F453137
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 485 | 291 | 481 | 69 |
Family's Representative Sequence
| Representative Sequence | 3300041486|Ga0451807_1098360|Ga0451807_1098360_309_557 |
| Length | 82 |
| Sequence | VTVPPKKAFALRLDPALYAAIERAAATDLRSVNAQVECLLREALNRRGVKLAAPVRAKRGRPPKPRPGAEDEIDPFNEEETQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 2 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 3 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 4 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 60 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 163 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 164 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 165 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 166 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 167 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 174 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 175 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 176 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 177 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 178 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 185 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 186 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 187 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 188 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 189 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 190 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 191 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 192 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 193 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 194 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 195 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 256 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 257 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 258 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 270 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 271 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 272 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 273 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 274 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 275 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 276 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 277 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 278 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 280 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 281 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 282 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 283 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 284 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 285 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 286 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 287 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 288 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 290 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 291 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.76 |
| Metatranscriptomes | 0.41 |
| Isolates | 0.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.14 |
| Nodule | 0.62 |
| Rhizoplane | 4.74 |
| Rhizosphere | 70.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10000396 | 3300001990 | Bacteria | 14833 |
| 2 | JGI24737J22298_10000868 | 3300001990 | Bacteria | 10796 |
| 3 | JGI25165J46597_1000065 | 3300003214 | Bacteria | 199761 |
| 4 | JGI25153J46596_10000027 | 3300003215 | Bacteria | 210760 |
| 5 | Ga0055525_1000099 | 3300003759 | Bacteria | 136491 |
| 6 | Ga0055542_1000177 | 3300003762 | Bacteria | 78838 |
| 7 | Ga0055529_1000350 | 3300003763 | Bacteria | 51011 |
| 8 | Ga0055526_1020480 | 3300003771 | Bacteria | 2351 |
| 9 | Ga0055537_1044819 | 3300003773 | Bacteria | 520 |
| 10 | Ga0055536_1027127 | 3300003781 | Bacteria | 1591 |
| 11 | Ga0055530_10000845 | 3300003791 | Bacteria | 25265 |
| 12 | Ga0055530_10026176 | 3300003791 | Bacteria | 1616 |
| 13 | Ga0055530_10030069 | 3300003791 | Bacteria | 1444 |
| 14 | Ga0055531_10000073 | 3300003794 | Bacteria | 109510 |
| 15 | Ga0055531_10039340 | 3300003794 | Bacteria | 1405 |
| 16 | Ga0055531_10039353 | 3300003794 | Bacteria | 1405 |
| 17 | Ga0065165_1004703 | 3300005262 | Bacteria | 8207 |
| 18 | Ga0065165_1023697 | 3300005262 | Bacteria | 2076 |
| 19 | Ga0065165_1030847 | 3300005262 | Bacteria | 1702 |
| 20 | Ga0065715_10707290 | 3300005293 | Bacteria | 650 |
| 21 | Ga0070658_10096143 | 3300005327 | Bacteria | 2445 |
| 22 | Ga0070676_10090064 | 3300005328 | Bacteria | 1878 |
| 23 | Ga0070676_10691903 | 3300005328 | Bacteria | 744 |
| 24 | Ga0070677_10185060 | 3300005333 | Bacteria | 995 |
| 25 | Ga0068869_100016231 | 3300005334 | Bacteria | 5015 |
| 26 | Ga0068868_100000281 | 3300005338 | Bacteria | 34228 |
| 27 | Ga0068868_100067006 | 3300005338 | Bacteria | 2856 |
| 28 | Ga0070660_100002551 | 3300005339 | Bacteria | 12486 |
| 29 | Ga0070660_100918035 | 3300005339 | Bacteria | 738 |
| 30 | Ga0070661_100000113 | 3300005344 | Bacteria | 67566 |
| 31 | Ga0070661_100072628 | 3300005344 | Bacteria | 2532 |
| 32 | Ga0070668_101016400 | 3300005347 | Bacteria | 746 |
| 33 | Ga0070669_100221189 | 3300005353 | Bacteria | 1497 |
| 34 | Ga0070669_100311968 | 3300005353 | Bacteria | 1268 |
| 35 | Ga0070669_101135261 | 3300005353 | Bacteria | 674 |
| 36 | Ga0070675_100200493 | 3300005354 | Bacteria | 1732 |
| 37 | Ga0070671_100024718 | 3300005355 | Bacteria | 4920 |
| 38 | Ga0070674_100007065 | 3300005356 | Bacteria | 6600 |
| 39 | Ga0070674_100044924 | 3300005356 | Bacteria | 3016 |
| 40 | Ga0070673_100000005 | 3300005364 | Bacteria | 193513 |
| 41 | Ga0070673_100568270 | 3300005364 | Bacteria | 1032 |
| 42 | Ga0070678_100000062 | 3300005456 | Bacteria | 39682 |
| 43 | Ga0070662_100543813 | 3300005457 | Bacteria | 973 |
| 44 | Ga0068867_100000060 | 3300005459 | Bacteria | 67750 |
| 45 | Ga0068867_100065727 | 3300005459 | Bacteria | 2700 |
| 46 | Ga0070679_100058584 | 3300005530 | Bacteria | 3838 |
| 47 | Ga0070684_100287844 | 3300005535 | Bacteria | 1506 |
| 48 | Ga0070684_100994973 | 3300005535 | Bacteria | 787 |
| 49 | Ga0070672_100171040 | 3300005543 | Bacteria | 1807 |
| 50 | Ga0070665_100000257 | 3300005548 | Bacteria | 87607 |
| 51 | Ga0068855_100258712 | 3300005563 | Bacteria | 1940 |
| 52 | Ga0068855_100890771 | 3300005563 | Bacteria | 941 |
| 53 | Ga0070664_100023385 | 3300005564 | Bacteria | 5103 |
| 54 | Ga0068854_101846679 | 3300005578 | Bacteria | 555 |
| 55 | Ga0068856_100137196 | 3300005614 | Bacteria | 2452 |
| 56 | Ga0068856_100364594 | 3300005614 | Bacteria | 1463 |
| 57 | Ga0068852_100658921 | 3300005616 | Bacteria | 1055 |
| 58 | Ga0068859_101903470 | 3300005617 | Bacteria | 657 |
| 59 | Ga0068859_102068246 | 3300005617 | Bacteria | 629 |
| 60 | Ga0068864_100000352 | 3300005618 | Bacteria | 40434 |
| 61 | Ga0068864_100460776 | 3300005618 | Bacteria | 1217 |
| 62 | Ga0068866_10591781 | 3300005718 | Bacteria | 748 |
| 63 | Ga0068866_10806498 | 3300005718 | Bacteria | 653 |
| 64 | Ga0068861_100064577 | 3300005719 | Bacteria | 2817 |
| 65 | Ga0068861_100629007 | 3300005719 | Bacteria | 989 |
| 66 | Ga0068861_100946156 | 3300005719 | Bacteria | 819 |
| 67 | Ga0068851_10063301 | 3300005834 | Bacteria | 1899 |
| 68 | Ga0068858_100000132 | 3300005842 | Bacteria | 77767 |
| 69 | Ga0068858_100000444 | 3300005842 | Bacteria | 43311 |
| 70 | Ga0068860_100000609 | 3300005843 | Bacteria | 42459 |
| 71 | Ga0068862_100000099 | 3300005844 | Bacteria | 103870 |
| 72 | Ga0068862_100072957 | 3300005844 | Bacteria | 2966 |
| 73 | Ga0081539_10013701 | 3300005985 | Bacteria | 6089 |
| 74 | Ga0075369_10072999 | 3300006186 | Bacteria | 1512 |
| 75 | Ga0075366_10176640 | 3300006195 | Bacteria | 1297 |
| 76 | Ga0075366_10894901 | 3300006195 | Bacteria | 553 |
| 77 | Ga0097621_100006422 | 3300006237 | Bacteria | 8343 |
| 78 | Ga0097621_100490206 | 3300006237 | Bacteria | 1112 |
| 79 | Ga0075370_10476015 | 3300006353 | Bacteria | 752 |
| 80 | Ga0075431_100010549 | 3300006847 | Bacteria | 9288 |
| 81 | Ga0068865_100000027 | 3300006881 | Bacteria | 92272 |
| 82 | Ga0068865_100249923 | 3300006881 | Bacteria | 1399 |
| 83 | Ga0068865_101254145 | 3300006881 | Bacteria | 658 |
| 84 | Ga0097620_101903712 | 3300006931 | Bacteria | 657 |
| 85 | Ga0097620_102067556 | 3300006931 | Bacteria | 629 |
| 86 | Ga0079104_1030151 | 3300006946 | Bacteria | 1358 |
| 87 | Ga0099826_10228384 | 3300006948 | Bacteria | 996 |
| 88 | Ga0105240_11197338 | 3300009093 | Bacteria | 804 |
| 89 | Ga0105245_10001310 | 3300009098 | Bacteria | 22494 |
| 90 | Ga0105245_10056870 | 3300009098 | Bacteria | 3517 |
| 91 | Ga0105243_10000180 | 3300009148 | Bacteria | 73474 |
| 92 | Ga0105243_10005280 | 3300009148 | Bacteria | 10102 |
| 93 | Ga0105243_10539296 | 3300009148 | Bacteria | 1113 |
| 94 | Ga0105241_10000907 | 3300009174 | Bacteria | 22391 |
| 95 | Ga0105242_10000077 | 3300009176 | Bacteria | 67726 |
| 96 | Ga0105242_10425974 | 3300009176 | Bacteria | 1245 |
| 97 | Ga0105242_10752239 | 3300009176 | Bacteria | 959 |
| 98 | Ga0105248_10025301 | 3300009177 | Bacteria | 6599 |
| 99 | Ga0105237_10534776 | 3300009545 | Bacteria | 1179 |
| 100 | Ga0105237_11852732 | 3300009545 | Bacteria | 611 |
| 101 | Ga0105238_10004794 | 3300009551 | Bacteria | 13382 |
| 102 | Ga0105238_11558392 | 3300009551 | Bacteria | 690 |
| 103 | Ga0105238_12411713 | 3300009551 | Bacteria | 562 |
| 104 | Ga0105249_10000086 | 3300009553 | Bacteria | 132132 |
| 105 | Ga0105249_10096242 | 3300009553 | Bacteria | 2777 |
| 106 | Ga0105239_13473448 | 3300010375 | Bacteria | 512 |
| 107 | Ga0105246_10000574 | 3300011119 | Bacteria | 20388 |
| 108 | Ga0105246_10096827 | 3300011119 | Bacteria | 2140 |
| 109 | Ga0157326_1004728 | 3300012513 | Bacteria | 1435 |
| 110 | Ga0157373_10354274 | 3300013100 | Bacteria | 1047 |
| 111 | Ga0157373_11495325 | 3300013100 | Bacteria | 515 |
| 112 | Ga0157371_10000110 | 3300013102 | Bacteria | 124933 |
| 113 | Ga0157370_10003802 | 3300013104 | Bacteria | 17612 |
| 114 | Ga0157369_10002615 | 3300013105 | Bacteria | 21530 |
| 115 | Ga0157369_10011999 | 3300013105 | Bacteria | 9842 |
| 116 | Ga0157369_10068183 | 3300013105 | Bacteria | 3822 |
| 117 | Ga0157369_10072392 | 3300013105 | Bacteria | 3699 |
| 118 | Ga0157369_10195837 | 3300013105 | Bacteria | 2122 |
| 119 | Ga0157374_10105445 | 3300013296 | Bacteria | 2707 |
| 120 | Ga0157374_10193655 | 3300013296 | Bacteria | 1989 |
| 121 | Ga0157378_10205471 | 3300013297 | Bacteria | 1865 |
| 122 | Ga0157378_11577523 | 3300013297 | Bacteria | 702 |
| 123 | Ga0157378_12544954 | 3300013297 | Bacteria | 564 |
| 124 | Ga0163162_10004623 | 3300013306 | Bacteria | 13265 |
| 125 | Ga0163162_10100249 | 3300013306 | Bacteria | 2987 |
| 126 | Ga0163162_10654148 | 3300013306 | Bacteria | 1174 |
| 127 | Ga0157372_10138582 | 3300013307 | Bacteria | 2802 |
| 128 | Ga0157372_11453519 | 3300013307 | Bacteria | 790 |
| 129 | Ga0157375_10000592 | 3300013308 | Bacteria | 32209 |
| 130 | Ga0157375_10955487 | 3300013308 | Bacteria | 998 |
| 131 | Ga0157375_12928403 | 3300013308 | Bacteria | 570 |
| 132 | Ga0163163_10251054 | 3300014325 | Bacteria | 1819 |
| 133 | Ga0157380_10778532 | 3300014326 | Bacteria | 971 |
| 134 | Ga0157377_10139434 | 3300014745 | Bacteria | 1489 |
| 135 | Ga0157376_10000095 | 3300014969 | Bacteria | 66245 |
| 136 | Ga0157376_10956912 | 3300014969 | Bacteria | 877 |
| 137 | Ga0163161_12024976 | 3300017792 | Bacteria | 512 |
| 138 | Ga0206352_10570229 | 3300020078 | Bacteria | 754 |
| 139 | Ga0206354_10898498 | 3300020081 | Bacteria | 584 |
| 140 | Ga0209674_105616 | 3300025226 | Bacteria | 1820 |
| 141 | Ga0209563_100081 | 3300025230 | Bacteria | 199455 |
| 142 | Ga0209437_115646 | 3300025233 | Bacteria | 1032 |
| 143 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 144 | Ga0209677_112052 | 3300025253 | Bacteria | 1305 |
| 145 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 146 | Ga0209129_1001474 | 3300025258 | Bacteria | 13094 |
| 147 | Ga0209233_1000107 | 3300025261 | Bacteria | 267399 |
| 148 | Ga0209565_1000209 | 3300025263 | Bacteria | 68237 |
| 149 | Ga0209565_1028334 | 3300025263 | Bacteria | 1108 |
| 150 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 151 | Ga0209455_1042853 | 3300025272 | Bacteria | 677 |
| 152 | Ga0209673_1045003 | 3300025273 | Bacteria | 1217 |
| 153 | Ga0209676_1002244 | 3300025292 | Bacteria | 14280 |
| 154 | Ga0209676_1036522 | 3300025292 | Bacteria | 1429 |
| 155 | Ga0209025_1000128 | 3300025294 | Bacteria | 198859 |
| 156 | Ga0209564_1001366 | 3300025295 | Bacteria | 25610 |
| 157 | Ga0209564_1001949 | 3300025295 | Bacteria | 18260 |
| 158 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 159 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 160 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 161 | Ga0209050_1000209 | 3300025298 | Bacteria | 130884 |
| 162 | Ga0209050_1000707 | 3300025298 | Bacteria | 49453 |
| 163 | Ga0209050_1025544 | 3300025298 | Bacteria | 2003 |
| 164 | Ga0209050_1043346 | 3300025298 | Bacteria | 1217 |
| 165 | Ga0207426_1089187 | 3300025302 | Bacteria | 820 |
| 166 | Ga0207426_1150361 | 3300025302 | Bacteria | 543 |
| 167 | Ga0209051_1000357 | 3300025303 | Bacteria | 67596 |
| 168 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 169 | Ga0209257_1000500 | 3300025304 | Bacteria | 70060 |
| 170 | Ga0209257_1001749 | 3300025304 | Bacteria | 24096 |
| 171 | Ga0209257_1151865 | 3300025304 | Bacteria | 509 |
| 172 | Ga0207697_10006787 | 3300025315 | Bacteria | 5147 |
| 173 | Ga0207682_10032446 | 3300025893 | Bacteria | 2099 |
| 174 | Ga0207642_10006614 | 3300025899 | Bacteria | 3866 |
| 175 | Ga0207710_10011316 | 3300025900 | Bacteria | 3757 |
| 176 | Ga0207688_10077892 | 3300025901 | Bacteria | 1889 |
| 177 | Ga0207688_10099326 | 3300025901 | Bacteria | 1679 |
| 178 | Ga0207647_10009889 | 3300025904 | Bacteria | 6755 |
| 179 | Ga0207645_10021501 | 3300025907 | Bacteria | 4207 |
| 180 | Ga0207645_10025902 | 3300025907 | Bacteria | 3793 |
| 181 | Ga0207645_10497149 | 3300025907 | Bacteria | 825 |
| 182 | Ga0207705_10000134 | 3300025909 | Bacteria | 79513 |
| 183 | Ga0207705_10012187 | 3300025909 | Bacteria | 6214 |
| 184 | Ga0207654_10001172 | 3300025911 | Bacteria | 14044 |
| 185 | Ga0207707_10613039 | 3300025912 | Bacteria | 920 |
| 186 | Ga0207695_10167048 | 3300025913 | Bacteria | 2128 |
| 187 | Ga0207695_10745589 | 3300025913 | Bacteria | 860 |
| 188 | Ga0207671_10427955 | 3300025914 | Bacteria | 1053 |
| 189 | Ga0207671_10651610 | 3300025914 | Bacteria | 839 |
| 190 | Ga0207657_10008611 | 3300025919 | Bacteria | 10327 |
| 191 | Ga0207657_10083546 | 3300025919 | Bacteria | 2679 |
| 192 | Ga0207657_10153615 | 3300025919 | Bacteria | 1873 |
| 193 | Ga0207657_11192695 | 3300025919 | Bacteria | 579 |
| 194 | Ga0207649_10000089 | 3300025920 | Bacteria | 76923 |
| 195 | Ga0207649_10000414 | 3300025920 | Bacteria | 31530 |
| 196 | Ga0207649_10846086 | 3300025920 | Bacteria | 716 |
| 197 | Ga0207649_10850174 | 3300025920 | Bacteria | 714 |
| 198 | Ga0207652_10452874 | 3300025921 | Bacteria | 1157 |
| 199 | Ga0207681_10084245 | 3300025923 | Bacteria | 2253 |
| 200 | Ga0207681_10193887 | 3300025923 | Bacteria | 1556 |
| 201 | Ga0207681_10587776 | 3300025923 | Bacteria | 919 |
| 202 | Ga0207694_10066351 | 3300025924 | Bacteria | 2816 |
| 203 | Ga0207694_10067907 | 3300025924 | Bacteria | 2783 |
| 204 | Ga0207694_11760294 | 3300025924 | Unclassified | 521 |
| 205 | Ga0207650_10501443 | 3300025925 | Bacteria | 1014 |
| 206 | Ga0207659_10188659 | 3300025926 | Bacteria | 1639 |
| 207 | Ga0207687_10000473 | 3300025927 | Bacteria | 27414 |
| 208 | Ga0207687_10804590 | 3300025927 | Bacteria | 802 |
| 209 | Ga0207644_10019894 | 3300025931 | Bacteria | 4559 |
| 210 | Ga0207644_11217773 | 3300025931 | Bacteria | 633 |
| 211 | Ga0207690_10048111 | 3300025932 | Bacteria | 2833 |
| 212 | Ga0207690_10117210 | 3300025932 | Bacteria | 1927 |
| 213 | Ga0207706_10273877 | 3300025933 | Bacteria | 1473 |
| 214 | Ga0207706_11408610 | 3300025933 | Bacteria | 572 |
| 215 | Ga0207686_10000866 | 3300025934 | Bacteria | 18334 |
| 216 | Ga0207686_10339556 | 3300025934 | Bacteria | 1128 |
| 217 | Ga0207709_10000146 | 3300025935 | Bacteria | 98521 |
| 218 | Ga0207709_10000260 | 3300025935 | Bacteria | 62960 |
| 219 | Ga0207709_10673394 | 3300025935 | Bacteria | 826 |
| 220 | Ga0207669_10000471 | 3300025937 | Bacteria | 17580 |
| 221 | Ga0207669_10004566 | 3300025937 | Bacteria | 6105 |
| 222 | Ga0207669_10611901 | 3300025937 | Bacteria | 887 |
| 223 | Ga0207669_11590006 | 3300025937 | Bacteria | 558 |
| 224 | Ga0207704_10000064 | 3300025938 | Bacteria | 73788 |
| 225 | Ga0207704_10481232 | 3300025938 | Bacteria | 997 |
| 226 | Ga0207704_10484152 | 3300025938 | Bacteria | 994 |
| 227 | Ga0207691_10109741 | 3300025940 | Bacteria | 2455 |
| 228 | Ga0207691_10686762 | 3300025940 | Bacteria | 864 |
| 229 | Ga0207711_10003598 | 3300025941 | Bacteria | 13403 |
| 230 | Ga0207689_10075643 | 3300025942 | Bacteria | 2768 |
| 231 | Ga0207661_10238179 | 3300025944 | Bacteria | 1614 |
| 232 | Ga0207679_10194739 | 3300025945 | Bacteria | 1688 |
| 233 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 234 | Ga0207667_10253459 | 3300025949 | Bacteria | 1800 |
| 235 | Ga0207667_10575854 | 3300025949 | Bacteria | 1137 |
| 236 | Ga0207651_10000010 | 3300025960 | Bacteria | 193754 |
| 237 | Ga0207651_10148137 | 3300025960 | Bacteria | 1823 |
| 238 | Ga0207651_11795357 | 3300025960 | Bacteria | 552 |
| 239 | Ga0207712_10000026 | 3300025961 | Bacteria | 271237 |
| 240 | Ga0207712_10404478 | 3300025961 | Bacteria | 1148 |
| 241 | Ga0207668_10319978 | 3300025972 | Bacteria | 1287 |
| 242 | Ga0207668_11958273 | 3300025972 | Bacteria | 528 |
| 243 | Ga0207640_10020478 | 3300025981 | Bacteria | 3928 |
| 244 | Ga0207640_10181970 | 3300025981 | Bacteria | 1577 |
| 245 | Ga0207640_10282770 | 3300025981 | Bacteria | 1304 |
| 246 | Ga0207658_10036194 | 3300025986 | Bacteria | 3539 |
| 247 | Ga0207658_11208960 | 3300025986 | Bacteria | 691 |
| 248 | Ga0207658_11832610 | 3300025986 | Bacteria | 553 |
| 249 | Ga0207677_10000021 | 3300026023 | Bacteria | 131828 |
| 250 | Ga0207677_10038594 | 3300026023 | Bacteria | 3133 |
| 251 | Ga0207677_10891942 | 3300026023 | Bacteria | 801 |
| 252 | Ga0207703_10000753 | 3300026035 | Bacteria | 31952 |
| 253 | Ga0207703_10002023 | 3300026035 | Bacteria | 17904 |
| 254 | Ga0207639_10116714 | 3300026041 | Bacteria | 2186 |
| 255 | Ga0207639_10279386 | 3300026041 | Bacteria | 1468 |
| 256 | Ga0207678_10065835 | 3300026067 | Bacteria | 3111 |
| 257 | Ga0207702_10003541 | 3300026078 | Bacteria | 14213 |
| 258 | Ga0207702_10090193 | 3300026078 | Bacteria | 2682 |
| 259 | Ga0207641_10001678 | 3300026088 | Bacteria | 21545 |
| 260 | Ga0207648_10000162 | 3300026089 | Bacteria | 68397 |
| 261 | Ga0207648_10089296 | 3300026089 | Bacteria | 2692 |
| 262 | Ga0207676_10010587 | 3300026095 | Bacteria | 6573 |
| 263 | Ga0207676_10422930 | 3300026095 | Bacteria | 1250 |
| 264 | Ga0207674_10644949 | 3300026116 | Bacteria | 1023 |
| 265 | Ga0207675_100655745 | 3300026118 | Bacteria | 1056 |
| 266 | Ga0207683_10001627 | 3300026121 | Bacteria | 20148 |
| 267 | Ga0207683_11393537 | 3300026121 | Bacteria | 648 |
| 268 | Ga0207698_10013588 | 3300026142 | Bacteria | 5379 |
| 269 | Ga0207698_10027213 | 3300026142 | Bacteria | 4056 |
| 270 | Ga0209281_1045307 | 3300027111 | Bacteria | 721 |
| 271 | Ga0268266_10000036 | 3300028379 | Bacteria | 348910 |
| 272 | Ga0268265_10000084 | 3300028380 | Bacteria | 119522 |
| 273 | Ga0268265_10278161 | 3300028380 | Bacteria | 1496 |
| 274 | Ga0268264_10001419 | 3300028381 | Bacteria | 22422 |
| 275 | Ga0307517_10136482 | 3300028786 | Bacteria | 1742 |
| 276 | Ga0307515_10228749 | 3300028794 | Bacteria | 1658 |
| 277 | Ga0314311_1099328 | 3300030733 | Bacteria | 885 |
| 278 | Ga0316182_1124187 | 3300030745 | Bacteria | 1061 |
| 279 | Ga0307513_10019526 | 3300031456 | Bacteria | 8067 |
| 280 | Ga0307513_10079752 | 3300031456 | Bacteria | 3380 |
| 281 | Ga0307513_10229349 | 3300031456 | Bacteria | 1670 |
| 282 | Ga0307513_10365332 | 3300031456 | Bacteria | 1187 |
| 283 | Ga0307513_11060938 | 3300031456 | Bacteria | 521 |
| 284 | Ga0307509_10260747 | 3300031507 | Bacteria | 1509 |
| 285 | Ga0307412_10039619 | 3300031911 | Bacteria | 3043 |
| 286 | Ga0307409_102173821 | 3300031995 | Bacteria | 584 |
| 287 | Ga0307510_10170867 | 3300033180 | Bacteria | 1753 |
| 288 | Ga0307510_10413711 | 3300033180 | Bacteria | 791 |
| 289 | Ga0307510_10627161 | 3300033180 | Bacteria | 530 |
| 290 | Ga0395905_0128047 | 3300037471 | Bacteria | 2388 |
| 291 | Ga0395905_0160733 | 3300037471 | Bacteria | 2111 |
| 292 | Ga0395905_1420015 | 3300037471 | Bacteria | 598 |
| 293 | Ga0395901_0178992 | 3300038443 | Bacteria | 2224 |
| 294 | Ga0237819_04423 | 3300038705 | Bacteria | 2312 |
| 295 | Ga0439436_0057103 | 3300041404 | Bacteria | 1095 |
| 296 | Ga0439453_0048333 | 3300041408 | Bacteria | 853 |
| 297 | Ga0439461_0055320 | 3300041410 | Bacteria | 889 |
| 298 | Ga0439465_0001974 | 3300041413 | Bacteria | 6736 |
| 299 | Ga0451789_1031900 | 3300041443 | Bacteria | 511 |
| 300 | Ga0451793_0275676 | 3300041452 | Bacteria | 633 |
| 301 | Ga0451795_0663129 | 3300041456 | Bacteria | 580 |
| 302 | Ga0451795_1567016 | 3300041456 | Bacteria | 1120 |
| 303 | Ga0451800_0880592 | 3300041459 | Bacteria | 751 |
| 304 | Ga0451802_0368878 | 3300041460 | Bacteria | 574 |
| 305 | Ga0451807_1098360 | 3300041486 | Bacteria | 653 |
| 306 | Ga0451807_1941827 | 3300041486 | Bacteria | 541 |
| 307 | Ga0451833_1268577 | 3300041491 | Bacteria | 694 |
| 308 | Ga0451837_0747534 | 3300041494 | Bacteria | 988 |
| 309 | Ga0451837_0971247 | 3300041494 | Bacteria | 533 |
| 310 | Ga0451853_1281590 | 3300041512 | Bacteria | 791 |
| 311 | Ga0439431_0026860 | 3300041997 | Bacteria | 1412 |
| 312 | Ga0439431_0040883 | 3300041997 | Bacteria | 1180 |
| 313 | Ga0439445_0032388 | 3300042004 | Bacteria | 1362 |
| 314 | Ga0439445_0080333 | 3300042004 | Bacteria | 910 |
| 315 | Ga0439448_0015231 | 3300042005 | Bacteria | 2327 |
| 316 | Ga0439432_066404 | 3300042006 | Bacteria | 1105 |
| 317 | Ga0439457_010366 | 3300042014 | Bacteria | 2143 |
| 318 | Ga0439462_0042284 | 3300042015 | Bacteria | 1217 |
| 319 | Ga0450898_144764 | 3300042134 | Bacteria | 517 |
| 320 | Ga0439446_0027649 | 3300042156 | Bacteria | 1629 |
| 321 | Ga0439435_0100285 | 3300042436 | Bacteria | 889 |
| 322 | Ga0466961_0824109 | 3300044693 | Bacteria | 554 |
| 323 | Ga0466963_0142077 | 3300044694 | Bacteria | 1663 |
| 324 | Ga0466963_0149990 | 3300044694 | Bacteria | 1618 |
| 325 | Ga0466970_0928260 | 3300044765 | Bacteria | 512 |
| 326 | Ga0466957_0684886 | 3300044842 | Bacteria | 723 |
| 327 | Ga0466958_0342785 | 3300045836 | Bacteria | 961 |
| 328 | Ga0495617_046761 | 3300046452 | Bacteria | 1442 |
| 329 | Ga0495627_098059 | 3300046453 | Bacteria | 838 |
| 330 | Ga0495592_0484158 | 3300046454 | Bacteria | 770 |
| 331 | Ga0495590_0192028 | 3300046457 | Bacteria | 748 |
| 332 | Ga0495590_0287382 | 3300046457 | Bacteria | 617 |
| 333 | Ga0495629_0380929 | 3300046459 | Bacteria | 960 |
| 334 | Ga0495638_0099733 | 3300046460 | Bacteria | 1738 |
| 335 | Ga0495638_0164127 | 3300046460 | Bacteria | 1279 |
| 336 | Ga0495650_0000428 | 3300046471 | Bacteria | 68082 |
| 337 | Ga0495650_0172073 | 3300046471 | Bacteria | 766 |
| 338 | Ga0495639_0723341 | 3300046475 | Bacteria | 515 |
| 339 | Ga0495584_0078586 | 3300046491 | Bacteria | 1660 |
| 340 | Ga0495585_0079003 | 3300046492 | Bacteria | 1784 |
| 341 | Ga0495585_0349563 | 3300046492 | Bacteria | 718 |
| 342 | Ga0495585_0459880 | 3300046492 | Bacteria | 608 |
| 343 | Ga0495596_0053596 | 3300046500 | Bacteria | 1578 |
| 344 | Ga0495607_0337110 | 3300046501 | Bacteria | 699 |
| 345 | Ga0495583_0000613 | 3300046506 | Bacteria | 48224 |
| 346 | Ga0495583_0005390 | 3300046506 | Bacteria | 8705 |
| 347 | Ga0495583_0009190 | 3300046506 | Bacteria | 5935 |
| 348 | Ga0495583_0032197 | 3300046506 | Bacteria | 2532 |
| 349 | Ga0495583_0056784 | 3300046506 | Bacteria | 1763 |
| 350 | Ga0495583_0105060 | 3300046506 | Bacteria | 1202 |
| 351 | Ga0495606_0000534 | 3300046507 | Bacteria | 61311 |
| 352 | Ga0495606_0052289 | 3300046507 | Bacteria | 2657 |
| 353 | Ga0495606_0101561 | 3300046507 | Bacteria | 1750 |
| 354 | Ga0495616_0021403 | 3300046513 | Bacteria | 3502 |
| 355 | Ga0495616_0236207 | 3300046513 | Bacteria | 790 |
| 356 | Ga0495631_0026437 | 3300046518 | Bacteria | 2665 |
| 357 | Ga0495631_0034307 | 3300046518 | Bacteria | 2275 |
| 358 | Ga0495631_0143195 | 3300046518 | Bacteria | 1026 |
| 359 | Ga0495632_0095055 | 3300046519 | Bacteria | 1409 |
| 360 | Ga0495637_0044255 | 3300046520 | Bacteria | 1896 |
| 361 | Ga0495643_0008262 | 3300046522 | Bacteria | 6607 |
| 362 | Ga0495643_0009124 | 3300046522 | Bacteria | 6205 |
| 363 | Ga0495643_0058809 | 3300046522 | Bacteria | 2044 |
| 364 | Ga0495643_0177901 | 3300046522 | Bacteria | 1036 |
| 365 | Ga0495643_0228141 | 3300046522 | Bacteria | 879 |
| 366 | Ga0495643_0416185 | 3300046522 | Bacteria | 590 |
| 367 | Ga0495648_0000376 | 3300046524 | Bacteria | 48867 |
| 368 | Ga0495648_0021934 | 3300046524 | Bacteria | 4411 |
| 369 | Ga0495663_0001141 | 3300046525 | Bacteria | 8568 |
| 370 | Ga0495663_0022362 | 3300046525 | Bacteria | 1826 |
| 371 | Ga0495663_0083837 | 3300046525 | Bacteria | 1030 |
| 372 | Ga0495642_0004270 | 3300046528 | Bacteria | 5555 |
| 373 | Ga0495652_0297347 | 3300046529 | Bacteria | 1175 |
| 374 | Ga0495587_0515661 | 3300046536 | Bacteria | 660 |
| 375 | Ga0495609_0107855 | 3300046538 | Bacteria | 1203 |
| 376 | Ga0495597_0105048 | 3300046542 | Bacteria | 1188 |
| 377 | Ga0495597_0139519 | 3300046542 | Bacteria | 1000 |
| 378 | Ga0495633_0003594 | 3300046558 | Bacteria | 10261 |
| 379 | Ga0495633_0064702 | 3300046558 | Bacteria | 1709 |
| 380 | Ga0495668_0000431 | 3300046616 | Bacteria | 54273 |
| 381 | Ga0495668_0012280 | 3300046616 | Bacteria | 5083 |
| 382 | Ga0495668_0125008 | 3300046616 | Bacteria | 1407 |
| 383 | Ga0495611_0011300 | 3300046648 | Bacteria | 3785 |
| 384 | Ga0495611_0130843 | 3300046648 | Bacteria | 1170 |
| 385 | Ga0495625_0000584 | 3300046660 | Bacteria | 52916 |
| 386 | Ga0495625_0000665 | 3300046660 | Bacteria | 48983 |
| 387 | Ga0495625_0013211 | 3300046660 | Bacteria | 6648 |
| 388 | Ga0495625_0041334 | 3300046660 | Bacteria | 3357 |
| 389 | Ga0495625_0052191 | 3300046660 | Bacteria | 2928 |
| 390 | Ga0495625_0058149 | 3300046660 | Bacteria | 2748 |
| 391 | Ga0495625_0085805 | 3300046660 | Bacteria | 2184 |
| 392 | Ga0495669_0000129 | 3300046684 | Bacteria | 48558 |
| 393 | Ga0495670_0020544 | 3300046691 | Bacteria | 3257 |
| 394 | Ga0495670_0351891 | 3300046691 | Bacteria | 793 |
| 395 | Ga0495649_0015398 | 3300046694 | Bacteria | 4354 |
| 396 | Ga0495649_0037865 | 3300046694 | Bacteria | 2647 |
| 397 | Ga0495649_0121335 | 3300046694 | Bacteria | 1382 |
| 398 | Ga0495649_0174633 | 3300046694 | Bacteria | 1123 |
| 399 | Ga0495649_0232460 | 3300046694 | Bacteria | 951 |
| 400 | Ga0495600_0003850 | 3300046809 | Bacteria | 8899 |
| 401 | Ga0495660_0063157 | 3300046810 | Bacteria | 1984 |
| 402 | Ga0495660_0114631 | 3300046810 | Bacteria | 1371 |
| 403 | Ga0495660_0130232 | 3300046810 | Bacteria | 1263 |
| 404 | Ga0495683_0003096 | 3300047323 | Bacteria | 9749 |
| 405 | Ga0495683_0009719 | 3300047323 | Bacteria | 5114 |
| 406 | Ga0495687_000109 | 3300047443 | Bacteria | 125648 |
| 407 | Ga0495687_001290 | 3300047443 | Bacteria | 23529 |
| 408 | Ga0495677_0012314 | 3300047445 | Bacteria | 3120 |
| 409 | Ga0495677_0037301 | 3300047445 | Bacteria | 1775 |
| 410 | Ga0495677_0348990 | 3300047445 | Bacteria | 584 |
| 411 | Ga0495673_0090439 | 3300047469 | Bacteria | 1252 |
| 412 | Ga0495681_0004372 | 3300047470 | Bacteria | 9652 |
| 413 | Ga0495681_0007127 | 3300047470 | Bacteria | 7204 |
| 414 | Ga0495686_0241368 | 3300047472 | Bacteria | 1019 |
| 415 | Ga0495686_0249059 | 3300047472 | Bacteria | 999 |
| 416 | Ga0496100_0125239 | 3300048903 | Bacteria | 1803 |
| 417 | Ga0496101_0331075 | 3300048904 | Bacteria | 1195 |
| 418 | Ga0496102_0000329 | 3300048905 | Bacteria | 59006 |
| 419 | Ga0496103_0000164 | 3300048906 | Bacteria | 70089 |
| 420 | Ga0496104_0030228 | 3300048907 | Bacteria | 5032 |
| 421 | Ga0496105_0002044 | 3300048908 | Bacteria | 14589 |
| 422 | Ga0496107_0353499 | 3300048910 | Bacteria | 1093 |
| 423 | Ga0496107_0439489 | 3300048910 | Bacteria | 970 |
| 424 | Ga0496110_0007556 | 3300048913 | Bacteria | 8682 |
| 425 | Ga0496111_0004277 | 3300048914 | Bacteria | 8997 |
| 426 | Ga0496113_0010663 | 3300048916 | Bacteria | 6086 |
| 427 | Ga0496114_0012260 | 3300048917 | Bacteria | 6860 |
| 428 | Ga0496115_0000174 | 3300048918 | Bacteria | 59745 |
| 429 | Ga0496115_0016397 | 3300048918 | Bacteria | 5642 |
| 430 | Ga0496116_0002115 | 3300048919 | Bacteria | 21160 |
| 431 | Ga0496117_0000432 | 3300048920 | Bacteria | 69975 |
| 432 | Ga0496118_0000127 | 3300048921 | Bacteria | 135377 |
| 433 | Ga0496119_0045957 | 3300048922 | Bacteria | 2731 |
| 434 | Ga0496120_0011068 | 3300048923 | Bacteria | 6226 |
| 435 | Ga0496121_0000335 | 3300048924 | Bacteria | 98310 |
| 436 | Ga0496121_0001019 | 3300048924 | Bacteria | 49980 |
| 437 | Ga0496121_0223986 | 3300048924 | Bacteria | 1322 |
| 438 | Ga0496122_0034395 | 3300048925 | Bacteria | 4147 |
| 439 | Ga0496123_0075326 | 3300048926 | Bacteria | 2083 |
| 440 | Ga0496124_0000011 | 3300048927 | Bacteria | 524145 |
| 441 | Ga0496125_0000426 | 3300048928 | Bacteria | 78122 |
| 442 | Ga0496126_0004692 | 3300048929 | Bacteria | 16145 |
| 443 | Ga0495682_0253451 | 3300049460 | Bacteria | 622 |
| 444 | Ga0501038_0547007 | 3300049574 | Bacteria | 881 |
| 445 | Ga0501047_0310469 | 3300049581 | Bacteria | 1418 |
| 446 | Ga0501044_0750714 | 3300049823 | Bacteria | 858 |
| 447 | nmdc:mga0k408_122446_c1 | 3300050493 | Bacteria | 1541 |
| 448 | nmdc:mga0k408_284239_c1 | 3300050493 | Bacteria | 987 |
| 449 | nmdc:mga0sz30_443277_c1 | 3300050516 | Bacteria | 583 |
| 450 | Ga0500610_0000099 | 3300053079 | Bacteria | 25819 |
| 451 | Ga0500643_001568 | 3300053087 | Bacteria | 12941 |
| 452 | Ga0500643_001747 | 3300053087 | Bacteria | 12029 |
| 453 | Ga0500643_010010 | 3300053087 | Bacteria | 3571 |
| 454 | Ga0500643_043196 | 3300053087 | Bacteria | 1315 |
| 455 | Ga0500646_0365896 | 3300053090 | Bacteria | 528 |
| 456 | Ga0500566_0005221 | 3300053094 | Bacteria | 7733 |
| 457 | Ga0500641_0019080 | 3300053096 | Bacteria | 2589 |
| 458 | Ga0500555_085882 | 3300053103 | Bacteria | 814 |
| 459 | Ga0500562_019273 | 3300053108 | Bacteria | 1765 |
| 460 | Ga0500562_213578 | 3300053108 | Bacteria | 522 |
| 461 | Ga0500594_0130655 | 3300053118 | Bacteria | 795 |
| 462 | Ga0500595_001055 | 3300053119 | Bacteria | 15345 |
| 463 | Ga0500595_006368 | 3300053119 | Bacteria | 5015 |
| 464 | Ga0500595_024955 | 3300053119 | Bacteria | 2080 |
| 465 | Ga0500595_128730 | 3300053119 | Bacteria | 713 |
| 466 | Ga0500607_082901 | 3300053121 | Bacteria | 1631 |
| 467 | Ga0500642_0000631 | 3300053130 | Bacteria | 10533 |
| 468 | Ga0500559_0090613 | 3300053136 | Bacteria | 1399 |
| 469 | Ga0500559_0165868 | 3300053136 | Bacteria | 1038 |
| 470 | Ga0500559_0209898 | 3300053136 | Bacteria | 918 |
| 471 | Ga0500559_0283820 | 3300053136 | Bacteria | 778 |
| 472 | Ga0500559_0356815 | 3300053136 | Bacteria | 683 |
| 473 | Ga0500568_0024253 | 3300053139 | Bacteria | 2570 |
| 474 | Ga0500585_208010 | 3300053144 | Bacteria | 647 |
| 475 | Ga0500604_0242326 | 3300053151 | Bacteria | 623 |
| 476 | Ga0500616_0074160 | 3300053153 | Bacteria | 1725 |
| 477 | Ga0500619_008673 | 3300053154 | Bacteria | 2483 |
| 478 | Ga0500636_0002160 | 3300053177 | Bacteria | 10856 |
| 479 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 480 | Ga0500609_047683 | 3300053731 | Bacteria | 594 |
| 481 | Ga0500661_108376 | 3300055283 | Bacteria | 531 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005535 | Ga0070684_100994973 | Ga0070684_1009949732 | 64 |
| 2 | 3300005614 | Ga0068856_100364594 | Ga0068856_1003645942 | 64 |
| 3 | 3300006847 | Ga0075431_100010549 | Ga0075431_1000105499 | 64 |
| 4 | 3300013100 | Ga0157373_11495325 | Ga0157373_114953252 | 64 |
| 5 | 3300013105 | Ga0157369_10072392 | Ga0157369_100723923 | 64 |
| 6 | 3300005617 | Ga0068859_102068246 | Ga0068859_1020682462 | 65 |
| 7 | 3300006931 | Ga0097620_102067556 | Ga0097620_1020675562 | 65 |
| 8 | 3300025912 | Ga0207707_10613039 | Ga0207707_106130392 | 65 |
| 9 | 3300025924 | Ga0207694_11760294 | Ga0207694_117602942 | 65 |
| 10 | 3300037471 | Ga0395905_1420015 | Ga0395905_1420015_89_289 | 65 |
| 11 | 3300044694 | Ga0466963_0142077 | Ga0466963_0142077_122_322 | 65 |
| 12 | 3300044842 | Ga0466957_0684886 | Ga0466957_0684886_179_379 | 65 |
| 13 | iso_pu_bacteria | 2599185354 | 2600203425 | 65 |
| 14 | iso_pu_bacteria | 2643221622 | 2644128069 | 65 |
| 15 | iso_pu_bacteria | 2751185897 | 2753765772 | 65 |
| 16 | 3300003214 | JGI25165J46597_1000065 | JGI25165J46597_100006537 | 66 |
| 17 | 3300005578 | Ga0068854_101846679 | Ga0068854_1018466792 | 66 |
| 18 | 3300005614 | Ga0068856_100137196 | Ga0068856_1001371964 | 66 |
| 19 | 3300006881 | Ga0068865_101254145 | Ga0068865_1012541452 | 66 |
| 20 | 3300009545 | Ga0105237_10534776 | Ga0105237_105347763 | 66 |
| 21 | 3300009551 | Ga0105238_10004794 | Ga0105238_100047944 | 66 |
| 22 | 3300013105 | Ga0157369_10002615 | Ga0157369_100026157 | 66 |
| 23 | 3300025233 | Ga0209437_115646 | Ga0209437_1156462 | 66 |
| 24 | 3300025261 | Ga0209233_1000107 | Ga0209233_1000107171 | 66 |
| 25 | 3300025909 | Ga0207705_10012187 | Ga0207705_100121875 | 66 |
| 26 | 3300025914 | Ga0207671_10427955 | Ga0207671_104279552 | 66 |
| 27 | 3300025919 | Ga0207657_11192695 | Ga0207657_111926952 | 66 |
| 28 | 3300025920 | Ga0207649_10850174 | Ga0207649_108501741 | 66 |
| 29 | 3300025924 | Ga0207694_10066351 | Ga0207694_100663513 | 66 |
| 30 | 3300025938 | Ga0207704_10484152 | Ga0207704_104841523 | 66 |
| 31 | 3300025981 | Ga0207640_10181970 | Ga0207640_101819703 | 66 |
| 32 | 3300026041 | Ga0207639_10279386 | Ga0207639_102793862 | 66 |
| 33 | 3300026078 | Ga0207702_10090193 | Ga0207702_100901932 | 66 |
| 34 | 3300026116 | Ga0207674_10644949 | Ga0207674_106449492 | 66 |
| 35 | 3300026142 | Ga0207698_10013588 | Ga0207698_100135884 | 66 |
| 36 | 3300031456 | Ga0307513_10365332 | Ga0307513_103653322 | 66 |
| 37 | 3300037471 | Ga0395905_0128047 | Ga0395905_0128047_1894_2097 | 66 |
| 38 | 3300041460 | Ga0451802_0368878 | Ga0451802_0368878_305_505 | 66 |
| 39 | 3300042134 | Ga0450898_144764 | Ga0450898_144764_244_447 | 66 |
| 40 | iso_pu_bacteria | 2879163058 | 2879165441 | 66 |
| 41 | 3300003791 | Ga0055530_10000845 | Ga0055530_1000084525 | 67 |
| 42 | 3300003794 | Ga0055531_10000073 | Ga0055531_10000073113 | 67 |
| 43 | 3300005262 | Ga0065165_1004703 | Ga0065165_10047034 | 67 |
| 44 | 3300013104 | Ga0157370_10003802 | Ga0157370_100038023 | 67 |
| 45 | 3300025298 | Ga0209050_1000209 | Ga0209050_1000209127 | 67 |
| 46 | 3300025304 | Ga0209257_1000027 | Ga0209257_1000027575 | 67 |
| 47 | 3300025932 | Ga0207690_10117210 | Ga0207690_101172102 | 67 |
| 48 | 3300025944 | Ga0207661_10238179 | Ga0207661_102381792 | 67 |
| 49 | 3300026041 | Ga0207639_10116714 | Ga0207639_101167142 | 67 |
| 50 | 3300033180 | Ga0307510_10413711 | Ga0307510_104137112 | 67 |
| 51 | 3300041486 | Ga0451807_1941827 | Ga0451807_1941827_188_391 | 67 |
| 52 | 3300044694 | Ga0466963_0149990 | Ga0466963_0149990_404_610 | 67 |
| 53 | 3300045836 | Ga0466958_0342785 | Ga0466958_0342785_404_610 | 67 |
| 54 | 3300049574 | Ga0501038_0547007 | Ga0501038_0547007_665_868 | 67 |
| 55 | 3300049823 | Ga0501044_0750714 | Ga0501044_0750714_43_246 | 67 |
| 56 | 3300053090 | Ga0500646_0365896 | Ga0500646_0365896_300_503 | 67 |
| 57 | 3300053118 | Ga0500594_0130655 | Ga0500594_0130655_403_606 | 67 |
| 58 | 3300005262 | Ga0065165_1023697 | Ga0065165_10236971 | 68 |
| 59 | 3300005293 | Ga0065715_10707290 | Ga0065715_107072902 | 68 |
| 60 | 3300005339 | Ga0070660_100002551 | Ga0070660_1000025514 | 68 |
| 61 | 3300005344 | Ga0070661_100000113 | Ga0070661_10000011336 | 68 |
| 62 | 3300005353 | Ga0070669_100221189 | Ga0070669_1002211893 | 68 |
| 63 | 3300005353 | Ga0070669_100311968 | Ga0070669_1003119682 | 68 |
| 64 | 3300005563 | Ga0068855_100258712 | Ga0068855_1002587123 | 68 |
| 65 | 3300005616 | Ga0068852_100658921 | Ga0068852_1006589212 | 68 |
| 66 | 3300005617 | Ga0068859_101903470 | Ga0068859_1019034702 | 68 |
| 67 | 3300005618 | Ga0068864_100000352 | Ga0068864_10000035219 | 68 |
| 68 | 3300005718 | Ga0068866_10806498 | Ga0068866_108064981 | 68 |
| 69 | 3300005719 | Ga0068861_100064577 | Ga0068861_1000645774 | 68 |
| 70 | 3300005719 | Ga0068861_100629007 | Ga0068861_1006290072 | 68 |
| 71 | 3300005842 | Ga0068858_100000132 | Ga0068858_10000013256 | 68 |
| 72 | 3300005842 | Ga0068858_100000444 | Ga0068858_10000044430 | 68 |
| 73 | 3300005844 | Ga0068862_100072957 | Ga0068862_1000729572 | 68 |
| 74 | 3300006195 | Ga0075366_10894901 | Ga0075366_108949012 | 68 |
| 75 | 3300006237 | Ga0097621_100490206 | Ga0097621_1004902062 | 68 |
| 76 | 3300006881 | Ga0068865_100249923 | Ga0068865_1002499234 | 68 |
| 77 | 3300006931 | Ga0097620_101903712 | Ga0097620_1019037122 | 68 |
| 78 | 3300009098 | Ga0105245_10001310 | Ga0105245_100013106 | 68 |
| 79 | 3300009148 | Ga0105243_10539296 | Ga0105243_105392962 | 68 |
| 80 | 3300009177 | Ga0105248_10025301 | Ga0105248_100253015 | 68 |
| 81 | 3300009545 | Ga0105237_11852732 | Ga0105237_118527323 | 68 |
| 82 | 3300013306 | Ga0163162_10004623 | Ga0163162_100046235 | 68 |
| 83 | 3300013306 | Ga0163162_10654148 | Ga0163162_106541483 | 68 |
| 84 | 3300013308 | Ga0157375_10955487 | Ga0157375_109554872 | 68 |
| 85 | 3300014325 | Ga0163163_10251054 | Ga0163163_102510541 | 68 |
| 86 | 3300025304 | Ga0209257_1151865 | Ga0209257_11518652 | 68 |
| 87 | 3300025315 | Ga0207697_10006787 | Ga0207697_100067874 | 68 |
| 88 | 3300025919 | Ga0207657_10008611 | Ga0207657_100086119 | 68 |
| 89 | 3300025920 | Ga0207649_10000089 | Ga0207649_1000008952 | 68 |
| 90 | 3300025923 | Ga0207681_10084245 | Ga0207681_100842453 | 68 |
| 91 | 3300025923 | Ga0207681_10193887 | Ga0207681_101938872 | 68 |
| 92 | 3300025927 | Ga0207687_10000473 | Ga0207687_1000047312 | 68 |
| 93 | 3300025931 | Ga0207644_11217773 | Ga0207644_112177732 | 68 |
| 94 | 3300025935 | Ga0207709_10673394 | Ga0207709_106733942 | 68 |
| 95 | 3300025937 | Ga0207669_10611901 | Ga0207669_106119012 | 68 |
| 96 | 3300025937 | Ga0207669_11590006 | Ga0207669_115900062 | 68 |
| 97 | 3300025938 | Ga0207704_10481232 | Ga0207704_104812323 | 68 |
| 98 | 3300025941 | Ga0207711_10003598 | Ga0207711_100035988 | 68 |
| 99 | 3300025972 | Ga0207668_11958273 | Ga0207668_119582731 | 68 |
| 100 | 3300025986 | Ga0207658_11208960 | Ga0207658_112089602 | 68 |
| 101 | 3300026023 | Ga0207677_10891942 | Ga0207677_108919421 | 68 |
| 102 | 3300026035 | Ga0207703_10000753 | Ga0207703_1000075327 | 68 |
| 103 | 3300026035 | Ga0207703_10002023 | Ga0207703_100020238 | 68 |
| 104 | 3300026095 | Ga0207676_10010587 | Ga0207676_100105874 | 68 |
| 105 | 3300028380 | Ga0268265_10278161 | Ga0268265_102781613 | 68 |
| 106 | 3300028794 | Ga0307515_10228749 | Ga0307515_102287493 | 68 |
| 107 | 3300031456 | Ga0307513_10019526 | Ga0307513_100195269 | 68 |
| 108 | 3300031507 | Ga0307509_10260747 | Ga0307509_102607472 | 68 |
| 109 | 3300041408 | Ga0439453_0048333 | Ga0439453_0048333_569_775 | 68 |
| 110 | 3300041494 | Ga0451837_0747534 | Ga0451837_0747534_532_738 | 68 |
| 111 | 3300042436 | Ga0439435_0100285 | Ga0439435_0100285_445_651 | 68 |
| 112 | 3300046457 | Ga0495590_0192028 | Ga0495590_0192028_308_514 | 68 |
| 113 | 3300046460 | Ga0495638_0164127 | Ga0495638_0164127_369_575 | 68 |
| 114 | 3300046471 | Ga0495650_0172073 | Ga0495650_0172073_410_616 | 68 |
| 115 | 3300046506 | Ga0495583_0032197 | Ga0495583_0032197_1324_1530 | 68 |
| 116 | 3300046616 | Ga0495668_0012280 | Ga0495668_0012280_1283_1489 | 68 |
| 117 | 3300046660 | Ga0495625_0085805 | Ga0495625_0085805_687_893 | 68 |
| 118 | 3300046691 | Ga0495670_0351891 | Ga0495670_0351891_49_255 | 68 |
| 119 | 3300046694 | Ga0495649_0232460 | Ga0495649_0232460_340_546 | 68 |
| 120 | 3300047445 | Ga0495677_0037301 | Ga0495677_0037301_448_654 | 68 |
| 121 | 3300053087 | Ga0500643_001747 | Ga0500643_001747_1311_1517 | 68 |
| 122 | 3300053119 | Ga0500595_024955 | Ga0500595_024955_1297_1503 | 68 |
| 123 | 3300053136 | Ga0500559_0165868 | Ga0500559_0165868_405_611 | 68 |
| 124 | 3300053136 | Ga0500559_0209898 | Ga0500559_0209898_563_769 | 68 |
| 125 | 3300001990 | JGI24737J22298_10000396 | JGI24737J22298_1000039620 | 69 |
| 126 | 3300001990 | JGI24737J22298_10000868 | JGI24737J22298_100008688 | 69 |
| 127 | 3300003215 | JGI25153J46596_10000027 | JGI25153J46596_100000274 | 69 |
| 128 | 3300003759 | Ga0055525_1000099 | Ga0055525_1000099121 | 69 |
| 129 | 3300003762 | Ga0055542_1000177 | Ga0055542_100017760 | 69 |
| 130 | 3300003763 | Ga0055529_1000350 | Ga0055529_100035032 | 69 |
| 131 | 3300003771 | Ga0055526_1020480 | Ga0055526_10204805 | 69 |
| 132 | 3300003773 | Ga0055537_1044819 | Ga0055537_10448191 | 69 |
| 133 | 3300003781 | Ga0055536_1027127 | Ga0055536_10271272 | 69 |
| 134 | 3300003791 | Ga0055530_10026176 | Ga0055530_100261763 | 69 |
| 135 | 3300003791 | Ga0055530_10030069 | Ga0055530_100300691 | 69 |
| 136 | 3300003794 | Ga0055531_10039340 | Ga0055531_100393401 | 69 |
| 137 | 3300003794 | Ga0055531_10039353 | Ga0055531_100393531 | 69 |
| 138 | 3300005262 | Ga0065165_1030847 | Ga0065165_10308472 | 69 |
| 139 | 3300005327 | Ga0070658_10096143 | Ga0070658_100961432 | 69 |
| 140 | 3300005328 | Ga0070676_10090064 | Ga0070676_100900643 | 69 |
| 141 | 3300005328 | Ga0070676_10691903 | Ga0070676_106919032 | 69 |
| 142 | 3300005333 | Ga0070677_10185060 | Ga0070677_101850602 | 69 |
| 143 | 3300005334 | Ga0068869_100016231 | Ga0068869_1000162316 | 69 |
| 144 | 3300005338 | Ga0068868_100000281 | Ga0068868_10000028120 | 69 |
| 145 | 3300005338 | Ga0068868_100067006 | Ga0068868_1000670062 | 69 |
| 146 | 3300005339 | Ga0070660_100918035 | Ga0070660_1009180352 | 69 |
| 147 | 3300005344 | Ga0070661_100072628 | Ga0070661_1000726283 | 69 |
| 148 | 3300005347 | Ga0070668_101016400 | Ga0070668_1010164003 | 69 |
| 149 | 3300005353 | Ga0070669_101135261 | Ga0070669_1011352612 | 69 |
| 150 | 3300005354 | Ga0070675_100200493 | Ga0070675_1002004931 | 69 |
| 151 | 3300005355 | Ga0070671_100024718 | Ga0070671_1000247182 | 69 |
| 152 | 3300005356 | Ga0070674_100007065 | Ga0070674_1000070652 | 69 |
| 153 | 3300005356 | Ga0070674_100044924 | Ga0070674_1000449245 | 69 |
| 154 | 3300005364 | Ga0070673_100000005 | Ga0070673_100000005168 | 69 |
| 155 | 3300005364 | Ga0070673_100568270 | Ga0070673_1005682702 | 69 |
| 156 | 3300005456 | Ga0070678_100000062 | Ga0070678_10000006210 | 69 |
| 157 | 3300005457 | Ga0070662_100543813 | Ga0070662_1005438132 | 69 |
| 158 | 3300005459 | Ga0068867_100000060 | Ga0068867_10000006027 | 69 |
| 159 | 3300005459 | Ga0068867_100065727 | Ga0068867_1000657274 | 69 |
| 160 | 3300005530 | Ga0070679_100058584 | Ga0070679_1000585845 | 69 |
| 161 | 3300005535 | Ga0070684_100287844 | Ga0070684_1002878442 | 69 |
| 162 | 3300005543 | Ga0070672_100171040 | Ga0070672_1001710402 | 69 |
| 163 | 3300005548 | Ga0070665_100000257 | Ga0070665_10000025757 | 69 |
| 164 | 3300005563 | Ga0068855_100890771 | Ga0068855_1008907712 | 69 |
| 165 | 3300005564 | Ga0070664_100023385 | Ga0070664_1000233853 | 69 |
| 166 | 3300005618 | Ga0068864_100460776 | Ga0068864_1004607763 | 69 |
| 167 | 3300005718 | Ga0068866_10591781 | Ga0068866_105917811 | 69 |
| 168 | 3300005719 | Ga0068861_100946156 | Ga0068861_1009461562 | 69 |
| 169 | 3300005834 | Ga0068851_10063301 | Ga0068851_100633012 | 69 |
| 170 | 3300005843 | Ga0068860_100000609 | Ga0068860_10000060946 | 69 |
| 171 | 3300005844 | Ga0068862_100000099 | Ga0068862_10000009950 | 69 |
| 172 | 3300005985 | Ga0081539_10013701 | Ga0081539_100137016 | 69 |
| 173 | 3300006186 | Ga0075369_10072999 | Ga0075369_100729993 | 69 |
| 174 | 3300006195 | Ga0075366_10176640 | Ga0075366_101766402 | 69 |
| 175 | 3300006237 | Ga0097621_100006422 | Ga0097621_1000064225 | 69 |
| 176 | 3300006353 | Ga0075370_10476015 | Ga0075370_104760154 | 69 |
| 177 | 3300006881 | Ga0068865_100000027 | Ga0068865_10000002764 | 69 |
| 178 | 3300006946 | Ga0079104_1030151 | Ga0079104_10301512 | 69 |
| 179 | 3300006948 | Ga0099826_10228384 | Ga0099826_102283841 | 69 |
| 180 | 3300009093 | Ga0105240_11197338 | Ga0105240_111973384 | 69 |
| 181 | 3300009098 | Ga0105245_10056870 | Ga0105245_100568703 | 69 |
| 182 | 3300009148 | Ga0105243_10000180 | Ga0105243_100001803 | 69 |
| 183 | 3300009148 | Ga0105243_10005280 | Ga0105243_100052808 | 69 |
| 184 | 3300009174 | Ga0105241_10000907 | Ga0105241_1000090719 | 69 |
| 185 | 3300009176 | Ga0105242_10000077 | Ga0105242_1000007759 | 69 |
| 186 | 3300009176 | Ga0105242_10425974 | Ga0105242_104259744 | 69 |
| 187 | 3300009176 | Ga0105242_10752239 | Ga0105242_107522393 | 69 |
| 188 | 3300009551 | Ga0105238_11558392 | Ga0105238_115583921 | 69 |
| 189 | 3300009551 | Ga0105238_12411713 | Ga0105238_124117133 | 69 |
| 190 | 3300009553 | Ga0105249_10000086 | Ga0105249_10000086114 | 69 |
| 191 | 3300009553 | Ga0105249_10096242 | Ga0105249_100962422 | 69 |
| 192 | 3300010375 | Ga0105239_13473448 | Ga0105239_134734483 | 69 |
| 193 | 3300011119 | Ga0105246_10000574 | Ga0105246_100005747 | 69 |
| 194 | 3300011119 | Ga0105246_10096827 | Ga0105246_100968274 | 69 |
| 195 | 3300012513 | Ga0157326_1004728 | Ga0157326_10047284 | 69 |
| 196 | 3300013100 | Ga0157373_10354274 | Ga0157373_103542742 | 69 |
| 197 | 3300013102 | Ga0157371_10000110 | Ga0157371_1000011042 | 69 |
| 198 | 3300013105 | Ga0157369_10011999 | Ga0157369_100119993 | 69 |
| 199 | 3300013105 | Ga0157369_10068183 | Ga0157369_100681835 | 69 |
| 200 | 3300013105 | Ga0157369_10195837 | Ga0157369_101958373 | 69 |
| 201 | 3300013296 | Ga0157374_10105445 | Ga0157374_101054453 | 69 |
| 202 | 3300013296 | Ga0157374_10193655 | Ga0157374_101936554 | 69 |
| 203 | 3300013297 | Ga0157378_10205471 | Ga0157378_102054713 | 69 |
| 204 | 3300013297 | Ga0157378_11577523 | Ga0157378_115775232 | 69 |
| 205 | 3300013297 | Ga0157378_12544954 | Ga0157378_125449541 | 69 |
| 206 | 3300013306 | Ga0163162_10100249 | Ga0163162_101002494 | 69 |
| 207 | 3300013307 | Ga0157372_10138582 | Ga0157372_101385822 | 69 |
| 208 | 3300013307 | Ga0157372_11453519 | Ga0157372_114535192 | 69 |
| 209 | 3300013308 | Ga0157375_10000592 | Ga0157375_1000059225 | 69 |
| 210 | 3300013308 | Ga0157375_12928403 | Ga0157375_129284032 | 69 |
| 211 | 3300014326 | Ga0157380_10778532 | Ga0157380_107785322 | 69 |
| 212 | 3300014745 | Ga0157377_10139434 | Ga0157377_101394342 | 69 |
| 213 | 3300014969 | Ga0157376_10000095 | Ga0157376_1000009526 | 69 |
| 214 | 3300014969 | Ga0157376_10956912 | Ga0157376_109569121 | 69 |
| 215 | 3300017792 | Ga0163161_12024976 | Ga0163161_120249762 | 69 |
| 216 | 3300020078 | Ga0206352_10570229 | Ga0206352_105702293 | 69 |
| 217 | 3300020081 | Ga0206354_10898498 | Ga0206354_108984981 | 69 |
| 218 | 3300025226 | Ga0209674_105616 | Ga0209674_1056163 | 69 |
| 219 | 3300025230 | Ga0209563_100081 | Ga0209563_1000815 | 69 |
| 220 | 3300025245 | Ga0207425_1000005 | Ga0207425_1000005402 | 69 |
| 221 | 3300025253 | Ga0209677_112052 | Ga0209677_1120522 | 69 |
| 222 | 3300025254 | Ga0209148_1000008 | Ga0209148_10000081274 | 69 |
| 223 | 3300025258 | Ga0209129_1001474 | Ga0209129_100147415 | 69 |
| 224 | 3300025263 | Ga0209565_1000209 | Ga0209565_100020958 | 69 |
| 225 | 3300025263 | Ga0209565_1028334 | Ga0209565_10283344 | 69 |
| 226 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002152 | 69 |
| 227 | 3300025272 | Ga0209455_1042853 | Ga0209455_10428533 | 69 |
| 228 | 3300025273 | Ga0209673_1045003 | Ga0209673_10450035 | 69 |
| 229 | 3300025292 | Ga0209676_1002244 | Ga0209676_100224414 | 69 |
| 230 | 3300025292 | Ga0209676_1036522 | Ga0209676_10365222 | 69 |
| 231 | 3300025294 | Ga0209025_1000128 | Ga0209025_1000128180 | 69 |
| 232 | 3300025295 | Ga0209564_1001366 | Ga0209564_10013661 | 69 |
| 233 | 3300025295 | Ga0209564_1001949 | Ga0209564_100194924 | 69 |
| 234 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002942 | 69 |
| 235 | 3300025297 | Ga0209758_1000017 | Ga0209758_1000017462 | 69 |
| 236 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001938 | 69 |
| 237 | 3300025298 | Ga0209050_1000707 | Ga0209050_100070735 | 69 |
| 238 | 3300025298 | Ga0209050_1025544 | Ga0209050_10255446 | 69 |
| 239 | 3300025298 | Ga0209050_1043346 | Ga0209050_10433464 | 69 |
| 240 | 3300025302 | Ga0207426_1089187 | Ga0207426_10891872 | 69 |
| 241 | 3300025302 | Ga0207426_1150361 | Ga0207426_11503612 | 69 |
| 242 | 3300025303 | Ga0209051_1000357 | Ga0209051_100035736 | 69 |
| 243 | 3300025304 | Ga0209257_1000500 | Ga0209257_100050065 | 69 |
| 244 | 3300025304 | Ga0209257_1001749 | Ga0209257_100174913 | 69 |
| 245 | 3300025893 | Ga0207682_10032446 | Ga0207682_100324462 | 69 |
| 246 | 3300025899 | Ga0207642_10006614 | Ga0207642_100066142 | 69 |
| 247 | 3300025900 | Ga0207710_10011316 | Ga0207710_100113164 | 69 |
| 248 | 3300025901 | Ga0207688_10077892 | Ga0207688_100778923 | 69 |
| 249 | 3300025901 | Ga0207688_10099326 | Ga0207688_100993262 | 69 |
| 250 | 3300025904 | Ga0207647_10009889 | Ga0207647_100098897 | 69 |
| 251 | 3300025907 | Ga0207645_10021501 | Ga0207645_100215012 | 69 |
| 252 | 3300025907 | Ga0207645_10025902 | Ga0207645_100259025 | 69 |
| 253 | 3300025907 | Ga0207645_10497149 | Ga0207645_104971492 | 69 |
| 254 | 3300025909 | Ga0207705_10000134 | Ga0207705_1000013418 | 69 |
| 255 | 3300025911 | Ga0207654_10001172 | Ga0207654_1000117218 | 69 |
| 256 | 3300025913 | Ga0207695_10167048 | Ga0207695_101670485 | 69 |
| 257 | 3300025913 | Ga0207695_10745589 | Ga0207695_107455894 | 69 |
| 258 | 3300025914 | Ga0207671_10651610 | Ga0207671_106516101 | 69 |
| 259 | 3300025919 | Ga0207657_10083546 | Ga0207657_100835462 | 69 |
| 260 | 3300025919 | Ga0207657_10153615 | Ga0207657_101536151 | 69 |
| 261 | 3300025920 | Ga0207649_10000414 | Ga0207649_1000041428 | 69 |
| 262 | 3300025920 | Ga0207649_10846086 | Ga0207649_108460862 | 69 |
| 263 | 3300025921 | Ga0207652_10452874 | Ga0207652_104528742 | 69 |
| 264 | 3300025923 | Ga0207681_10587776 | Ga0207681_105877762 | 69 |
| 265 | 3300025924 | Ga0207694_10067907 | Ga0207694_100679076 | 69 |
| 266 | 3300025925 | Ga0207650_10501443 | Ga0207650_105014433 | 69 |
| 267 | 3300025926 | Ga0207659_10188659 | Ga0207659_101886591 | 69 |
| 268 | 3300025927 | Ga0207687_10804590 | Ga0207687_108045902 | 69 |
| 269 | 3300025931 | Ga0207644_10019894 | Ga0207644_100198943 | 69 |
| 270 | 3300025932 | Ga0207690_10048111 | Ga0207690_100481112 | 69 |
| 271 | 3300025933 | Ga0207706_10273877 | Ga0207706_102738773 | 69 |
| 272 | 3300025933 | Ga0207706_11408610 | Ga0207706_114086102 | 69 |
| 273 | 3300025934 | Ga0207686_10000866 | Ga0207686_100008662 | 69 |
| 274 | 3300025934 | Ga0207686_10339556 | Ga0207686_103395562 | 69 |
| 275 | 3300025935 | Ga0207709_10000146 | Ga0207709_1000014634 | 69 |
| 276 | 3300025935 | Ga0207709_10000260 | Ga0207709_1000026022 | 69 |
| 277 | 3300025937 | Ga0207669_10000471 | Ga0207669_1000047113 | 69 |
| 278 | 3300025937 | Ga0207669_10004566 | Ga0207669_100045668 | 69 |
| 279 | 3300025938 | Ga0207704_10000064 | Ga0207704_1000006426 | 69 |
| 280 | 3300025940 | Ga0207691_10109741 | Ga0207691_101097412 | 69 |
| 281 | 3300025940 | Ga0207691_10686762 | Ga0207691_106867622 | 69 |
| 282 | 3300025942 | Ga0207689_10075643 | Ga0207689_100756431 | 69 |
| 283 | 3300025945 | Ga0207679_10194739 | Ga0207679_101947394 | 69 |
| 284 | 3300025949 | Ga0207667_10000001 | Ga0207667_10000001285 | 69 |
| 285 | 3300025949 | Ga0207667_10253459 | Ga0207667_102534592 | 69 |
| 286 | 3300025949 | Ga0207667_10575854 | Ga0207667_105758543 | 69 |
| 287 | 3300025960 | Ga0207651_10000010 | Ga0207651_10000010165 | 69 |
| 288 | 3300025960 | Ga0207651_10148137 | Ga0207651_101481373 | 69 |
| 289 | 3300025960 | Ga0207651_11795357 | Ga0207651_117953573 | 69 |
| 290 | 3300025961 | Ga0207712_10000026 | Ga0207712_1000002621 | 69 |
| 291 | 3300025961 | Ga0207712_10404478 | Ga0207712_104044782 | 69 |
| 292 | 3300025972 | Ga0207668_10319978 | Ga0207668_103199784 | 69 |
| 293 | 3300025981 | Ga0207640_10020478 | Ga0207640_100204785 | 69 |
| 294 | 3300025981 | Ga0207640_10282770 | Ga0207640_102827701 | 69 |
| 295 | 3300025986 | Ga0207658_10036194 | Ga0207658_100361943 | 69 |
| 296 | 3300025986 | Ga0207658_11832610 | Ga0207658_118326102 | 69 |
| 297 | 3300026023 | Ga0207677_10000021 | Ga0207677_100000214 | 69 |
| 298 | 3300026023 | Ga0207677_10038594 | Ga0207677_100385944 | 69 |
| 299 | 3300026067 | Ga0207678_10065835 | Ga0207678_100658353 | 69 |
| 300 | 3300026078 | Ga0207702_10003541 | Ga0207702_1000354120 | 69 |
| 301 | 3300026088 | Ga0207641_10001678 | Ga0207641_1000167810 | 69 |
| 302 | 3300026089 | Ga0207648_10000162 | Ga0207648_1000016238 | 69 |
| 303 | 3300026089 | Ga0207648_10089296 | Ga0207648_100892962 | 69 |
| 304 | 3300026095 | Ga0207676_10422930 | Ga0207676_104229302 | 69 |
| 305 | 3300026118 | Ga0207675_100655745 | Ga0207675_1006557452 | 69 |
| 306 | 3300026121 | Ga0207683_10001627 | Ga0207683_100016278 | 69 |
| 307 | 3300026121 | Ga0207683_11393537 | Ga0207683_113935373 | 69 |
| 308 | 3300026142 | Ga0207698_10027213 | Ga0207698_100272135 | 69 |
| 309 | 3300027111 | Ga0209281_1045307 | Ga0209281_10453071 | 69 |
| 310 | 3300028379 | Ga0268266_10000036 | Ga0268266_10000036283 | 69 |
| 311 | 3300028380 | Ga0268265_10000084 | Ga0268265_1000008486 | 69 |
| 312 | 3300028381 | Ga0268264_10001419 | Ga0268264_1000141916 | 69 |
| 313 | 3300028786 | Ga0307517_10136482 | Ga0307517_101364823 | 69 |
| 314 | 3300030733 | Ga0314311_1099328 | Ga0314311_10993282 | 69 |
| 315 | 3300030745 | Ga0316182_1124187 | Ga0316182_11241872 | 69 |
| 316 | 3300031456 | Ga0307513_10079752 | Ga0307513_100797523 | 69 |
| 317 | 3300031456 | Ga0307513_10229349 | Ga0307513_102293493 | 69 |
| 318 | 3300031456 | Ga0307513_11060938 | Ga0307513_110609381 | 69 |
| 319 | 3300031911 | Ga0307412_10039619 | Ga0307412_100396194 | 69 |
| 320 | 3300031995 | Ga0307409_102173821 | Ga0307409_1021738212 | 69 |
| 321 | 3300033180 | Ga0307510_10170867 | Ga0307510_101708675 | 69 |
| 322 | 3300033180 | Ga0307510_10627161 | Ga0307510_106271612 | 69 |
| 323 | 3300037471 | Ga0395905_0160733 | Ga0395905_0160733_313_522 | 69 |
| 324 | 3300038443 | Ga0395901_0178992 | Ga0395901_0178992_734_943 | 69 |
| 325 | 3300038705 | Ga0237819_04423 | Ga0237819_04423_2032_2250 | 69 |
| 326 | 3300041404 | Ga0439436_0057103 | Ga0439436_0057103_388_612 | 69 |
| 327 | 3300041410 | Ga0439461_0055320 | Ga0439461_0055320_523_747 | 69 |
| 328 | 3300041413 | Ga0439465_0001974 | Ga0439465_0001974_5842_6066 | 69 |
| 329 | 3300041443 | Ga0451789_1031900 | Ga0451789_1031900_244_453 | 69 |
| 330 | 3300041452 | Ga0451793_0275676 | Ga0451793_0275676_307_516 | 69 |
| 331 | 3300041456 | Ga0451795_0663129 | Ga0451795_0663129_85_294 | 69 |
| 332 | 3300041456 | Ga0451795_1567016 | Ga0451795_1567016_85_294 | 69 |
| 333 | 3300041459 | Ga0451800_0880592 | Ga0451800_0880592_191_400 | 69 |
| 334 | 3300041486 | Ga0451807_1098360 | Ga0451807_1098360_309_557 | 69 |
| 335 | 3300041491 | Ga0451833_1268577 | Ga0451833_1268577_127_336 | 69 |
| 336 | 3300041494 | Ga0451837_0971247 | Ga0451837_0971247_81_290 | 69 |
| 337 | 3300041512 | Ga0451853_1281590 | Ga0451853_1281590_170_418 | 69 |
| 338 | 3300041997 | Ga0439431_0026860 | Ga0439431_0026860_234_458 | 69 |
| 339 | 3300041997 | Ga0439431_0040883 | Ga0439431_0040883_148_372 | 69 |
| 340 | 3300042004 | Ga0439445_0032388 | Ga0439445_0032388_656_880 | 69 |
| 341 | 3300042004 | Ga0439445_0080333 | Ga0439445_0080333_598_822 | 69 |
| 342 | 3300042005 | Ga0439448_0015231 | Ga0439448_0015231_2052_2261 | 69 |
| 343 | 3300042006 | Ga0439432_066404 | Ga0439432_066404_183_407 | 69 |
| 344 | 3300042014 | Ga0439457_010366 | Ga0439457_010366_746_970 | 69 |
| 345 | 3300042015 | Ga0439462_0042284 | Ga0439462_0042284_10_234 | 69 |
| 346 | 3300042156 | Ga0439446_0027649 | Ga0439446_0027649_233_457 | 69 |
| 347 | 3300044693 | Ga0466961_0824109 | Ga0466961_0824109_129_338 | 69 |
| 348 | 3300044765 | Ga0466970_0928260 | Ga0466970_0928260_274_483 | 69 |
| 349 | 3300046452 | Ga0495617_046761 | Ga0495617_046761_939_1148 | 69 |
| 350 | 3300046453 | Ga0495627_098059 | Ga0495627_098059_548_760 | 69 |
| 351 | 3300046454 | Ga0495592_0484158 | Ga0495592_0484158_105_314 | 69 |
| 352 | 3300046457 | Ga0495590_0287382 | Ga0495590_0287382_40_252 | 69 |
| 353 | 3300046459 | Ga0495629_0380929 | Ga0495629_0380929_611_820 | 69 |
| 354 | 3300046460 | Ga0495638_0099733 | Ga0495638_0099733_413_625 | 69 |
| 355 | 3300046471 | Ga0495650_0000428 | Ga0495650_0000428_36455_36664 | 69 |
| 356 | 3300046475 | Ga0495639_0723341 | Ga0495639_0723341_209_418 | 69 |
| 357 | 3300046491 | Ga0495584_0078586 | Ga0495584_0078586_547_759 | 69 |
| 358 | 3300046492 | Ga0495585_0079003 | Ga0495585_0079003_859_1068 | 69 |
| 359 | 3300046492 | Ga0495585_0349563 | Ga0495585_0349563_406_615 | 69 |
| 360 | 3300046492 | Ga0495585_0459880 | Ga0495585_0459880_344_553 | 69 |
| 361 | 3300046500 | Ga0495596_0053596 | Ga0495596_0053596_521_730 | 69 |
| 362 | 3300046501 | Ga0495607_0337110 | Ga0495607_0337110_206_415 | 69 |
| 363 | 3300046506 | Ga0495583_0000613 | Ga0495583_0000613_30773_30982 | 69 |
| 364 | 3300046506 | Ga0495583_0005390 | Ga0495583_0005390_3276_3485 | 69 |
| 365 | 3300046506 | Ga0495583_0009190 | Ga0495583_0009190_1937_2149 | 69 |
| 366 | 3300046506 | Ga0495583_0056784 | Ga0495583_0056784_328_537 | 69 |
| 367 | 3300046506 | Ga0495583_0105060 | Ga0495583_0105060_756_965 | 69 |
| 368 | 3300046507 | Ga0495606_0000534 | Ga0495606_0000534_41261_41470 | 69 |
| 369 | 3300046507 | Ga0495606_0052289 | Ga0495606_0052289_1720_1929 | 69 |
| 370 | 3300046507 | Ga0495606_0101561 | Ga0495606_0101561_970_1179 | 69 |
| 371 | 3300046513 | Ga0495616_0021403 | Ga0495616_0021403_121_330 | 69 |
| 372 | 3300046513 | Ga0495616_0236207 | Ga0495616_0236207_21_230 | 69 |
| 373 | 3300046518 | Ga0495631_0026437 | Ga0495631_0026437_2013_2225 | 69 |
| 374 | 3300046518 | Ga0495631_0034307 | Ga0495631_0034307_1560_1769 | 69 |
| 375 | 3300046518 | Ga0495631_0143195 | Ga0495631_0143195_649_858 | 69 |
| 376 | 3300046519 | Ga0495632_0095055 | Ga0495632_0095055_530_739 | 69 |
| 377 | 3300046520 | Ga0495637_0044255 | Ga0495637_0044255_320_532 | 69 |
| 378 | 3300046522 | Ga0495643_0008262 | Ga0495643_0008262_2810_3019 | 69 |
| 379 | 3300046522 | Ga0495643_0009124 | Ga0495643_0009124_2336_2545 | 69 |
| 380 | 3300046522 | Ga0495643_0058809 | Ga0495643_0058809_1034_1243 | 69 |
| 381 | 3300046522 | Ga0495643_0177901 | Ga0495643_0177901_187_396 | 69 |
| 382 | 3300046522 | Ga0495643_0228141 | Ga0495643_0228141_276_485 | 69 |
| 383 | 3300046522 | Ga0495643_0416185 | Ga0495643_0416185_133_342 | 69 |
| 384 | 3300046524 | Ga0495648_0000376 | Ga0495648_0000376_20243_20452 | 69 |
| 385 | 3300046524 | Ga0495648_0021934 | Ga0495648_0021934_1120_1329 | 69 |
| 386 | 3300046525 | Ga0495663_0001141 | Ga0495663_0001141_6381_6590 | 69 |
| 387 | 3300046525 | Ga0495663_0022362 | Ga0495663_0022362_1377_1589 | 69 |
| 388 | 3300046525 | Ga0495663_0083837 | Ga0495663_0083837_790_1008 | 69 |
| 389 | 3300046528 | Ga0495642_0004270 | Ga0495642_0004270_965_1174 | 69 |
| 390 | 3300046529 | Ga0495652_0297347 | Ga0495652_0297347_702_911 | 69 |
| 391 | 3300046536 | Ga0495587_0515661 | Ga0495587_0515661_163_372 | 69 |
| 392 | 3300046538 | Ga0495609_0107855 | Ga0495609_0107855_432_644 | 69 |
| 393 | 3300046542 | Ga0495597_0105048 | Ga0495597_0105048_71_280 | 69 |
| 394 | 3300046542 | Ga0495597_0139519 | Ga0495597_0139519_745_954 | 69 |
| 395 | 3300046558 | Ga0495633_0003594 | Ga0495633_0003594_9933_10142 | 69 |
| 396 | 3300046558 | Ga0495633_0064702 | Ga0495633_0064702_120_329 | 69 |
| 397 | 3300046616 | Ga0495668_0000431 | Ga0495668_0000431_39092_39301 | 69 |
| 398 | 3300046616 | Ga0495668_0125008 | Ga0495668_0125008_826_1035 | 69 |
| 399 | 3300046648 | Ga0495611_0011300 | Ga0495611_0011300_2522_2734 | 69 |
| 400 | 3300046648 | Ga0495611_0130843 | Ga0495611_0130843_945_1154 | 69 |
| 401 | 3300046660 | Ga0495625_0000584 | Ga0495625_0000584_31455_31667 | 69 |
| 402 | 3300046660 | Ga0495625_0000665 | Ga0495625_0000665_6271_6486 | 69 |
| 403 | 3300046660 | Ga0495625_0013211 | Ga0495625_0013211_2302_2514 | 69 |
| 404 | 3300046660 | Ga0495625_0041334 | Ga0495625_0041334_124_333 | 69 |
| 405 | 3300046660 | Ga0495625_0052191 | Ga0495625_0052191_393_602 | 69 |
| 406 | 3300046660 | Ga0495625_0058149 | Ga0495625_0058149_2136_2354 | 69 |
| 407 | 3300046684 | Ga0495669_0000129 | Ga0495669_0000129_30960_31172 | 69 |
| 408 | 3300046691 | Ga0495670_0020544 | Ga0495670_0020544_389_598 | 69 |
| 409 | 3300046694 | Ga0495649_0015398 | Ga0495649_0015398_3395_3604 | 69 |
| 410 | 3300046694 | Ga0495649_0037865 | Ga0495649_0037865_1834_2046 | 69 |
| 411 | 3300046694 | Ga0495649_0121335 | Ga0495649_0121335_597_806 | 69 |
| 412 | 3300046694 | Ga0495649_0174633 | Ga0495649_0174633_693_902 | 69 |
| 413 | 3300046809 | Ga0495600_0003850 | Ga0495600_0003850_7456_7665 | 69 |
| 414 | 3300046810 | Ga0495660_0063157 | Ga0495660_0063157_443_655 | 69 |
| 415 | 3300046810 | Ga0495660_0114631 | Ga0495660_0114631_344_553 | 69 |
| 416 | 3300046810 | Ga0495660_0130232 | Ga0495660_0130232_584_796 | 69 |
| 417 | 3300047323 | Ga0495683_0003096 | Ga0495683_0003096_4977_5186 | 69 |
| 418 | 3300047323 | Ga0495683_0009719 | Ga0495683_0009719_4112_4321 | 69 |
| 419 | 3300047443 | Ga0495687_000109 | Ga0495687_000109_17545_17757 | 69 |
| 420 | 3300047443 | Ga0495687_001290 | Ga0495687_001290_17787_17996 | 69 |
| 421 | 3300047445 | Ga0495677_0012314 | Ga0495677_0012314_1605_1814 | 69 |
| 422 | 3300047445 | Ga0495677_0348990 | Ga0495677_0348990_119_328 | 69 |
| 423 | 3300047469 | Ga0495673_0090439 | Ga0495673_0090439_755_964 | 69 |
| 424 | 3300047470 | Ga0495681_0004372 | Ga0495681_0004372_4491_4700 | 69 |
| 425 | 3300047470 | Ga0495681_0007127 | Ga0495681_0007127_4291_4503 | 69 |
| 426 | 3300047472 | Ga0495686_0241368 | Ga0495686_0241368_68_277 | 69 |
| 427 | 3300047472 | Ga0495686_0249059 | Ga0495686_0249059_601_810 | 69 |
| 428 | 3300048903 | Ga0496100_0125239 | Ga0496100_0125239_1097_1315 | 69 |
| 429 | 3300048904 | Ga0496101_0331075 | Ga0496101_0331075_47_256 | 69 |
| 430 | 3300048905 | Ga0496102_0000329 | Ga0496102_0000329_19773_19982 | 69 |
| 431 | 3300048906 | Ga0496103_0000164 | Ga0496103_0000164_30873_31082 | 69 |
| 432 | 3300048907 | Ga0496104_0030228 | Ga0496104_0030228_3966_4175 | 69 |
| 433 | 3300048908 | Ga0496105_0002044 | Ga0496105_0002044_14055_14264 | 69 |
| 434 | 3300048910 | Ga0496107_0353499 | Ga0496107_0353499_113_322 | 69 |
| 435 | 3300048910 | Ga0496107_0439489 | Ga0496107_0439489_449_658 | 69 |
| 436 | 3300048913 | Ga0496110_0007556 | Ga0496110_0007556_2091_2300 | 69 |
| 437 | 3300048914 | Ga0496111_0004277 | Ga0496111_0004277_1522_1731 | 69 |
| 438 | 3300048916 | Ga0496113_0010663 | Ga0496113_0010663_4404_4613 | 69 |
| 439 | 3300048917 | Ga0496114_0012260 | Ga0496114_0012260_5004_5213 | 69 |
| 440 | 3300048918 | Ga0496115_0000174 | Ga0496115_0000174_35391_35600 | 69 |
| 441 | 3300048918 | Ga0496115_0016397 | Ga0496115_0016397_3474_3689 | 69 |
| 442 | 3300048919 | Ga0496116_0002115 | Ga0496116_0002115_6680_6889 | 69 |
| 443 | 3300048920 | Ga0496117_0000432 | Ga0496117_0000432_55661_55870 | 69 |
| 444 | 3300048921 | Ga0496118_0000127 | Ga0496118_0000127_39104_39313 | 69 |
| 445 | 3300048922 | Ga0496119_0045957 | Ga0496119_0045957_661_870 | 69 |
| 446 | 3300048923 | Ga0496120_0011068 | Ga0496120_0011068_5323_5532 | 69 |
| 447 | 3300048924 | Ga0496121_0000335 | Ga0496121_0000335_53105_53317 | 69 |
| 448 | 3300048924 | Ga0496121_0001019 | Ga0496121_0001019_10765_10974 | 69 |
| 449 | 3300048924 | Ga0496121_0223986 | Ga0496121_0223986_248_463 | 69 |
| 450 | 3300048925 | Ga0496122_0034395 | Ga0496122_0034395_985_1194 | 69 |
| 451 | 3300048926 | Ga0496123_0075326 | Ga0496123_0075326_713_922 | 69 |
| 452 | 3300048927 | Ga0496124_0000011 | Ga0496124_0000011_96434_96643 | 69 |
| 453 | 3300048928 | Ga0496125_0000426 | Ga0496125_0000426_28044_28253 | 69 |
| 454 | 3300048929 | Ga0496126_0004692 | Ga0496126_0004692_10838_11047 | 69 |
| 455 | 3300049460 | Ga0495682_0253451 | Ga0495682_0253451_26_238 | 69 |
| 456 | 3300049581 | Ga0501047_0310469 | Ga0501047_0310469_176_388 | 69 |
| 457 | 3300050493 | nmdc:mga0k408_122446_c1 | nmdc:mga0k408_122446_c1_659_868 | 69 |
| 458 | 3300050493 | nmdc:mga0k408_284239_c1 | nmdc:mga0k408_284239_c1_595_810 | 69 |
| 459 | 3300050516 | nmdc:mga0sz30_443277_c1 | nmdc:mga0sz30_443277_c1_93_302 | 69 |
| 460 | 3300053079 | Ga0500610_0000099 | Ga0500610_0000099_5074_5286 | 69 |
| 461 | 3300053087 | Ga0500643_001568 | Ga0500643_001568_11913_12128 | 69 |
| 462 | 3300053087 | Ga0500643_010010 | Ga0500643_010010_3267_3482 | 69 |
| 463 | 3300053087 | Ga0500643_043196 | Ga0500643_043196_939_1151 | 69 |
| 464 | 3300053094 | Ga0500566_0005221 | Ga0500566_0005221_2267_2482 | 69 |
| 465 | 3300053096 | Ga0500641_0019080 | Ga0500641_0019080_1593_1811 | 69 |
| 466 | 3300053103 | Ga0500555_085882 | Ga0500555_085882_557_769 | 69 |
| 467 | 3300053108 | Ga0500562_019273 | Ga0500562_019273_1050_1265 | 69 |
| 468 | 3300053108 | Ga0500562_213578 | Ga0500562_213578_214_432 | 69 |
| 469 | 3300053119 | Ga0500595_001055 | Ga0500595_001055_5028_5237 | 69 |
| 470 | 3300053119 | Ga0500595_006368 | Ga0500595_006368_3717_3929 | 69 |
| 471 | 3300053119 | Ga0500595_128730 | Ga0500595_128730_455_664 | 69 |
| 472 | 3300053121 | Ga0500607_082901 | Ga0500607_082901_1000_1209 | 69 |
| 473 | 3300053130 | Ga0500642_0000631 | Ga0500642_0000631_5366_5575 | 69 |
| 474 | 3300053136 | Ga0500559_0090613 | Ga0500559_0090613_968_1177 | 69 |
| 475 | 3300053136 | Ga0500559_0283820 | Ga0500559_0283820_273_482 | 69 |
| 476 | 3300053136 | Ga0500559_0356815 | Ga0500559_0356815_315_524 | 69 |
| 477 | 3300053139 | Ga0500568_0024253 | Ga0500568_0024253_439_651 | 69 |
| 478 | 3300053144 | Ga0500585_208010 | Ga0500585_208010_192_401 | 69 |
| 479 | 3300053151 | Ga0500604_0242326 | Ga0500604_0242326_164_376 | 69 |
| 480 | 3300053153 | Ga0500616_0074160 | Ga0500616_0074160_76_303 | 69 |
| 481 | 3300053154 | Ga0500619_008673 | Ga0500619_008673_1029_1238 | 69 |
| 482 | 3300053177 | Ga0500636_0002160 | Ga0500636_0002160_5685_5894 | 69 |
| 483 | 3300053730 | Ga0500645_000001 | Ga0500645_000001_437749_437961 | 69 |
| 484 | 3300053731 | Ga0500609_047683 | Ga0500609_047683_10_219 | 69 |
| 485 | 3300055283 | Ga0500661_108376 | Ga0500661_108376_251_460 | 69 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XUS7_9_301_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.3332 | 16 | 69 | 1.20.1270.60 |
| af_Q9XUS7_9_301_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.2588 | 16 | 69 | 1.20.1270.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A448PNN8-F1-model_v4 | Uncharacterized protein | 0.3754 | 1 | 69 |
GO:0006355
|
| AF-A0A448PNN8-F1-model_v4 | Uncharacterized protein | 0.3711 | 1 | 69 |
GO:0006355
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar