 67
53 3300045836 Ga0466958_0342785 Ga0466958_0342785_404_610 67
54 3300049574 Ga0501038_0547007 Ga0501038_0547007_665_868 67
55 3300049823 Ga0501044_0750714 Ga0501044_0750714_43_246 67
56 3300053090 Ga0500646_0365896 Ga0500646_0365896_300_503 67
57 3300053118 Ga0500594_0130655 Ga0500594_0130655_403_606 67
58 3300005262 Ga0065165_1023697 Ga0065165_10236971 68
59 3300005293 Ga0065715_10707290 Ga0065715_107072902 68
60 3300005339 Ga0070660_100002551 Ga0070660_1000025514 68
61 3300005344 Ga0070661_100000113 Ga0070661_10000011336 68
62 3300005353 Ga0070669_100221189 Ga0070669_1002211893 68
63 3300005353 Ga0070669_100311968 Ga0070669_1003119682 68
64 3300005563 Ga0068855_100258712 Ga0068855_1002587123 68
65 3300005616 Ga0068852_100658921 Ga0068852_1006589212 68
66 3300005617 Ga0068859_101903470 Ga0068859_1019034702 68
67 3300005618 Ga0068864_100000352 Ga0068864_10000035219 68
68 3300005718 Ga0068866_10806498 Ga0068866_108064981 68
69 3300005719 Ga0068861_100064577 Ga0068861_1000645774 68
70 3300005719 Ga0068861_100629007 Ga0068861_1006290072 68
71 3300005842 Ga0068858_100000132 Ga0068858_10000013256 68
72 3300005842 Ga0068858_100000444 Ga0068858_10000044430 68
73 3300005844 Ga0068862_100072957 Ga0068862_1000729572 68
74 3300006195 Ga0075366_10894901 Ga0075366_108949012 68
75 3300006237 Ga0097621_100490206 Ga0097621_1004902062 68
76 3300006881 Ga0068865_100249923 Ga0068865_1002499234 68
77 3300006931 Ga0097620_101903712 Ga0097620_1019037122 68
78 3300009098 Ga0105245_10001310 Ga0105245_100013106 68
79 3300009148 Ga0105243_10539296 Ga0105243_105392962 68
80 3300009177 Ga0105248_10025301 Ga0105248_100253015 68
81 3300009545 Ga0105237_11852732 Ga0105237_118527323 68
82 3300013306 Ga0163162_10004623 Ga0163162_100046235 68
83 3300013306 Ga0163162_10654148 Ga0163162_106541483 68
84 3300013308 Ga0157375_10955487 Ga0157375_109554872 68
85 3300014325 Ga0163163_10251054 Ga0163163_102510541 68
86 3300025304 Ga0209257_1151865 Ga0209257_11518652 68
87 3300025315 Ga0207697_10006787 Ga0207697_100067874 68
88 3300025919 Ga0207657_10008611 Ga0207657_100086119 68
89 3300025920 Ga0207649_10000089 Ga0207649_1000008952 68
90 3300025923 Ga0207681_10084245 Ga0207681_100842453 68
91 3300025923 Ga0207681_10193887 Ga0207681_101938872 68
92 3300025927 Ga0207687_10000473 Ga0207687_1000047312 68
93 3300025931 Ga0207644_11217773 Ga0207644_112177732 68
94 3300025935 Ga0207709_10673394 Ga0207709_106733942 68
95 3300025937 Ga0207669_10611901 Ga0207669_106119012 68
96 3300025937 Ga0207669_11590006 Ga0207669_115900062 68
97 3300025938 Ga0207704_10481232 Ga0207704_104812323 68
98 3300025941 Ga0207711_10003598 Ga0207711_100035988 68
99 3300025972 Ga0207668_11958273 Ga0207668_119582731 68
100 3300025986 Ga0207658_11208960 Ga0207658_112089602 68
101 3300026023 Ga0207677_10891942 Ga0207677_108919421 68
102 3300026035 Ga0207703_10000753 Ga0207703_1000075327 68
103 3300026035 Ga0207703_10002023 Ga0207703_100020238 68
104 3300026095 Ga0207676_10010587 Ga0207676_100105874 68
105 3300028380 Ga0268265_10278161 Ga0268265_102781613 68
106 3300028794 Ga0307515_10228749 Ga0307515_102287493 68
107 3300031456 Ga0307513_10019526 Ga0307513_100195269 68
108 3300031507 Ga0307509_10260747 Ga0307509_102607472 68
109 3300041408 Ga0439453_0048333 Ga0439453_0048333_569_775 68
110 3300041494 Ga0451837_0747534 Ga0451837_0747534_532_738 68
111 3300042436 Ga0439435_0100285 Ga0439435_0100285_445_651 68
112 3300046457 Ga0495590_0192028 Ga0495590_0192028_308_514 68
113 3300046460 Ga0495638_0164127 Ga0495638_0164127_369_575 68
114 3300046471 Ga0495650_0172073 Ga0495650_0172073_410_616 68
115 3300046506 Ga0495583_0032197 Ga0495583_0032197_1324_1530 68
116 3300046616 Ga0495668_0012280 Ga0495668_0012280_1283_1489 68
117 3300046660 Ga0495625_0085805 Ga0495625_0085805_687_893 68
118 3300046691 Ga0495670_0351891 Ga0495670_0351891_49_255 68
119 3300046694 Ga0495649_0232460 Ga0495649_0232460_340_546 68
120 3300047445 Ga0495677_0037301 Ga0495677_0037301_448_654 68
121 3300053087 Ga0500643_001747 Ga0500643_001747_1311_1517 68
122 3300053119 Ga0500595_024955 Ga0500595_024955_1297_1503 68
123 3300053136 Ga0500559_0165868 Ga0500559_0165868_405_611 68
124 3300053136 Ga0500559_0209898 Ga0500559_0209898_563_769 68
125 3300001990 JGI24737J22298_10000396 JGI24737J22298_1000039620 69
126 3300001990 JGI24737J22298_10000868 JGI24737J22298_100008688 69
127 3300003215 JGI25153J46596_10000027 JGI25153J46596_100000274 69
128 3300003759 Ga0055525_1000099 Ga0055525_1000099121 69
129 3300003762 Ga0055542_1000177 Ga0055542_100017760 69
130 3300003763 Ga0055529_1000350 Ga0055529_100035032 69
131 3300003771 Ga0055526_1020480 Ga0055526_10204805 69
132 3300003773 Ga0055537_1044819 Ga0055537_10448191 69
133 3300003781 Ga0055536_1027127 Ga0055536_10271272 69
134 3300003791 Ga0055530_10026176 Ga0055530_100261763 69
135 3300003791 Ga0055530_10030069 Ga0055530_100300691 69
136 3300003794 Ga0055531_10039340 Ga0055531_100393401 69
137 3300003794 Ga0055531_10039353 Ga0055531_100393531 69
138 3300005262 Ga0065165_1030847 Ga0065165_10308472 69
139 3300005327 Ga0070658_10096143 Ga0070658_100961432 69
140 3300005328 Ga0070676_10090064 Ga0070676_100900643 69
141 3300005328 Ga0070676_10691903 Ga0070676_106919032 69
142 3300005333 Ga0070677_10185060 Ga0070677_101850602 69
143 3300005334 Ga0068869_100016231 Ga0068869_1000162316 69
144 3300005338 Ga0068868_100000281 Ga0068868_10000028120 69
145 3300005338 Ga0068868_100067006 Ga0068868_1000670062 69
146 3300005339 Ga0070660_100918035 Ga0070660_1009180352 69
147 3300005344 Ga0070661_100072628 Ga0070661_1000726283 69
148 3300005347 Ga0070668_101016400 Ga0070668_1010164003 69
149 3300005353 Ga0070669_101135261 Ga0070669_1011352612 69
150 3300005354 Ga0070675_100200493 Ga0070675_1002004931 69
151 3300005355 Ga0070671_100024718 Ga0070671_1000247182 69
152 3300005356 Ga0070674_100007065 Ga0070674_1000070652 69
153 3300005356 Ga0070674_100044924 Ga0070674_1000449245 69
154 3300005364 Ga0070673_100000005 Ga0070673_100000005168 69
155 3300005364 Ga0070673_100568270 Ga0070673_1005682702 69
156 3300005456 Ga0070678_100000062 Ga0070678_10000006210 69
157 3300005457 Ga0070662_100543813 Ga0070662_1005438132 69
158 3300005459 Ga0068867_100000060 Ga0068867_10000006027 69
159 3300005459 Ga0068867_100065727 Ga0068867_1000657274 69
160 3300005530 Ga0070679_100058584 Ga0070679_1000585845 69
161 3300005535 Ga0070684_100287844 Ga0070684_1002878442 69
162 3300005543 Ga0070672_100171040 Ga0070672_1001710402 69
163 3300005548 Ga0070665_100000257 Ga0070665_10000025757 69
164 3300005563 Ga0068855_100890771 Ga0068855_1008907712 69
165 3300005564 Ga0070664_100023385 Ga0070664_1000233853 69
166 3300005618 Ga0068864_100460776 Ga0068864_1004607763 69
167 3300005718 Ga0068866_10591781 Ga0068866_105917811 69
168 3300005719 Ga0068861_100946156 Ga0068861_1009461562 69
169 3300005834 Ga0068851_10063301 Ga0068851_100633012 69
170 3300005843 Ga0068860_100000609 Ga0068860_10000060946 69
171 3300005844 Ga0068862_100000099 Ga0068862_10000009950 69
172 3300005985 Ga0081539_10013701 Ga0081539_100137016 69
173 3300006186 Ga0075369_10072999 Ga0075369_100729993 69
174 3300006195 Ga0075366_10176640 Ga0075366_101766402 69
175 3300006237 Ga0097621_100006422 Ga0097621_1000064225 69
176 3300006353 Ga0075370_10476015 Ga0075370_104760154 69
177 3300006881 Ga0068865_100000027 Ga0068865_10000002764 69
178 3300006946 Ga0079104_1030151 Ga0079104_10301512 69
179 3300006948 Ga0099826_10228384 Ga0099826_102283841 69
180 3300009093 Ga0105240_11197338 Ga0105240_111973384 69
181 3300009098 Ga0105245_10056870 Ga0105245_100568703 69
182 3300009148 Ga0105243_10000180 Ga0105243_100001803 69
183 3300009148 Ga0105243_10005280 Ga0105243_100052808 69
184 3300009174 Ga0105241_10000907 Ga0105241_1000090719 69
185 3300009176 Ga0105242_10000077 Ga0105242_1000007759 69
186 3300009176 Ga0105242_10425974 Ga0105242_104259744 69
187 3300009176 Ga0105242_10752239 Ga0105242_107522393 69
188 3300009551 Ga0105238_11558392 Ga0105238_115583921 69
189 3300009551 Ga0105238_12411713 Ga0105238_124117133 69
190 3300009553 Ga0105249_10000086 Ga0105249_10000086114 69
191 3300009553 Ga0105249_10096242 Ga0105249_100962422 69
192 3300010375 Ga0105239_13473448 Ga0105239_134734483 69
193 3300011119 Ga0105246_10000574 Ga0105246_100005747 69
194 3300011119 Ga0105246_10096827 Ga0105246_100968274 69
195 3300012513 Ga0157326_1004728 Ga0157326_10047284 69
196 3300013100 Ga0157373_10354274 Ga0157373_103542742 69
197 3300013102 Ga0157371_10000110 Ga0157371_1000011042 69
198 3300013105 Ga0157369_10011999 Ga0157369_100119993 69
199 3300013105 Ga0157369_10068183 Ga0157369_100681835 69
200 3300013105 Ga0157369_10195837 Ga0157369_101958373 69
201 3300013296 Ga0157374_10105445 Ga0157374_101054453 69
202 3300013296 Ga0157374_10193655 Ga0157374_101936554 69
203 3300013297 Ga0157378_10205471 Ga0157378_102054713 69
204 3300013297 Ga0157378_11577523 Ga0157378_115775232 69
205 3300013297 Ga0157378_12544954 Ga0157378_125449541 69
206 3300013306 Ga0163162_10100249 Ga0163162_101002494 69
207 3300013307 Ga0157372_10138582 Ga0157372_101385822 69
208 3300013307 Ga0157372_11453519 Ga0157372_114535192 69
209 3300013308 Ga0157375_10000592 Ga0157375_1000059225 69
210 3300013308 Ga0157375_12928403 Ga0157375_129284032 69
211 3300014326 Ga0157380_10778532 Ga0157380_107785322 69
212 3300014745 Ga0157377_10139434 Ga0157377_101394342 69
213 3300014969 Ga0157376_10000095 Ga0157376_1000009526 69
214 3300014969 Ga0157376_10956912 Ga0157376_109569121 69
215 3300017792 Ga0163161_12024976 Ga0163161_120249762 69
216 3300020078 Ga0206352_10570229 Ga0206352_105702293 69
217 3300020081 Ga0206354_10898498 Ga0206354_108984981 69
218 3300025226 Ga0209674_105616 Ga0209674_1056163 69
219 3300025230 Ga0209563_100081 Ga0209563_1000815 69
220 3300025245 Ga0207425_1000005 Ga0207425_1000005402 69
221 3300025253 Ga0209677_112052 Ga0209677_1120522 69
222 3300025254 Ga0209148_1000008 Ga0209148_10000081274 69
223 3300025258 Ga0209129_1001474 Ga0209129_100147415 69
224 3300025263 Ga0209565_1000209 Ga0209565_100020958 69
225 3300025263 Ga0209565_1028334 Ga0209565_10283344 69
226 3300025272 Ga0209455_1000002 Ga0209455_1000002152 69
227 3300025272 Ga0209455_1042853 Ga0209455_10428533 69
228 3300025273 Ga0209673_1045003 Ga0209673_10450035 69
229 3300025292 Ga0209676_1002244 Ga0209676_100224414 69
230 3300025292 Ga0209676_1036522 Ga0209676_10365222 69
231 3300025294 Ga0209025_1000128 Ga0209025_1000128180 69
232 3300025295 Ga0209564_1001366 Ga0209564_10013661 69
233 3300025295 Ga0209564_1001949 Ga0209564_100194924 69
234 3300025297 Ga0209758_1000002 Ga0209758_1000002942 69
235 3300025297 Ga0209758_1000017 Ga0209758_1000017462 69
236 3300025298 Ga0209050_1000001 Ga0209050_1000001938 69
237 3300025298 Ga0209050_1000707 Ga0209050_100070735 69
238 3300025298 Ga0209050_1025544 Ga0209050_10255446 69
239 3300025298 Ga0209050_1043346 Ga0209050_10433464 69
240 3300025302 Ga0207426_1089187 Ga0207426_10891872 69
241 3300025302 Ga0207426_1150361 Ga0207426_11503612 69
242 3300025303 Ga0209051_1000357 Ga0209051_100035736 69
243 3300025304 Ga0209257_1000500 Ga0209257_100050065 69
244 3300025304 Ga0209257_1001749 Ga0209257_100174913 69
245 3300025893 Ga0207682_10032446 Ga0207682_100324462 69
246 3300025899 Ga0207642_10006614 Ga0207642_100066142 69
247 3300025900 Ga0207710_10011316 Ga0207710_100113164 69
248 3300025901 Ga0207688_10077892 Ga0207688_100778923 69
249 3300025901 Ga0207688_10099326 Ga0207688_100993262 69
250 3300025904 Ga0207647_10009889 Ga0207647_100098897 69
251 3300025907 Ga0207645_10021501 Ga0207645_100215012 69
252 3300025907 Ga0207645_10025902 Ga0207645_100259025 69
253 3300025907 Ga0207645_10497149 Ga0207645_104971492 69
254 3300025909 Ga0207705_10000134 Ga0207705_1000013418 69
255 3300025911 Ga0207654_10001172 Ga0207654_1000117218 69
256 3300025913 Ga0207695_10167048 Ga0207695_101670485 69
257 3300025913 Ga0207695_10745589 Ga0207695_107455894 69
258 3300025914 Ga0207671_10651610 Ga0207671_106516101 69
259 3300025919 Ga0207657_10083546 Ga0207657_100835462 69
260 3300025919 Ga0207657_10153615 Ga0207657_101536151 69
261 3300025920 Ga0207649_10000414 Ga0207649_1000041428 69
262 3300025920 Ga0207649_10846086 Ga0207649_108460862 69
263 3300025921 Ga0207652_10452874 Ga0207652_104528742 69
264 3300025923 Ga0207681_10587776 Ga0207681_105877762 69
265 3300025924 Ga0207694_10067907 Ga0207694_100679076 69
266 3300025925 Ga0207650_10501443 Ga0207650_105014433 69
267 3300025926 Ga0207659_10188659 Ga0207659_101886591 69
268 3300025927 Ga0207687_10804590 Ga0207687_108045902 69
269 3300025931 Ga0207644_10019894 Ga0207644_100198943 69
270 3300025932 Ga0207690_10048111 Ga0207690_100481112 69
271 3300025933 Ga0207706_10273877 Ga0207706_102738773 69
272 3300025933 Ga0207706_11408610 Ga0207706_114086102 69
273 3300025934 Ga0207686_10000866 Ga0207686_100008662 69
274 3300025934 Ga0207686_10339556 Ga0207686_103395562 69
275 3300025935 Ga0207709_10000146 Ga0207709_1000014634 69
276 3300025935 Ga0207709_10000260 Ga0207709_1000026022 69
277 3300025937 Ga0207669_10000471 Ga0207669_1000047113 69
278 3300025937 Ga0207669_10004566 Ga0207669_100045668 69
279 3300025938 Ga0207704_10000064 Ga0207704_1000006426 69
280 3300025940 Ga0207691_10109741 Ga0207691_101097412 69
281 3300025940 Ga0207691_10686762 Ga0207691_106867622 69
282 3300025942 Ga0207689_10075643 Ga0207689_100756431 69
283 3300025945 Ga0207679_10194739 Ga0207679_101947394 69
284 3300025949 Ga0207667_10000001 Ga0207667_10000001285 69
285 3300025949 Ga0207667_10253459 Ga0207667_102534592 69
286 3300025949 Ga0207667_10575854 Ga0207667_105758543 69
287 3300025960 Ga0207651_10000010 Ga0207651_10000010165 69
288 3300025960 Ga0207651_10148137 Ga0207651_101481373 69
289 3300025960 Ga0207651_11795357 Ga0207651_117953573 69
290 3300025961 Ga0207712_10000026 Ga0207712_1000002621 69
291 3300025961 Ga0207712_10404478 Ga0207712_104044782 69
292 3300025972 Ga0207668_10319978 Ga0207668_103199784 69
293 3300025981 Ga0207640_10020478 Ga0207640_100204785 69
294 3300025981 Ga0207640_10282770 Ga0207640_102827701 69
295 3300025986 Ga0207658_10036194 Ga0207658_100361943 69
296 3300025986 Ga0207658_11832610 Ga0207658_118326102 69
297 3300026023 Ga0207677_10000021 Ga0207677_100000214 69
298 3300026023 Ga0207677_10038594 Ga0207677_100385944 69
299 3300026067 Ga0207678_10065835 Ga0207678_100658353 69
300 3300026078 Ga0207702_10003541 Ga0207702_1000354120 69
301 3300026088 Ga0207641_10001678 Ga0207641_1000167810 69
302 3300026089 Ga0207648_10000162 Ga0207648_1000016238 69
303 3300026089 Ga0207648_10089296 Ga0207648_100892962 69
304 3300026095 Ga0207676_10422930 Ga0207676_104229302 69
305 3300026118 Ga0207675_100655745 Ga0207675_1006557452 69
306 3300026121 Ga0207683_10001627 Ga0207683_100016278 69
307 3300026121 Ga0207683_11393537 Ga0207683_113935373 69
308 3300026142 Ga0207698_10027213 Ga0207698_100272135 69
309 3300027111 Ga0209281_1045307 Ga0209281_10453071 69
310 3300028379 Ga0268266_10000036 Ga0268266_10000036283 69
311 3300028380 Ga0268265_10000084 Ga0268265_1000008486 69
312 3300028381 Ga0268264_10001419 Ga0268264_1000141916 69
313 3300028786 Ga0307517_10136482 Ga0307517_101364823 69
314 3300030733 Ga0314311_1099328 Ga0314311_10993282 69
315 3300030745 Ga0316182_1124187 Ga0316182_11241872 69
316 3300031456 Ga0307513_10079752 Ga0307513_100797523 69
317 3300031456 Ga0307513_10229349 Ga0307513_102293493 69
318 3300031456 Ga0307513_11060938 Ga0307513_110609381 69
319 3300031911 Ga0307412_10039619 Ga0307412_100396194 69
320 3300031995 Ga0307409_102173821 Ga0307409_1021738212 69
321 3300033180 Ga0307510_10170867 Ga0307510_101708675 69
322 3300033180 Ga0307510_10627161 Ga0307510_106271612 69
323 3300037471 Ga0395905_0160733 Ga0395905_0160733_313_522 69
324 3300038443 Ga0395901_0178992 Ga0395901_0178992_734_943 69
325 3300038705 Ga0237819_04423 Ga0237819_04423_2032_2250 69
326 3300041404 Ga0439436_0057103 Ga0439436_0057103_388_612 69
327 3300041410 Ga0439461_0055320 Ga0439461_0055320_523_747 69
328 3300041413 Ga0439465_0001974 Ga0439465_0001974_5842_6066 69
329 3300041443 Ga0451789_1031900 Ga0451789_1031900_244_453 69
330 3300041452 Ga0451793_0275676 Ga0451793_0275676_307_516 69
331 3300041456 Ga0451795_0663129 Ga0451795_0663129_85_294 69
332 3300041456 Ga0451795_1567016 Ga0451795_1567016_85_294 69
333 3300041459 Ga0451800_0880592 Ga0451800_0880592_191_400 69
334 3300041486 Ga0451807_1098360 Ga0451807_1098360_309_557 69
335 3300041491 Ga0451833_1268577 Ga0451833_1268577_127_336 69
336 3300041494 Ga0451837_0971247 Ga0451837_0971247_81_290 69
337 3300041512 Ga0451853_1281590 Ga0451853_1281590_170_418 69
338 3300041997 Ga0439431_0026860 Ga0439431_0026860_234_458 69
339 3300041997 Ga0439431_0040883 Ga0439431_0040883_148_372 69
340 3300042004 Ga0439445_0032388 Ga0439445_0032388_656_880 69
341 3300042004 Ga0439445_0080333 Ga0439445_0080333_598_822 69
342 3300042005 Ga0439448_0015231 Ga0439448_0015231_2052_2261 69
343 3300042006 Ga0439432_066404 Ga0439432_066404_183_407 69
344 3300042014 Ga0439457_010366 Ga0439457_010366_746_970 69
345 3300042015 Ga0439462_0042284 Ga0439462_0042284_10_234 69
346 3300042156 Ga0439446_0027649 Ga0439446_0027649_233_457 69
347 3300044693 Ga0466961_0824109 Ga0466961_0824109_129_338 69
348 3300044765 Ga0466970_0928260 Ga0466970_0928260_274_483 69
349 3300046452 Ga0495617_046761 Ga0495617_046761_939_1148 69
350 3300046453 Ga0495627_098059 Ga0495627_098059_548_760 69
351 3300046454 Ga0495592_0484158 Ga0495592_0484158_105_314 69
352 3300046457 Ga0495590_0287382 Ga0495590_0287382_40_252 69
353 3300046459 Ga0495629_0380929 Ga0495629_0380929_611_820 69
354 3300046460 Ga0495638_0099733 Ga0495638_0099733_413_625 69
355 3300046471 Ga0495650_0000428 Ga0495650_0000428_36455_36664 69
356 3300046475 Ga0495639_0723341 Ga0495639_0723341_209_418 69
357 3300046491 Ga0495584_0078586 Ga0495584_0078586_547_759 69
358 3300046492 Ga0495585_0079003 Ga0495585_0079003_859_1068 69
359 3300046492 Ga0495585_0349563 Ga0495585_0349563_406_615 69
360 3300046492 Ga0495585_0459880 Ga0495585_0459880_344_553 69
361 3300046500 Ga0495596_0053596 Ga0495596_0053596_521_730 69
362 3300046501 Ga0495607_0337110 Ga0495607_0337110_206_415 69
363 3300046506 Ga0495583_0000613 Ga0495583_0000613_30773_30982 69
364 3300046506 Ga0495583_0005390 Ga0495583_0005390_3276_3485 69
365 3300046506 Ga0495583_0009190 Ga0495583_0009190_1937_2149 69
366 3300046506 Ga0495583_0056784 Ga0495583_0056784_328_537 69
367 3300046506 Ga0495583_0105060 Ga0495583_0105060_756_965 69
368 3300046507 Ga0495606_0000534 Ga0495606_0000534_41261_41470 69
369 3300046507 Ga0495606_0052289 Ga0495606_0052289_1720_1929 69
370 3300046507 Ga0495606_0101561 Ga0495606_0101561_970_1179 69
371 3300046513 Ga0495616_0021403 Ga0495616_0021403_121_330 69
372 3300046513 Ga0495616_0236207 Ga0495616_0236207_21_230 69
373 3300046518 Ga0495631_0026437 Ga0495631_0026437_2013_2225 69
374 3300046518 Ga0495631_0034307 Ga0495631_0034307_1560_1769 69
375 3300046518 Ga0495631_0143195 Ga0495631_0143195_649_858 69
376 3300046519 Ga0495632_0095055 Ga0495632_0095055_530_739 69
377 3300046520 Ga0495637_0044255 Ga0495637_0044255_320_532 69
378 3300046522 Ga0495643_0008262 Ga0495643_0008262_2810_3019 69
379 3300046522 Ga0495643_0009124 Ga0495643_0009124_2336_2545 69
380 3300046522 Ga0495643_0058809 Ga0495643_0058809_1034_1243 69
381 3300046522 Ga0495643_0177901 Ga0495643_0177901_187_396 69
382 3300046522 Ga0495643_0228141 Ga0495643_0228141_276_485 69
383 3300046522 Ga0495643_0416185 Ga0495643_0416185_133_342 69
384 3300046524 Ga0495648_0000376 Ga0495648_0000376_20243_20452 69
385 3300046524 Ga0495648_0021934 Ga0495648_0021934_1120_1329 69
386 3300046525 Ga0495663_0001141 Ga0495663_0001141_6381_6590 69
387 3300046525 Ga0495663_0022362 Ga0495663_0022362_1377_1589 69
388 3300046525 Ga0495663_0083837 Ga0495663_0083837_790_1008 69
389 3300046528 Ga0495642_0004270 Ga0495642_0004270_965_1174 69
390 3300046529 Ga0495652_0297347 Ga0495652_0297347_702_911 69
391 3300046536 Ga0495587_0515661 Ga0495587_0515661_163_372 69
392 3300046538 Ga0495609_0107855 Ga0495609_0107855_432_644 69
393 3300046542 Ga0495597_0105048 Ga0495597_0105048_71_280 69
394 3300046542 Ga0495597_0139519 Ga0495597_0139519_745_954 69
395 3300046558 Ga0495633_0003594 Ga0495633_0003594_9933_10142 69
396 3300046558 Ga0495633_0064702 Ga0495633_0064702_120_329 69
397 3300046616 Ga0495668_0000431 Ga0495668_0000431_39092_39301 69
398 3300046616 Ga0495668_0125008 Ga0495668_0125008_826_1035 69
399 3300046648 Ga0495611_0011300 Ga0495611_0011300_2522_2734 69
400 3300046648 Ga0495611_0130843 Ga0495611_0130843_945_1154 69
401 3300046660 Ga0495625_0000584 Ga0495625_0000584_31455_31667 69
402 3300046660 Ga0495625_0000665 Ga0495625_0000665_6271_6486 69
403 3300046660 Ga0495625_0013211 Ga0495625_0013211_2302_2514 69
404 3300046660 Ga0495625_0041334 Ga0495625_0041334_124_333 69
405 3300046660 Ga0495625_0052191 Ga0495625_0052191_393_602 69
406 3300046660 Ga0495625_0058149 Ga0495625_0058149_2136_2354 69
407 3300046684 Ga0495669_0000129 Ga0495669_0000129_30960_31172 69
408 3300046691 Ga0495670_0020544 Ga0495670_0020544_389_598 69
409 3300046694 Ga0495649_0015398 Ga0495649_0015398_3395_3604 69
410 3300046694 Ga0495649_0037865 Ga0495649_0037865_1834_2046 69
411 3300046694 Ga0495649_0121335 Ga0495649_0121335_597_806 69
412 3300046694 Ga0495649_0174633 Ga0495649_0174633_693_902 69
413 3300046809 Ga0495600_0003850 Ga0495600_0003850_7456_7665 69
414 3300046810 Ga0495660_0063157 Ga0495660_0063157_443_655 69
415 3300046810 Ga0495660_0114631 Ga0495660_0114631_344_553 69
416 3300046810 Ga0495660_0130232 Ga0495660_0130232_584_796 69
417 3300047323 Ga0495683_0003096 Ga0495683_0003096_4977_5186 69
418 3300047323 Ga0495683_0009719 Ga0495683_0009719_4112_4321 69
419 3300047443 Ga0495687_000109 Ga0495687_000109_17545_17757 69
420 3300047443 Ga0495687_001290 Ga0495687_001290_17787_17996 69
421 3300047445 Ga0495677_0012314 Ga0495677_0012314_1605_1814 69
422 3300047445 Ga0495677_0348990 Ga0495677_0348990_119_328 69
423 3300047469 Ga0495673_0090439 Ga0495673_0090439_755_964 69
424 3300047470 Ga0495681_0004372 Ga0495681_0004372_4491_4700 69
425 3300047470 Ga0495681_0007127 Ga0495681_0007127_4291_4503 69
426 3300047472 Ga0495686_0241368 Ga0495686_0241368_68_277 69
427 3300047472 Ga0495686_0249059 Ga0495686_0249059_601_810 69
428 3300048903 Ga0496100_0125239 Ga0496100_0125239_1097_1315 69
429 3300048904 Ga0496101_0331075 Ga0496101_0331075_47_256 69
430 3300048905 Ga0496102_0000329 Ga0496102_0000329_19773_19982 69
431 3300048906 Ga0496103_0000164 Ga0496103_0000164_30873_31082 69
432 3300048907 Ga0496104_0030228 Ga0496104_0030228_3966_4175 69
433 3300048908 Ga0496105_0002044 Ga0496105_0002044_14055_14264 69
434 3300048910 Ga0496107_0353499 Ga0496107_0353499_113_322 69
435 3300048910 Ga0496107_0439489 Ga0496107_0439489_449_658 69
436 3300048913 Ga0496110_0007556 Ga0496110_0007556_2091_2300 69
437 3300048914 Ga0496111_0004277 Ga0496111_0004277_1522_1731 69
438 3300048916 Ga0496113_0010663 Ga0496113_0010663_4404_4613 69
439 3300048917 Ga0496114_0012260 Ga0496114_0012260_5004_5213 69
440 3300048918 Ga0496115_0000174 Ga0496115_0000174_35391_35600 69
441 3300048918 Ga0496115_0016397 Ga0496115_0016397_3474_3689 69
442 3300048919 Ga0496116_0002115 Ga0496116_0002115_6680_6889 69
443 3300048920 Ga0496117_0000432 Ga0496117_0000432_55661_55870 69
444 3300048921 Ga0496118_0000127 Ga0496118_0000127_39104_39313 69
445 3300048922 Ga0496119_0045957 Ga0496119_0045957_661_870 69
446 3300048923 Ga0496120_0011068 Ga0496120_0011068_5323_5532 69
447 3300048924 Ga0496121_0000335 Ga0496121_0000335_53105_53317 69
448 3300048924 Ga0496121_0001019 Ga0496121_0001019_10765_10974 69
449 3300048924 Ga0496121_0223986 Ga0496121_0223986_248_463 69
450 3300048925 Ga0496122_0034395 Ga0496122_0034395_985_1194 69
451 3300048926 Ga0496123_0075326 Ga0496123_0075326_713_922 69
452 3300048927 Ga0496124_0000011 Ga0496124_0000011_96434_96643 69
453 3300048928 Ga0496125_0000426 Ga0496125_0000426_28044_28253 69
454 3300048929 Ga0496126_0004692 Ga0496126_0004692_10838_11047 69
455 3300049460 Ga0495682_0253451 Ga0495682_0253451_26_238 69
456 3300049581 Ga0501047_0310469 Ga0501047_0310469_176_388 69
457 3300050493 nmdc:mga0k408_122446_c1 nmdc:mga0k408_122446_c1_659_868 69
458 3300050493 nmdc:mga0k408_284239_c1 nmdc:mga0k408_284239_c1_595_810 69
459 3300050516 nmdc:mga0sz30_443277_c1 nmdc:mga0sz30_443277_c1_93_302 69
460 3300053079 Ga0500610_0000099 Ga0500610_0000099_5074_5286 69
461 3300053087 Ga0500643_001568 Ga0500643_001568_11913_12128 69
462 3300053087 Ga0500643_010010 Ga0500643_010010_3267_3482 69
463 3300053087 Ga0500643_043196 Ga0500643_043196_939_1151 69
464 3300053094 Ga0500566_0005221 Ga0500566_0005221_2267_2482 69
465 3300053096 Ga0500641_0019080 Ga0500641_0019080_1593_1811 69
466 3300053103 Ga0500555_085882 Ga0500555_085882_557_769 69
467 3300053108 Ga0500562_019273 Ga0500562_019273_1050_1265 69
468 3300053108 Ga0500562_213578 Ga0500562_213578_214_432 69
469 3300053119 Ga0500595_001055 Ga0500595_001055_5028_5237 69
470 3300053119 Ga0500595_006368 Ga0500595_006368_3717_3929 69
471 3300053119 Ga0500595_128730 Ga0500595_128730_455_664 69
472 3300053121 Ga0500607_082901 Ga0500607_082901_1000_1209 69
473 3300053130 Ga0500642_0000631 Ga0500642_0000631_5366_5575 69
474 3300053136 Ga0500559_0090613 Ga0500559_0090613_968_1177 69
475 3300053136 Ga0500559_0283820 Ga0500559_0283820_273_482 69
476 3300053136 Ga0500559_0356815 Ga0500559_0356815_315_524 69
477 3300053139 Ga0500568_0024253 Ga0500568_0024253_439_651 69
478 3300053144 Ga0500585_208010 Ga0500585_208010_192_401 69
479 3300053151 Ga0500604_0242326 Ga0500604_0242326_164_376 69
480 3300053153 Ga0500616_0074160 Ga0500616_0074160_76_303 69
481 3300053154 Ga0500619_008673 Ga0500619_008673_1029_1238 69
482 3300053177 Ga0500636_0002160 Ga0500636_0002160_5685_5894 69
483 3300053730 Ga0500645_000001 Ga0500645_000001_437749_437961 69
484 3300053731 Ga0500609_047683 Ga0500609_047683_10_219 69
485 3300055283 Ga0500661_108376 Ga0500661_108376_251_460 69

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_Q9XUS7_9_301_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.3332 16 69 1.20.1270.60
af_Q9XUS7_9_301_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.2588 16 69 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A448PNN8-F1-model_v4 Uncharacterized protein 0.3754 1 69 GO:0006355
AF-A0A448PNN8-F1-model_v4 Uncharacterized protein 0.3711 1 69 GO:0006355

Feature Viewer

pLDDT pTM Quality
83.2 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map