F453175

General Info

Members Datasets Scaffolds Average Seq Length
485 298 473 153

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0495642|Ga0501035_0495642_523_993
Length 156
Sequence LNIASSKPRTHFARRAGQALLVAAALASLGACGKKERPKADIAAAKITTIGVNAYLWKASLETLSFMPLLQTDSAGGVIVTDWYANPRNPAERMKVSVTILDQDLRADALRVAASRQVAVGGGTWVDAPVEAATVQKLEDIILTKARELRRSAIAG

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
10 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
11 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
12 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
13 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
14 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
163 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
197 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
198 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
242 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
243 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
244 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
245 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
246 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
260 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
261 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
262 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
263 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
264 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
265 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
266 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
267 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
268 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
269 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
270 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
271 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
272 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
273 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
274 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
275 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
276 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
277 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
286 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
287 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
288 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
289 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
290 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
295 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
296 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
297 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0.41
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.7
Nodule 0.41
Rhizoplane 5.15
Rhizosphere 69.69
Stem 0
Stem Tuber 0
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c004327 3300000041 Bacteria 1238
2 ARcpr5yngRDRAFT_c005971 3300000043 Bacteria 1110
3 JGI24740J21852_10005324 3300001979 Bacteria 5456
4 JGI24739J22299_10031522 3300001989 Bacteria 1832
5 JGI24739J22299_10041287 3300001989 Bacteria 1535
6 JGI24751J29686_10000248 3300002459 Bacteria 21460
7 JGI25150J39212_1000189 3300002774 Bacteria 34828
8 JGI25150J39212_1014466 3300002774 Bacteria 1340
9 JGI25151J46595_10037663 3300003187 Bacteria 1811
10 JGI25165J46597_1000010 3300003214 Bacteria 442113
11 JGI25153J46596_10000125 3300003215 Bacteria 86065
12 JGI25153J46596_10021376 3300003215 Bacteria 2413
13 rootL2_10265637 3300003322 Bacteria 1472
14 Ga0055526_1026363 3300003771 Bacteria 1835
15 Ga0055537_1000852 3300003773 Bacteria 14838
16 Ga0055524_1000387 3300003775 Bacteria 37906
17 Ga0055536_1002780 3300003781 Bacteria 9686
18 Ga0055536_1005046 3300003781 Bacteria 6557
19 Ga0055536_1010687 3300003781 Bacteria 3608
20 Ga0055528_1020769 3300003790 Bacteria 2115
21 Ga0055530_10000115 3300003791 Bacteria 70229
22 Ga0055530_10001385 3300003791 Bacteria 17950
23 Ga0055530_10011223 3300003791 Bacteria 3235
24 Ga0055530_10031272 3300003791 Bacteria 1399
25 Ga0055530_10046727 3300003791 Bacteria 1026
26 Ga0055540_1001895 3300003792 Bacteria 11716
27 Ga0055531_10007918 3300003794 Bacteria 5701
28 Ga0055531_10039285 3300003794 Bacteria 1407
29 Ga0055531_10039478 3300003794 Bacteria 1401
30 Ga0055531_10041570 3300003794 Bacteria 1329
31 Ga0055531_10058207 3300003794 Bacteria 963
32 Ga0065165_1010466 3300005262 Bacteria 4004
33 Ga0065165_1095073 3300005262 Bacteria 753
34 Ga0065165_1100922 3300005262 Bacteria 722
35 Ga0070658_10012594 3300005327 Bacteria 6784
36 Ga0070658_10034843 3300005327 Bacteria 4051
37 Ga0070658_10448353 3300005327 Bacteria 1112
38 Ga0070658_10918574 3300005327 Bacteria 761
39 Ga0070683_100677233 3300005329 Bacteria 988
40 Ga0070690_100099382 3300005330 Bacteria 1927
41 Ga0070670_100245654 3300005331 Bacteria 1559
42 Ga0070677_10026023 3300005333 Bacteria 2190
43 Ga0070666_10046282 3300005335 Bacteria 2917
44 Ga0070666_10409910 3300005335 Bacteria 975
45 Ga0070680_100004738 3300005336 Bacteria 10238
46 Ga0068868_100436311 3300005338 Bacteria 1136
47 Ga0070660_100001566 3300005339 Bacteria 15724
48 Ga0070689_100097146 3300005340 Bacteria 2329
49 Ga0070687_100332802 3300005343 Bacteria 974
50 Ga0070661_100001080 3300005344 Bacteria 19297
51 Ga0070692_10054709 3300005345 Bacteria 2085
52 Ga0070669_100003265 3300005353 Bacteria 11653
53 Ga0070675_100007371 3300005354 Bacteria 8496
54 Ga0070675_100143703 3300005354 Bacteria 2041
55 Ga0070671_100000268 3300005355 Bacteria 35150
56 Ga0070671_100154261 3300005355 Bacteria 1940
57 Ga0070671_100593314 3300005355 Bacteria 957
58 Ga0070671_101145475 3300005355 Bacteria 684
59 Ga0070673_100125776 3300005364 Bacteria 2145
60 Ga0070659_100002055 3300005366 Bacteria 14366
61 Ga0070659_100103597 3300005366 Bacteria 2292
62 Ga0070667_100000377 3300005367 Bacteria 48838
63 Ga0070667_100007492 3300005367 Bacteria 9056
64 Ga0070667_100011507 3300005367 Bacteria 7318
65 Ga0070667_100343349 3300005367 Bacteria 1351
66 Ga0070663_100047846 3300005455 Bacteria 3030
67 Ga0070663_100456199 3300005455 Bacteria 1054
68 Ga0070678_100167875 3300005456 Bacteria 1784
69 Ga0070662_100000296 3300005457 Bacteria 29421
70 Ga0070662_100030113 3300005457 Bacteria 3794
71 Ga0070662_100091571 3300005457 Bacteria 2284
72 Ga0070681_10000704 3300005458 Bacteria 27767
73 Ga0070685_10196035 3300005466 Bacteria 1310
74 Ga0070679_100009470 3300005530 Bacteria 9213
75 Ga0070679_100084575 3300005530 Bacteria 3160
76 Ga0070684_100845035 3300005535 Bacteria 857
77 Ga0068853_100005067 3300005539 Bacteria 10280
78 Ga0068853_100035221 3300005539 Bacteria 4251
79 Ga0068853_100641939 3300005539 Bacteria 1010
80 Ga0070672_100072979 3300005543 Bacteria 2734
81 Ga0070686_100010084 3300005544 Bacteria 5316
82 Ga0070693_100087616 3300005547 Bacteria 1870
83 Ga0070665_100023655 3300005548 Bacteria 6185
84 Ga0070665_100025894 3300005548 Bacteria 5906
85 Ga0070665_100392343 3300005548 Bacteria 1396
86 Ga0070665_100861413 3300005548 Bacteria 919
87 Ga0068855_100002306 3300005563 Bacteria 23590
88 Ga0068855_100009460 3300005563 Bacteria 11770
89 Ga0068855_100185629 3300005563 Bacteria 2349
90 Ga0068855_100238359 3300005563 Bacteria 2033
91 Ga0070664_100000599 3300005564 Bacteria 27555
92 Ga0070664_100167768 3300005564 Bacteria 1946
93 Ga0068857_100033196 3300005577 Bacteria 4564
94 Ga0068857_100279118 3300005577 Bacteria 1536
95 Ga0068857_100383943 3300005577 Bacteria 1305
96 Ga0068854_100169228 3300005578 Bacteria 1699
97 Ga0068854_100172336 3300005578 Bacteria 1685
98 Ga0068854_100374948 3300005578 Bacteria 1171
99 Ga0068856_100254561 3300005614 Bacteria 1771
100 Ga0068856_100534174 3300005614 Bacteria 1194
101 Ga0068859_100128494 3300005617 Bacteria 2605
102 Ga0068859_100220912 3300005617 Bacteria 1982
103 Ga0068859_100323717 3300005617 Bacteria 1635
104 Ga0068864_100001638 3300005618 Bacteria 18469
105 Ga0068864_100107408 3300005618 Bacteria 2483
106 Ga0068851_10133232 3300005834 Bacteria 1346
107 Ga0068851_10219683 3300005834 Bacteria 1067
108 Ga0068851_10423387 3300005834 Bacteria 787
109 Ga0068863_100000778 3300005841 Bacteria 32056
110 Ga0068863_100097552 3300005841 Bacteria 2791
111 Ga0068863_100147109 3300005841 Bacteria 2254
112 Ga0068863_100476409 3300005841 Bacteria 1227
113 Ga0068858_100000803 3300005842 Bacteria 32914
114 Ga0068858_100048753 3300005842 Bacteria 3923
115 Ga0068860_100000422 3300005843 Bacteria 54588
116 Ga0068860_100002959 3300005843 Bacteria 17532
117 Ga0068860_100106589 3300005843 Bacteria 2677
118 Ga0068862_100022982 3300005844 Bacteria 5221
119 Ga0068862_100083545 3300005844 Bacteria 2773
120 Ga0068862_100854420 3300005844 Bacteria 892
121 Ga0081539_10115794 3300005985 Bacteria 1340
122 Ga0075364_10000934 3300006051 Bacteria 15423
123 Ga0075366_10008138 3300006195 Bacteria 5817
124 Ga0075366_10318475 3300006195 Bacteria 953
125 Ga0097620_100128492 3300006931 Bacteria 2605
126 Ga0097620_100220904 3300006931 Bacteria 1982
127 Ga0097620_100323729 3300006931 Bacteria 1635
128 Ga0097620_100384559 3300006931 Bacteria 1499
129 Ga0079104_1011144 3300006946 Bacteria 2910
130 Ga0105240_10205345 3300009093 Bacteria 2307
131 Ga0105240_10369510 3300009093 Bacteria 1622
132 Ga0105240_11217437 3300009093 Bacteria 797
133 Ga0105245_10012492 3300009098 Bacteria 7389
134 Ga0105247_10051830 3300009101 Bacteria 2528
135 Ga0105243_10076652 3300009148 Bacteria 2718
136 Ga0105241_10052927 3300009174 Bacteria 3102
137 Ga0105242_10258378 3300009176 Bacteria 1572
138 Ga0105248_10028901 3300009177 Bacteria 6180
139 Ga0105248_10161041 3300009177 Bacteria 2531
140 Ga0105237_10032356 3300009545 Bacteria 5295
141 Ga0105237_10367034 3300009545 Bacteria 1444
142 Ga0105237_10763565 3300009545 Bacteria 973
143 Ga0105238_10721954 3300009551 Bacteria 1009
144 Ga0105249_10197558 3300009553 Bacteria 1966
145 Ga0105239_10312085 3300010375 Bacteria 1772
146 Ga0105246_10003891 3300011119 Bacteria 9048
147 Ga0157373_10042182 3300013100 Bacteria 3262
148 Ga0157371_10000838 3300013102 Bacteria 35145
149 Ga0157371_10048467 3300013102 Bacteria 3020
150 Ga0157370_10000287 3300013104 Bacteria 64090
151 Ga0157369_10097615 3300013105 Bacteria 3134
152 Ga0157374_10342730 3300013296 Bacteria 1484
153 Ga0157378_10036010 3300013297 Bacteria 4380
154 Ga0163162_10097805 3300013306 Bacteria 3024
155 Ga0163162_10351772 3300013306 Bacteria 1606
156 Ga0157372_10004576 3300013307 Bacteria 14713
157 Ga0157372_10266782 3300013307 Bacteria 1988
158 Ga0157372_10466031 3300013307 Bacteria 1473
159 Ga0157372_10524253 3300013307 Bacteria 1381
160 Ga0157375_10113547 3300013308 Bacteria 2810
161 Ga0157375_10924373 3300013308 Bacteria 1015
162 Ga0163163_10191752 3300014325 Bacteria 2092
163 Ga0157377_10485968 3300014745 Bacteria 860
164 Ga0163161_10161869 3300017792 Bacteria 1707
165 Ga0213875_10000166 3300021388 Bacteria 68786
166 Ga0207425_1000005 3300025245 Bacteria 900502
167 Ga0209026_1024863 3300025250 Bacteria 906
168 Ga0209129_1000345 3300025258 Bacteria 39677
169 Ga0209233_1000044 3300025261 Bacteria 489783
170 Ga0209565_1000052 3300025263 Bacteria 212056
171 Ga0209455_1018055 3300025272 Bacteria 1459
172 Ga0209673_1051784 3300025273 Bacteria 1081
173 Ga0209675_1000104 3300025291 Bacteria 121249
174 Ga0209676_1000512 3300025292 Bacteria 61167
175 Ga0209676_1001456 3300025292 Bacteria 22181
176 Ga0209676_1012010 3300025292 Bacteria 3442
177 Ga0209676_1018292 3300025292 Bacteria 2449
178 Ga0209025_1001007 3300025294 Bacteria 41722
179 Ga0209025_1020363 3300025294 Bacteria 3633
180 Ga0209025_1056248 3300025294 Bacteria 1514
181 Ga0209564_1018743 3300025295 Bacteria 2622
182 Ga0209564_1022881 3300025295 Bacteria 2191
183 Ga0209758_1000002 3300025297 Bacteria 1400310
184 Ga0209758_1041823 3300025297 Bacteria 1707
185 Ga0209050_1000001 3300025298 Bacteria 3563507
186 Ga0209050_1000286 3300025298 Bacteria 106566
187 Ga0209050_1003173 3300025298 Bacteria 12496
188 Ga0209050_1021898 3300025298 Bacteria 2309
189 Ga0207426_1006259 3300025302 Bacteria 5210
190 Ga0209051_1000472 3300025303 Bacteria 52350
191 Ga0209257_1000245 3300025304 Bacteria 125987
192 Ga0209257_1000321 3300025304 Bacteria 100476
193 Ga0209257_1002319 3300025304 Bacteria 19233
194 Ga0209257_1011475 3300025304 Bacteria 4262
195 Ga0209257_1041739 3300025304 Bacteria 1359
196 Ga0207697_10043975 3300025315 Bacteria 1837
197 Ga0207656_10246419 3300025321 Bacteria 874
198 Ga0207710_10062599 3300025900 Bacteria 1691
199 Ga0207680_10238749 3300025903 Bacteria 1252
200 Ga0207705_10066559 3300025909 Bacteria 2606
201 Ga0207705_10154843 3300025909 Bacteria 1719
202 Ga0207705_10487187 3300025909 Bacteria 957
203 Ga0207707_10015569 3300025912 Bacteria 6624
204 Ga0207695_10617947 3300025913 Bacteria 965
205 Ga0207671_10002056 3300025914 Bacteria 22074
206 Ga0207671_10489463 3300025914 Bacteria 980
207 Ga0207660_10004662 3300025917 Bacteria 8935
208 Ga0207660_10376707 3300025917 Bacteria 1140
209 Ga0207657_10000237 3300025919 Bacteria 58162
210 Ga0207657_10038981 3300025919 Bacteria 4225
211 Ga0207649_10137340 3300025920 Bacteria 1668
212 Ga0207652_10003065 3300025921 Bacteria 13950
213 Ga0207652_10022405 3300025921 Bacteria 5226
214 Ga0207681_10000260 3300025923 Bacteria 40385
215 Ga0207681_10213351 3300025923 Bacteria 1489
216 Ga0207694_10023969 3300025924 Bacteria 4635
217 Ga0207659_10021746 3300025926 Bacteria 4263
218 Ga0207687_10003478 3300025927 Bacteria 10598
219 Ga0207644_10000008 3300025931 Bacteria 354219
220 Ga0207644_10319835 3300025931 Bacteria 1254
221 Ga0207644_10449883 3300025931 Bacteria 1058
222 Ga0207690_10000321 3300025932 Bacteria 32084
223 Ga0207690_10125940 3300025932 Bacteria 1868
224 Ga0207706_10001328 3300025933 Bacteria 24769
225 Ga0207706_10008461 3300025933 Bacteria 9490
226 Ga0207706_10076727 3300025933 Bacteria 2939
227 Ga0207686_10155988 3300025934 Bacteria 1595
228 Ga0207691_10109620 3300025940 Bacteria 2456
229 Ga0207711_10119135 3300025941 Bacteria 2355
230 Ga0207711_10142917 3300025941 Bacteria 2154
231 Ga0207711_11209712 3300025941 Bacteria 697
232 Ga0207661_10097375 3300025944 Bacteria 2463
233 Ga0207679_10037614 3300025945 Bacteria 3442
234 Ga0207667_10000686 3300025949 Bacteria 43969
235 Ga0207667_10000881 3300025949 Bacteria 38298
236 Ga0207667_10029439 3300025949 Bacteria 5956
237 Ga0207667_10094877 3300025949 Bacteria 3080
238 Ga0207667_10305402 3300025949 Bacteria 1626
239 Ga0207651_10611176 3300025960 Bacteria 954
240 Ga0207712_11109327 3300025961 Bacteria 704
241 Ga0207668_10041281 3300025972 Bacteria 3118
242 Ga0207668_10824170 3300025972 Bacteria 822
243 Ga0207640_10003971 3300025981 Bacteria 7981
244 Ga0207640_10118101 3300025981 Bacteria 1894
245 Ga0207640_10441555 3300025981 Bacteria 1070
246 Ga0207640_10540210 3300025981 Bacteria 977
247 Ga0207658_10000813 3300025986 Bacteria 26103
248 Ga0207658_10002531 3300025986 Bacteria 13305
249 Ga0207658_10055762 3300025986 Bacteria 2930
250 Ga0207658_10141750 3300025986 Bacteria 1946
251 Ga0207677_10377139 3300026023 Bacteria 1196
252 Ga0207703_10001170 3300026035 Bacteria 24778
253 Ga0207703_10018441 3300026035 Bacteria 5449
254 Ga0207703_10087280 3300026035 Bacteria 2615
255 Ga0207639_10007020 3300026041 Bacteria 7678
256 Ga0207639_10078805 3300026041 Bacteria 2602
257 Ga0207639_10290415 3300026041 Bacteria 1442
258 Ga0207639_10851319 3300026041 Bacteria 851
259 Ga0207678_10038888 3300026067 Bacteria 4131
260 Ga0207678_10071764 3300026067 Bacteria 2968
261 Ga0207702_10163113 3300026078 Bacteria 2037
262 Ga0207641_10000098 3300026088 Bacteria 123514
263 Ga0207641_10083693 3300026088 Bacteria 2775
264 Ga0207676_10010385 3300026095 Bacteria 6630
265 Ga0207676_11459174 3300026095 Bacteria 681
266 Ga0207674_10078554 3300026116 Bacteria 3305
267 Ga0207674_10099465 3300026116 Bacteria 2891
268 Ga0207674_10380065 3300026116 Bacteria 1365
269 Ga0207674_10645308 3300026116 Bacteria 1022
270 Ga0207675_100400608 3300026118 Bacteria 1352
271 Ga0207683_10148294 3300026121 Bacteria 2116
272 Ga0207698_10369724 3300026142 Bacteria 1360
273 Ga0209281_1011771 3300027111 Bacteria 1945
274 Ga0209983_1016964 3300027665 Bacteria 1505
275 Ga0209998_10063992 3300027717 Bacteria 870
276 Ga0268266_10005988 3300028379 Bacteria 11222
277 Ga0268266_10021490 3300028379 Bacteria 5497
278 Ga0268265_10002675 3300028380 Bacteria 13211
279 Ga0268265_10128282 3300028380 Bacteria 2103
280 Ga0268265_10633196 3300028380 Bacteria 1026
281 Ga0268264_10000224 3300028381 Bacteria 110355
282 Ga0268264_10081233 3300028381 Bacteria 2770
283 Ga0268264_10111744 3300028381 Bacteria 2394
284 Ga0265334_10234962 3300028573 Bacteria 633
285 Ga0307517_10032173 3300028786 Bacteria 6073
286 Ga0307517_10111580 3300028786 Bacteria 2077
287 Ga0307515_10452649 3300028794 Bacteria 899
288 Ga0307513_10030193 3300031456 Bacteria 6160
289 Ga0307513_10099351 3300031456 Bacteria 2939
290 Ga0307513_10231556 3300031456 Bacteria 1660
291 Ga0307509_10199470 3300031507 Bacteria 1840
292 Ga0307408_100074072 3300031548 Bacteria 2525
293 Ga0307508_10000011 3300031616 Bacteria 248001
294 Ga0316578_10107733 3300031728 Bacteria 1673
295 Ga0307405_10345683 3300031731 Bacteria 1145
296 Ga0307405_10613309 3300031731 Bacteria 890
297 Ga0307405_11591679 3300031731 Bacteria 576
298 Ga0307413_10184769 3300031824 Bacteria 1490
299 Ga0307413_10202556 3300031824 Bacteria 1434
300 Ga0307413_11111534 3300031824 Bacteria 683
301 Ga0307410_10012878 3300031852 Bacteria 4856
302 Ga0307410_10269910 3300031852 Bacteria 1330
303 Ga0307410_10361342 3300031852 Bacteria 1163
304 Ga0307410_10532590 3300031852 Bacteria 971
305 Ga0307406_10103492 3300031901 Bacteria 1944
306 Ga0307406_10288830 3300031901 Bacteria 1254
307 Ga0307407_10005479 3300031903 Bacteria 5512
308 Ga0307407_10402626 3300031903 Bacteria 982
309 Ga0307412_10002381 3300031911 Bacteria 10439
310 Ga0307412_10097536 3300031911 Bacteria 2071
311 Ga0307412_10269069 3300031911 Bacteria 1332
312 Ga0307412_10690497 3300031911 Bacteria 875
313 Ga0307409_100715686 3300031995 Bacteria 1002
314 Ga0307416_100160419 3300032002 Bacteria 2078
315 Ga0307416_100227030 3300032002 Bacteria 1796
316 Ga0307416_101992168 3300032002 Bacteria 683
317 Ga0307414_10003045 3300032004 Bacteria 8890
318 Ga0307414_10111869 3300032004 Bacteria 2080
319 Ga0307414_10134838 3300032004 Bacteria 1923
320 Ga0307414_10334220 3300032004 Bacteria 1294
321 Ga0307414_10366076 3300032004 Bacteria 1242
322 Ga0307414_10693448 3300032004 Bacteria 921
323 Ga0307411_10025542 3300032005 Bacteria 3541
324 Ga0307411_10207725 3300032005 Bacteria 1509
325 Ga0307411_10252648 3300032005 Bacteria 1387
326 Ga0307411_10337722 3300032005 Bacteria 1223
327 Ga0307411_11517193 3300032005 Bacteria 616
328 Ga0307415_100172675 3300032126 Bacteria 1687
329 Ga0307415_100786044 3300032126 Bacteria 867
330 Ga0316583_10001242 3300032133 Bacteria 8391
331 Ga0373937_0198592 3300036401 Bacteria 1885
332 Ga0316582_0020940 3300036647 Bacteria 3854
333 Ga0316581_0158025 3300037588 Bacteria 699
334 Ga0436364_0545952 3300037853 Bacteria 79385
335 Ga0436365_1367690 3300039437 Bacteria 824
336 Ga0439465_0058128 3300041413 Bacteria 1277
337 Ga0451791_1274022 3300041451 Bacteria 589
338 Ga0451791_1368899 3300041451 Bacteria 518
339 Ga0451791_1794905 3300041451 Bacteria 609
340 Ga0451807_2558812 3300041486 Bacteria 682
341 Ga0451837_0388540 3300041494 Bacteria 500
342 Ga0451847_0004174 3300041503 Bacteria 654
343 Ga0451851_0890183 3300041507 Bacteria 810
344 Ga0451843_1087739 3300041509 Bacteria 599
345 Ga0451853_2126796 3300041512 Bacteria 849
346 Ga0450890_018179 3300042127 Bacteria 940
347 Ga0439434_0031460 3300042435 Bacteria 1613
348 Ga0466965_0475167 3300044683 Bacteria 699
349 Ga0451576_0000017 3300045051 Bacteria 558261
350 Ga0451576_1284389 3300045051 Bacteria 763
351 Ga0495650_0073152 3300046471 Bacteria 1340
352 Ga0495585_0186864 3300046492 Bacteria 1062
353 Ga0495648_0364478 3300046524 Bacteria 656
354 Ga0495666_0039961 3300046526 Bacteria 2276
355 Ga0495654_0302362 3300046530 Bacteria 653
356 Ga0495598_0127566 3300046537 Bacteria 869
357 Ga0495621_0010980 3300046539 Bacteria 2787
358 Ga0495625_0000094 3300046660 Bacteria 144517
359 Ga0495670_0000016 3300046691 Bacteria 128045
360 Ga0495670_0054475 3300046691 Bacteria 2004
361 Ga0495670_0466083 3300046691 Bacteria 685
362 Ga0495672_0335753 3300047320 Bacteria 706
363 Ga0495681_0214730 3300047470 Bacteria 774
364 Ga0495686_0247187 3300047472 Bacteria 1004
365 Ga0495615_0007307 3300048090 Bacteria 2091
366 Ga0496100_0190025 3300048903 Bacteria 1490
367 Ga0496100_0739465 3300048903 Bacteria 769
368 Ga0496101_0046344 3300048904 Bacteria 3117
369 Ga0496102_0067865 3300048905 Bacteria 3271
370 Ga0496103_0017415 3300048906 Bacteria 4300
371 Ga0496103_0629934 3300048906 Bacteria 682
372 Ga0496103_0762269 3300048906 Bacteria 611
373 Ga0496104_0090530 3300048907 Bacteria 2923
374 Ga0496104_0408310 3300048907 Bacteria 1270
375 Ga0496105_0013455 3300048908 Bacteria 6495
376 Ga0496105_0076140 3300048908 Bacteria 2770
377 Ga0496106_0005097 3300048909 Bacteria 9726
378 Ga0496107_0010144 3300048910 Bacteria 6534
379 Ga0496108_0021289 3300048911 Bacteria 5329
380 Ga0496108_0168946 3300048911 Bacteria 1892
381 Ga0496109_0106648 3300048912 Bacteria 2602
382 Ga0496111_0027115 3300048914 Bacteria 4050
383 Ga0496112_0282853 3300048915 Bacteria 1605
384 Ga0496113_0020024 3300048916 Bacteria 4694
385 Ga0496114_0413007 3300048917 Bacteria 1195
386 Ga0496115_0001166 3300048918 Bacteria 18830
387 Ga0496118_0109422 3300048921 Bacteria 1839
388 Ga0496120_0056862 3300048923 Bacteria 2205
389 Ga0496121_0000276 3300048924 Bacteria 107058
390 Ga0496121_0392561 3300048924 Bacteria 911
391 Ga0496122_0137465 3300048925 Bacteria 1536
392 Ga0496123_0055545 3300048926 Bacteria 2596
393 Ga0496124_0000675 3300048927 Bacteria 56113
394 Ga0496124_0008603 3300048927 Bacteria 10645
395 Ga0496125_0184909 3300048928 Bacteria 1383
396 Ga0496125_0226076 3300048928 Bacteria 1201
397 Ga0496125_0450855 3300048928 Bacteria 737
398 Ga0496126_0138921 3300048929 Bacteria 2093
399 Ga0501290_018506 3300049513 Bacteria 939
400 Ga0501292_000013 3300049515 Bacteria 65866
401 Ga0501293_009077 3300049516 Bacteria 844
402 Ga0501294_004900 3300049517 Bacteria 1265
403 Ga0501300_003447 3300049523 Bacteria 2364
404 Ga0501300_006273 3300049523 Bacteria 1752
405 Ga0501315_053374 3300049531 Bacteria 639
406 Ga0501317_055566 3300049533 Bacteria 639
407 Ga0501032_0909405 3300049569 Bacteria 554
408 Ga0501033_0053763 3300049570 Bacteria 2981
409 Ga0501034_0009756 3300049571 Bacteria 10040
410 Ga0501034_0029942 3300049571 Bacteria 5533
411 Ga0501036_0027242 3300049572 Bacteria 4828
412 Ga0501036_0495554 3300049572 Bacteria 1017
413 Ga0501037_0096601 3300049573 Bacteria 2135
414 Ga0501037_0358439 3300049573 Bacteria 1005
415 Ga0501038_0062429 3300049574 Bacteria 3183
416 Ga0501040_0716979 3300049576 Bacteria 723
417 Ga0501042_0095641 3300049578 Bacteria 2134
418 Ga0501042_0343811 3300049578 Bacteria 1079
419 Ga0501046_0498102 3300049580 Bacteria 873
420 Ga0501047_0236348 3300049581 Bacteria 1679
421 Ga0501048_0331102 3300049582 Bacteria 1085
422 Ga0501206_021297 3300049653 Bacteria 925
423 Ga0501222_000744 3300049662 Bacteria 4715
424 Ga0501223_000447 3300049663 Bacteria 9956
425 Ga0501224_028867 3300049664 Bacteria 830
426 Ga0501227_039492 3300049665 Bacteria 1162
427 Ga0501227_153721 3300049665 Bacteria 636
428 Ga0501233_000149 3300049668 Bacteria 10087
429 Ga0501233_103076 3300049668 Bacteria 756
430 Ga0501236_054647 3300049670 Bacteria 694
431 Ga0501257_000010 3300049686 Bacteria 53242
432 Ga0501257_111949 3300049686 Bacteria 724
433 Ga0501259_000881 3300049688 Bacteria 4947
434 Ga0501261_000272 3300049690 Bacteria 7118
435 Ga0501221_008430 3300049704 Bacteria 1792
436 Ga0501225_0002623 3300049705 Bacteria 5521
437 Ga0501245_026078 3300049708 Bacteria 942
438 Ga0501241_006510 3300049758 Bacteria 2149
439 Ga0501279_000004 3300049775 Bacteria 175612
440 Ga0501280_000054 3300049776 Bacteria 33149
441 Ga0501280_015484 3300049776 Bacteria 1093
442 Ga0501281_02871 3300049777 Bacteria 1243
443 Ga0501282_000366 3300049778 Bacteria 5425
444 Ga0501283_021039 3300049779 Bacteria 1043
445 Ga0501035_0090616 3300049822 Bacteria 2691
446 Ga0501035_0495642 3300049822 Bacteria 1006
447 Ga0501035_0524721 3300049822 Bacteria 972
448 Ga0501035_1488216 3300049822 Bacteria 517
449 Ga0501044_0383504 3300049823 Bacteria 1320
450 Ga0501044_0791058 3300049823 Bacteria 828
451 nmdc:mga03683_298639_c1 3300050489 Bacteria 755
452 nmdc:mga00v17_23348_c1 3300050491 Bacteria 3576
453 nmdc:mga00v17_82975_c1 3300050491 Bacteria 2004
454 nmdc:mga0k408_96178_c1 3300050493 Bacteria 1743
455 nmdc:mga07m45_19876_c2 3300050496 Bacteria 3242
456 Ga0500643_000566 3300053087 Bacteria 25752
457 Ga0500555_033828 3300053103 Bacteria 1440
458 Ga0500595_022041 3300053119 Bacteria 2263
459 Ga0500607_000023 3300053121 Bacteria 97892
460 Ga0500626_086911 3300053128 Bacteria 1376
461 Ga0500652_111710 3300053131 Bacteria 1142
462 Ga0500559_0001189 3300053136 Bacteria 15470
463 Ga0500559_0158151 3300053136 Bacteria 1064
464 Ga0500559_0229684 3300053136 Bacteria 875
465 Ga0500559_0322127 3300053136 Bacteria 724
466 Ga0500568_0017156 3300053139 Bacteria 3203
467 Ga0500604_0168030 3300053151 Bacteria 749
468 Ga0500616_0099003 3300053153 Bacteria 1429
469 Ga0500636_0392927 3300053177 Bacteria 646
470 Ga0500637_0022998 3300053178 Bacteria 3402
471 Ga0500645_001934 3300053730 Bacteria 9832
472 Ga0500596_004081 3300053735 Bacteria 2708
473 Ga0501082_1193202 3300060353 Bacteria 665

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100097146 Ga0070689_1000971462 130
2 3300031728 Ga0316578_10107733 Ga0316578_101077332 133
3 3300032133 Ga0316583_10001242 Ga0316583_100012426 133
4 3300036647 Ga0316582_0020940 Ga0316582_0020940_2517_2978 133
5 3300037588 Ga0316581_0158025 Ga0316581_0158025_115_576 133
6 3300005327 Ga0070658_10012594 Ga0070658_100125942 135
7 3300005329 Ga0070683_100677233 Ga0070683_1006772332 135
8 3300005336 Ga0070680_100004738 Ga0070680_1000047386 135
9 3300005339 Ga0070660_100001566 Ga0070660_1000015664 135
10 3300005344 Ga0070661_100001080 Ga0070661_1000010801 135
11 3300005345 Ga0070692_10054709 Ga0070692_100547092 135
12 3300005366 Ga0070659_100002055 Ga0070659_1000020558 135
13 3300005457 Ga0070662_100000296 Ga0070662_10000029610 135
14 3300005458 Ga0070681_10000704 Ga0070681_1000070414 135
15 3300005530 Ga0070679_100009470 Ga0070679_1000094704 135
16 3300005539 Ga0068853_100005067 Ga0068853_1000050676 135
17 3300005547 Ga0070693_100087616 Ga0070693_1000876162 135
18 3300005563 Ga0068855_100002306 Ga0068855_10000230622 135
19 3300005564 Ga0070664_100000599 Ga0070664_10000059923 135
20 3300005577 Ga0068857_100279118 Ga0068857_1002791181 135
21 3300005578 Ga0068854_100374948 Ga0068854_1003749483 135
22 3300005614 Ga0068856_100254561 Ga0068856_1002545612 135
23 3300005834 Ga0068851_10219683 Ga0068851_102196832 135
24 3300006195 Ga0075366_10318475 Ga0075366_103184751 135
25 3300009174 Ga0105241_10052927 Ga0105241_100529272 135
26 3300013100 Ga0157373_10042182 Ga0157373_100421822 135
27 3300013102 Ga0157371_10000838 Ga0157371_1000083811 135
28 3300013104 Ga0157370_10000287 Ga0157370_1000028720 135
29 3300013105 Ga0157369_10097615 Ga0157369_100976152 135
30 3300013307 Ga0157372_10004576 Ga0157372_1000457613 135
31 3300025321 Ga0207656_10246419 Ga0207656_102464191 135
32 3300025909 Ga0207705_10154843 Ga0207705_101548432 135
33 3300025912 Ga0207707_10015569 Ga0207707_100155692 135
34 3300025917 Ga0207660_10004662 Ga0207660_100046624 135
35 3300025919 Ga0207657_10000237 Ga0207657_1000023725 135
36 3300025921 Ga0207652_10003065 Ga0207652_1000306510 135
37 3300025932 Ga0207690_10000321 Ga0207690_100003214 135
38 3300025933 Ga0207706_10001328 Ga0207706_100013289 135
39 3300025944 Ga0207661_10097375 Ga0207661_100973753 135
40 3300025945 Ga0207679_10037614 Ga0207679_100376142 135
41 3300025949 Ga0207667_10000686 Ga0207667_1000068626 135
42 3300025981 Ga0207640_10118101 Ga0207640_101181012 135
43 3300026041 Ga0207639_10007020 Ga0207639_100070209 135
44 3300026078 Ga0207702_10163113 Ga0207702_101631132 135
45 3300026095 Ga0207676_11459174 Ga0207676_114591741 135
46 3300026116 Ga0207674_10099465 Ga0207674_100994653 135
47 3300032005 Ga0307411_10337722 Ga0307411_103377221 135
48 3300046537 Ga0495598_0127566 Ga0495598_0127566_162_611 135
49 3300046539 Ga0495621_0010980 Ga0495621_0010980_687_1136 135
50 3300048090 Ga0495615_0007307 Ga0495615_0007307_584_1033 135
51 3300050493 nmdc:mga0k408_96178_c1 nmdc:mga0k408_96178_c1_734_1183 135
52 3300005834 Ga0068851_10423387 Ga0068851_104233872 136
53 3300025972 Ga0207668_10824170 Ga0207668_108241702 136
54 3300026142 Ga0207698_10369724 Ga0207698_103697242 136
55 3300049576 Ga0501040_0716979 Ga0501040_0716979_64_507 136
56 3300049578 Ga0501042_0095641 Ga0501042_0095641_1330_1773 136
57 3300048929 Ga0496126_0138921 Ga0496126_0138921_1155_1604 137
58 3300005327 Ga0070658_10034843 Ga0070658_100348433 138
59 3300013307 Ga0157372_10524253 Ga0157372_105242532 138
60 3300027665 Ga0209983_1016964 Ga0209983_10169642 138
61 3300005539 Ga0068853_100035221 Ga0068853_1000352211 139
62 3300013307 Ga0157372_10466031 Ga0157372_104660312 139
63 3300025981 Ga0207640_10540210 Ga0207640_105402102 139
64 3300026041 Ga0207639_10851319 Ga0207639_108513192 139
65 3300031731 Ga0307405_11591679 Ga0307405_115916791 139
66 3300031824 Ga0307413_11111534 Ga0307413_111115342 139
67 3300031852 Ga0307410_10012878 Ga0307410_100128781 139
68 3300031901 Ga0307406_10288830 Ga0307406_102888301 139
69 3300031903 Ga0307407_10005479 Ga0307407_100054794 139
70 3300031903 Ga0307407_10402626 Ga0307407_104026261 139
71 3300032002 Ga0307416_100160419 Ga0307416_1001604192 139
72 3300032002 Ga0307416_101992168 Ga0307416_1019921681 139
73 3300032004 Ga0307414_10366076 Ga0307414_103660762 139
74 3300032005 Ga0307411_10025542 Ga0307411_100255422 139
75 3300032126 Ga0307415_100172675 Ga0307415_1001726752 139
76 3300032126 Ga0307415_100786044 Ga0307415_1007860441 139
77 3300041494 Ga0451837_0388540 Ga0451837_0388540_44_481 139
78 3300048928 Ga0496125_0450855 Ga0496125_0450855_188_673 140
79 3300050491 nmdc:mga00v17_23348_c1 nmdc:mga00v17_23348_c1_702_1190 140
80 3300005327 Ga0070658_10918574 Ga0070658_109185741 141
81 3300005354 Ga0070675_100143703 Ga0070675_1001437033 141
82 3300005355 Ga0070671_101145475 Ga0070671_1011454751 141
83 3300005366 Ga0070659_100103597 Ga0070659_1001035972 141
84 3300005455 Ga0070663_100047846 Ga0070663_1000478462 141
85 3300005455 Ga0070663_100456199 Ga0070663_1004561991 141
86 3300005457 Ga0070662_100030113 Ga0070662_1000301134 141
87 3300005457 Ga0070662_100091571 Ga0070662_1000915712 141
88 3300005530 Ga0070679_100084575 Ga0070679_1000845752 141
89 3300005535 Ga0070684_100845035 Ga0070684_1008450352 141
90 3300005539 Ga0068853_100641939 Ga0068853_1006419392 141
91 3300005563 Ga0068855_100009460 Ga0068855_1000094609 141
92 3300005563 Ga0068855_100185629 Ga0068855_1001856292 141
93 3300005563 Ga0068855_100238359 Ga0068855_1002383592 141
94 3300005577 Ga0068857_100033196 Ga0068857_1000331962 141
95 3300009093 Ga0105240_10369510 Ga0105240_103695102 141
96 3300011119 Ga0105246_10003891 Ga0105246_1000389110 141
97 3300013307 Ga0157372_10266782 Ga0157372_102667823 141
98 3300025909 Ga0207705_10066559 Ga0207705_100665591 141
99 3300025909 Ga0207705_10487187 Ga0207705_104871872 141
100 3300025914 Ga0207671_10489463 Ga0207671_104894631 141
101 3300025917 Ga0207660_10376707 Ga0207660_103767072 141
102 3300025919 Ga0207657_10038981 Ga0207657_100389812 141
103 3300025920 Ga0207649_10137340 Ga0207649_101373402 141
104 3300025921 Ga0207652_10022405 Ga0207652_100224055 141
105 3300025932 Ga0207690_10125940 Ga0207690_101259402 141
106 3300025933 Ga0207706_10008461 Ga0207706_100084615 141
107 3300025933 Ga0207706_10076727 Ga0207706_100767273 141
108 3300025949 Ga0207667_10029439 Ga0207667_100294392 141
109 3300025949 Ga0207667_10094877 Ga0207667_100948772 141
110 3300026041 Ga0207639_10290415 Ga0207639_102904152 141
111 3300026067 Ga0207678_10038888 Ga0207678_100388884 141
112 3300026067 Ga0207678_10071764 Ga0207678_100717642 141
113 3300026116 Ga0207674_10078554 Ga0207674_100785544 141
114 3300028573 Ga0265334_10234962 Ga0265334_102349622 141
115 3300045051 Ga0451576_1284389 Ga0451576_1284389_32_517 141
116 3300001979 JGI24740J21852_10005324 JGI24740J21852_100053247 142
117 3300001989 JGI24739J22299_10031522 JGI24739J22299_100315222 142
118 3300002459 JGI24751J29686_10000248 JGI24751J29686_1000024810 142
119 3300003322 rootL2_10265637 rootL2_102656372 142
120 3300003781 Ga0055536_1002780 Ga0055536_10027806 142
121 3300003781 Ga0055536_1010687 Ga0055536_10106872 142
122 3300003791 Ga0055530_10000115 Ga0055530_100001152 142
123 3300003791 Ga0055530_10046727 Ga0055530_100467271 142
124 3300003794 Ga0055531_10039285 Ga0055531_100392852 142
125 3300003794 Ga0055531_10039478 Ga0055531_100394782 142
126 3300005327 Ga0070658_10448353 Ga0070658_104483532 142
127 3300005330 Ga0070690_100099382 Ga0070690_1000993823 142
128 3300005331 Ga0070670_100245654 Ga0070670_1002456542 142
129 3300005333 Ga0070677_10026023 Ga0070677_100260232 142
130 3300005335 Ga0070666_10046282 Ga0070666_100462824 142
131 3300005338 Ga0068868_100436311 Ga0068868_1004363112 142
132 3300005343 Ga0070687_100332802 Ga0070687_1003328021 142
133 3300005353 Ga0070669_100003265 Ga0070669_1000032652 142
134 3300005354 Ga0070675_100007371 Ga0070675_1000073712 142
135 3300005355 Ga0070671_100000268 Ga0070671_1000002687 142
136 3300005355 Ga0070671_100154261 Ga0070671_1001542612 142
137 3300005364 Ga0070673_100125776 Ga0070673_1001257762 142
138 3300005367 Ga0070667_100000377 Ga0070667_10000037718 142
139 3300005367 Ga0070667_100007492 Ga0070667_1000074923 142
140 3300005367 Ga0070667_100343349 Ga0070667_1003433492 142
141 3300005456 Ga0070678_100167875 Ga0070678_1001678751 142
142 3300005466 Ga0070685_10196035 Ga0070685_101960351 142
143 3300005543 Ga0070672_100072979 Ga0070672_1000729794 142
144 3300005544 Ga0070686_100010084 Ga0070686_1000100844 142
145 3300005548 Ga0070665_100023655 Ga0070665_1000236556 142
146 3300005548 Ga0070665_100392343 Ga0070665_1003923432 142
147 3300005548 Ga0070665_100861413 Ga0070665_1008614132 142
148 3300005564 Ga0070664_100167768 Ga0070664_1001677681 142
149 3300005577 Ga0068857_100383943 Ga0068857_1003839432 142
150 3300005578 Ga0068854_100172336 Ga0068854_1001723363 142
151 3300005614 Ga0068856_100534174 Ga0068856_1005341741 142
152 3300005617 Ga0068859_100128494 Ga0068859_1001284942 142
153 3300005617 Ga0068859_100220912 Ga0068859_1002209121 142
154 3300005617 Ga0068859_100323717 Ga0068859_1003237172 142
155 3300005618 Ga0068864_100107408 Ga0068864_1001074083 142
156 3300005834 Ga0068851_10133232 Ga0068851_101332322 142
157 3300005841 Ga0068863_100097552 Ga0068863_1000975522 142
158 3300005841 Ga0068863_100147109 Ga0068863_1001471092 142
159 3300005841 Ga0068863_100476409 Ga0068863_1004764092 142
160 3300005842 Ga0068858_100000803 Ga0068858_10000080313 142
161 3300005842 Ga0068858_100048753 Ga0068858_1000487533 142
162 3300005843 Ga0068860_100002959 Ga0068860_10000295912 142
163 3300005843 Ga0068860_100106589 Ga0068860_1001065892 142
164 3300005844 Ga0068862_100083545 Ga0068862_1000835452 142
165 3300005844 Ga0068862_100854420 Ga0068862_1008544202 142
166 3300006195 Ga0075366_10008138 Ga0075366_100081384 142
167 3300006931 Ga0097620_100128492 Ga0097620_1001284922 142
168 3300006931 Ga0097620_100220904 Ga0097620_1002209042 142
169 3300006931 Ga0097620_100323729 Ga0097620_1003237292 142
170 3300006931 Ga0097620_100384559 Ga0097620_1003845592 142
171 3300006946 Ga0079104_1011144 Ga0079104_10111442 142
172 3300009093 Ga0105240_10205345 Ga0105240_102053452 142
173 3300009093 Ga0105240_11217437 Ga0105240_112174371 142
174 3300009098 Ga0105245_10012492 Ga0105245_100124922 142
175 3300009101 Ga0105247_10051830 Ga0105247_100518301 142
176 3300009148 Ga0105243_10076652 Ga0105243_100766522 142
177 3300009176 Ga0105242_10258378 Ga0105242_102583782 142
178 3300009177 Ga0105248_10028901 Ga0105248_100289013 142
179 3300009545 Ga0105237_10367034 Ga0105237_103670342 142
180 3300009545 Ga0105237_10763565 Ga0105237_107635651 142
181 3300009551 Ga0105238_10721954 Ga0105238_107219542 142
182 3300009553 Ga0105249_10197558 Ga0105249_101975582 142
183 3300013296 Ga0157374_10342730 Ga0157374_103427302 142
184 3300013297 Ga0157378_10036010 Ga0157378_100360102 142
185 3300013306 Ga0163162_10097805 Ga0163162_100978052 142
186 3300013306 Ga0163162_10351772 Ga0163162_103517721 142
187 3300013308 Ga0157375_10113547 Ga0157375_101135472 142
188 3300013308 Ga0157375_10924373 Ga0157375_109243732 142
189 3300014325 Ga0163163_10191752 Ga0163163_101917521 142
190 3300014745 Ga0157377_10485968 Ga0157377_104859681 142
191 3300017792 Ga0163161_10161869 Ga0163161_101618692 142
192 3300025250 Ga0209026_1024863 Ga0209026_10248632 142
193 3300025272 Ga0209455_1018055 Ga0209455_10180552 142
194 3300025291 Ga0209675_1000104 Ga0209675_100010452 142
195 3300025292 Ga0209676_1000512 Ga0209676_100051233 142
196 3300025292 Ga0209676_1001456 Ga0209676_10014562 142
197 3300025292 Ga0209676_1018292 Ga0209676_10182923 142
198 3300025294 Ga0209025_1020363 Ga0209025_10203633 142
199 3300025294 Ga0209025_1056248 Ga0209025_10562482 142
200 3300025297 Ga0209758_1041823 Ga0209758_10418232 142
201 3300025298 Ga0209050_1000286 Ga0209050_100028665 142
202 3300025298 Ga0209050_1003173 Ga0209050_10031732 142
203 3300025304 Ga0209257_1000245 Ga0209257_100024561 142
204 3300025304 Ga0209257_1000321 Ga0209257_100032127 142
205 3300025304 Ga0209257_1002319 Ga0209257_100231913 142
206 3300025315 Ga0207697_10043975 Ga0207697_100439752 142
207 3300025900 Ga0207710_10062599 Ga0207710_100625991 142
208 3300025913 Ga0207695_10617947 Ga0207695_106179472 142
209 3300025923 Ga0207681_10000260 Ga0207681_100002602 142
210 3300025924 Ga0207694_10023969 Ga0207694_100239694 142
211 3300025926 Ga0207659_10021746 Ga0207659_100217462 142
212 3300025927 Ga0207687_10003478 Ga0207687_100034788 142
213 3300025931 Ga0207644_10000008 Ga0207644_10000008350 142
214 3300025931 Ga0207644_10319835 Ga0207644_103198352 142
215 3300025940 Ga0207691_10109620 Ga0207691_101096202 142
216 3300025941 Ga0207711_10119135 Ga0207711_101191353 142
217 3300025941 Ga0207711_10142917 Ga0207711_101429172 142
218 3300025949 Ga0207667_10000881 Ga0207667_1000088110 142
219 3300025949 Ga0207667_10305402 Ga0207667_103054021 142
220 3300025960 Ga0207651_10611176 Ga0207651_106111761 142
221 3300025972 Ga0207668_10041281 Ga0207668_100412812 142
222 3300025986 Ga0207658_10000813 Ga0207658_100008136 142
223 3300025986 Ga0207658_10055762 Ga0207658_100557622 142
224 3300025986 Ga0207658_10141750 Ga0207658_101417502 142
225 3300026023 Ga0207677_10377139 Ga0207677_103771392 142
226 3300026035 Ga0207703_10001170 Ga0207703_1000117014 142
227 3300026035 Ga0207703_10018441 Ga0207703_100184412 142
228 3300026035 Ga0207703_10087280 Ga0207703_100872802 142
229 3300026088 Ga0207641_10083693 Ga0207641_100836932 142
230 3300026116 Ga0207674_10380065 Ga0207674_103800652 142
231 3300026116 Ga0207674_10645308 Ga0207674_106453081 142
232 3300026118 Ga0207675_100400608 Ga0207675_1004006081 142
233 3300026121 Ga0207683_10148294 Ga0207683_101482942 142
234 3300027111 Ga0209281_1011771 Ga0209281_10117712 142
235 3300028379 Ga0268266_10021490 Ga0268266_100214907 142
236 3300028380 Ga0268265_10128282 Ga0268265_101282823 142
237 3300028380 Ga0268265_10633196 Ga0268265_106331961 142
238 3300028381 Ga0268264_10081233 Ga0268264_100812331 142
239 3300028381 Ga0268264_10111744 Ga0268264_101117442 142
240 3300028786 Ga0307517_10032173 Ga0307517_100321737 142
241 3300028794 Ga0307515_10452649 Ga0307515_104526492 142
242 3300031456 Ga0307513_10030193 Ga0307513_100301937 142
243 3300031456 Ga0307513_10099351 Ga0307513_100993512 142
244 3300031507 Ga0307509_10199470 Ga0307509_101994702 142
245 3300031616 Ga0307508_10000011 Ga0307508_1000001117 142
246 3300031911 Ga0307412_10097536 Ga0307412_100975362 142
247 3300032004 Ga0307414_10003045 Ga0307414_100030451 142
248 3300032004 Ga0307414_10134838 Ga0307414_101348381 142
249 3300032004 Ga0307414_10334220 Ga0307414_103342202 142
250 3300032005 Ga0307411_10207725 Ga0307411_102077252 142
251 3300036401 Ga0373937_0198592 Ga0373937_0198592_704_1141 142
252 3300041451 Ga0451791_1368899 Ga0451791_1368899_11_457 142
253 3300041486 Ga0451807_2558812 Ga0451807_2558812_133_567 142
254 3300041507 Ga0451851_0890183 Ga0451851_0890183_148_582 142
255 3300041512 Ga0451853_2126796 Ga0451853_2126796_209_643 142
256 3300045051 Ga0451576_0000017 Ga0451576_0000017_108642_109109 142
257 3300046471 Ga0495650_0073152 Ga0495650_0073152_692_1129 142
258 3300046492 Ga0495585_0186864 Ga0495585_0186864_70_513 142
259 3300047320 Ga0495672_0335753 Ga0495672_0335753_133_567 142
260 3300047470 Ga0495681_0214730 Ga0495681_0214730_43_516 142
261 3300048903 Ga0496100_0190025 Ga0496100_0190025_585_1073 142
262 3300048904 Ga0496101_0046344 Ga0496101_0046344_1340_1828 142
263 3300048905 Ga0496102_0067865 Ga0496102_0067865_811_1299 142
264 3300048906 Ga0496103_0017415 Ga0496103_0017415_2553_3041 142
265 3300048907 Ga0496104_0090530 Ga0496104_0090530_1553_2041 142
266 3300048908 Ga0496105_0076140 Ga0496105_0076140_86_574 142
267 3300048909 Ga0496106_0005097 Ga0496106_0005097_418_906 142
268 3300048910 Ga0496107_0010144 Ga0496107_0010144_1978_2466 142
269 3300048911 Ga0496108_0021289 Ga0496108_0021289_3398_3886 142
270 3300048911 Ga0496108_0168946 Ga0496108_0168946_1279_1713 142
271 3300048912 Ga0496109_0106648 Ga0496109_0106648_1584_2072 142
272 3300048914 Ga0496111_0027115 Ga0496111_0027115_1838_2326 142
273 3300048915 Ga0496112_0282853 Ga0496112_0282853_481_969 142
274 3300048916 Ga0496113_0020024 Ga0496113_0020024_3215_3703 142
275 3300048917 Ga0496114_0413007 Ga0496114_0413007_110_598 142
276 3300049569 Ga0501032_0909405 Ga0501032_0909405_107_541 142
277 3300049570 Ga0501033_0053763 Ga0501033_0053763_1879_2331 142
278 3300049571 Ga0501034_0029942 Ga0501034_0029942_208_660 142
279 3300049572 Ga0501036_0027242 Ga0501036_0027242_1659_2111 142
280 3300049573 Ga0501037_0096601 Ga0501037_0096601_1360_1812 142
281 3300049574 Ga0501038_0062429 Ga0501038_0062429_2684_3136 142
282 3300049578 Ga0501042_0343811 Ga0501042_0343811_160_612 142
283 3300049580 Ga0501046_0498102 Ga0501046_0498102_159_611 142
284 3300049581 Ga0501047_0236348 Ga0501047_0236348_811_1245 142
285 3300049582 Ga0501048_0331102 Ga0501048_0331102_171_623 142
286 3300049822 Ga0501035_0090616 Ga0501035_0090616_373_825 142
287 3300049822 Ga0501035_0495642 Ga0501035_0495642_523_993 142
288 3300049822 Ga0501035_0524721 Ga0501035_0524721_269_721 142
289 3300049822 Ga0501035_1488216 Ga0501035_1488216_37_471 142
290 3300049823 Ga0501044_0383504 Ga0501044_0383504_81_515 142
291 3300049823 Ga0501044_0791058 Ga0501044_0791058_221_655 142
292 3300053119 Ga0500595_022041 Ga0500595_022041_268_729 142
293 3300053136 Ga0500559_0158151 Ga0500559_0158151_598_1041 142
294 3300053136 Ga0500559_0229684 Ga0500559_0229684_185_622 142
295 3300053735 Ga0500596_004081 Ga0500596_004081_895_1332 142
296 iso_pu_bacteria 2643221563 2643834965 142
297 iso_pu_bacteria 2643221608 2644055892 142
298 iso_pu_bacteria 2738541275 2738711220 142
299 iso_pu_bacteria 2738541301 2738849645 142
300 iso_pu_bacteria 2738541304 2738865374 142
301 iso_pu_bacteria 2738543022 2739297892 142
302 iso_pu_bacteria 2738543033 2739359570 142
303 iso_pu_bacteria 2852653556 2852655836 142
304 iso_pu_bacteria 2895880812 2895882321 142
305 iso_pu_bacteria 2928100450 2928103964 142
306 iso_pu_bacteria 2928959182 2928961492 142
307 3300000041 ARcpr5oldR_c004327 ARcpr5oldR_0043272 143
308 3300000043 ARcpr5yngRDRAFT_c005971 ARcpr5yngRDRAFT_0059712 143
309 3300001989 JGI24739J22299_10041287 JGI24739J22299_100412871 143
310 3300002774 JGI25150J39212_1000189 JGI25150J39212_10001891 143
311 3300002774 JGI25150J39212_1014466 JGI25150J39212_10144662 143
312 3300003187 JGI25151J46595_10037663 JGI25151J46595_100376633 143
313 3300003214 JGI25165J46597_1000010 JGI25165J46597_1000010106 143
314 3300003215 JGI25153J46596_10000125 JGI25153J46596_1000012575 143
315 3300003215 JGI25153J46596_10021376 JGI25153J46596_100213763 143
316 3300003771 Ga0055526_1026363 Ga0055526_10263632 143
317 3300003773 Ga0055537_1000852 Ga0055537_100085216 143
318 3300003775 Ga0055524_1000387 Ga0055524_10003878 143
319 3300003781 Ga0055536_1005046 Ga0055536_10050463 143
320 3300003790 Ga0055528_1020769 Ga0055528_10207692 143
321 3300003791 Ga0055530_10001385 Ga0055530_100013857 143
322 3300003791 Ga0055530_10011223 Ga0055530_100112234 143
323 3300003791 Ga0055530_10031272 Ga0055530_100312721 143
324 3300003792 Ga0055540_1001895 Ga0055540_100189510 143
325 3300003794 Ga0055531_10007918 Ga0055531_100079182 143
326 3300003794 Ga0055531_10041570 Ga0055531_100415701 143
327 3300003794 Ga0055531_10058207 Ga0055531_100582072 143
328 3300005262 Ga0065165_1010466 Ga0065165_10104662 143
329 3300005262 Ga0065165_1095073 Ga0065165_10950732 143
330 3300005262 Ga0065165_1100922 Ga0065165_11009221 143
331 3300005335 Ga0070666_10409910 Ga0070666_104099101 143
332 3300005355 Ga0070671_100593314 Ga0070671_1005933142 143
333 3300005367 Ga0070667_100011507 Ga0070667_1000115074 143
334 3300005548 Ga0070665_100025894 Ga0070665_1000258942 143
335 3300005578 Ga0068854_100169228 Ga0068854_1001692282 143
336 3300005618 Ga0068864_100001638 Ga0068864_1000016387 143
337 3300005841 Ga0068863_100000778 Ga0068863_1000007782 143
338 3300005843 Ga0068860_100000422 Ga0068860_10000042232 143
339 3300005844 Ga0068862_100022982 Ga0068862_1000229823 143
340 3300005985 Ga0081539_10115794 Ga0081539_101157941 143
341 3300006051 Ga0075364_10000934 Ga0075364_100009348 143
342 3300009177 Ga0105248_10161041 Ga0105248_101610412 143
343 3300009545 Ga0105237_10032356 Ga0105237_100323564 143
344 3300010375 Ga0105239_10312085 Ga0105239_103120853 143
345 3300013102 Ga0157371_10048467 Ga0157371_100484671 143
346 3300021388 Ga0213875_10000166 Ga0213875_1000016645 143
347 3300025245 Ga0207425_1000005 Ga0207425_1000005838 143
348 3300025258 Ga0209129_1000345 Ga0209129_10003451 143
349 3300025261 Ga0209233_1000044 Ga0209233_1000044377 143
350 3300025263 Ga0209565_1000052 Ga0209565_1000052215 143
351 3300025273 Ga0209673_1051784 Ga0209673_10517842 143
352 3300025292 Ga0209676_1012010 Ga0209676_10120102 143
353 3300025294 Ga0209025_1001007 Ga0209025_100100741 143
354 3300025295 Ga0209564_1018743 Ga0209564_10187434 143
355 3300025295 Ga0209564_1022881 Ga0209564_10228813 143
356 3300025297 Ga0209758_1000002 Ga0209758_1000002507 143
357 3300025298 Ga0209050_1000001 Ga0209050_1000001458 143
358 3300025298 Ga0209050_1021898 Ga0209050_10218983 143
359 3300025302 Ga0207426_1006259 Ga0207426_10062591 143
360 3300025303 Ga0209051_1000472 Ga0209051_100047246 143
361 3300025304 Ga0209257_1011475 Ga0209257_10114752 143
362 3300025304 Ga0209257_1041739 Ga0209257_10417392 143
363 3300025903 Ga0207680_10238749 Ga0207680_102387491 143
364 3300025914 Ga0207671_10002056 Ga0207671_1000205624 143
365 3300025923 Ga0207681_10213351 Ga0207681_102133512 143
366 3300025931 Ga0207644_10449883 Ga0207644_104498831 143
367 3300025934 Ga0207686_10155988 Ga0207686_101559882 143
368 3300025941 Ga0207711_11209712 Ga0207711_112097122 143
369 3300025961 Ga0207712_11109327 Ga0207712_111093272 143
370 3300025981 Ga0207640_10003971 Ga0207640_100039715 143
371 3300025981 Ga0207640_10441555 Ga0207640_104415551 143
372 3300025986 Ga0207658_10002531 Ga0207658_100025315 143
373 3300026041 Ga0207639_10078805 Ga0207639_100788052 143
374 3300026088 Ga0207641_10000098 Ga0207641_10000098101 143
375 3300026095 Ga0207676_10010385 Ga0207676_100103854 143
376 3300027717 Ga0209998_10063992 Ga0209998_100639922 143
377 3300028379 Ga0268266_10005988 Ga0268266_100059885 143
378 3300028380 Ga0268265_10002675 Ga0268265_100026752 143
379 3300028381 Ga0268264_10000224 Ga0268264_1000022416 143
380 3300028786 Ga0307517_10111580 Ga0307517_101115802 143
381 3300031456 Ga0307513_10231556 Ga0307513_102315561 143
382 3300031548 Ga0307408_100074072 Ga0307408_1000740722 143
383 3300031731 Ga0307405_10345683 Ga0307405_103456832 143
384 3300031731 Ga0307405_10613309 Ga0307405_106133091 143
385 3300031824 Ga0307413_10184769 Ga0307413_101847692 143
386 3300031824 Ga0307413_10202556 Ga0307413_102025561 143
387 3300031852 Ga0307410_10269910 Ga0307410_102699102 143
388 3300031852 Ga0307410_10361342 Ga0307410_103613421 143
389 3300031852 Ga0307410_10532590 Ga0307410_105325902 143
390 3300031901 Ga0307406_10103492 Ga0307406_101034923 143
391 3300031911 Ga0307412_10002381 Ga0307412_1000238111 143
392 3300031911 Ga0307412_10269069 Ga0307412_102690692 143
393 3300031911 Ga0307412_10690497 Ga0307412_106904971 143
394 3300031995 Ga0307409_100715686 Ga0307409_1007156862 143
395 3300032002 Ga0307416_100227030 Ga0307416_1002270302 143
396 3300032004 Ga0307414_10111869 Ga0307414_101118692 143
397 3300032004 Ga0307414_10693448 Ga0307414_106934481 143
398 3300032005 Ga0307411_10252648 Ga0307411_102526481 143
399 3300032005 Ga0307411_11517193 Ga0307411_115171931 143
400 3300037853 Ga0436364_0545952 Ga0436364_0545952_37068_37523 143
401 3300039437 Ga0436365_1367690 Ga0436365_1367690_174_629 143
402 3300041413 Ga0439465_0058128 Ga0439465_0058128_310_780 143
403 3300041451 Ga0451791_1274022 Ga0451791_1274022_119_574 143
404 3300041451 Ga0451791_1794905 Ga0451791_1794905_14_448 143
405 3300041503 Ga0451847_0004174 Ga0451847_0004174_137_577 143
406 3300041509 Ga0451843_1087739 Ga0451843_1087739_76_543 143
407 3300042127 Ga0450890_018179 Ga0450890_018179_194_664 143
408 3300042435 Ga0439434_0031460 Ga0439434_0031460_650_1120 143
409 3300044683 Ga0466965_0475167 Ga0466965_0475167_131_565 143
410 3300046524 Ga0495648_0364478 Ga0495648_0364478_149_583 143
411 3300046526 Ga0495666_0039961 Ga0495666_0039961_1530_1991 143
412 3300046530 Ga0495654_0302362 Ga0495654_0302362_69_521 143
413 3300046660 Ga0495625_0000094 Ga0495625_0000094_82371_82808 143
414 3300046691 Ga0495670_0000016 Ga0495670_0000016_69229_69663 143
415 3300046691 Ga0495670_0054475 Ga0495670_0054475_1006_1443 143
416 3300046691 Ga0495670_0466083 Ga0495670_0466083_37_471 143
417 3300047472 Ga0495686_0247187 Ga0495686_0247187_154_588 143
418 3300048903 Ga0496100_0739465 Ga0496100_0739465_22_459 143
419 3300048906 Ga0496103_0629934 Ga0496103_0629934_162_599 143
420 3300048906 Ga0496103_0762269 Ga0496103_0762269_149_586 143
421 3300048907 Ga0496104_0408310 Ga0496104_0408310_692_1186 143
422 3300048908 Ga0496105_0013455 Ga0496105_0013455_5545_6039 143
423 3300048918 Ga0496115_0001166 Ga0496115_0001166_5919_6362 143
424 3300048921 Ga0496118_0109422 Ga0496118_0109422_321_833 143
425 3300048923 Ga0496120_0056862 Ga0496120_0056862_179_616 143
426 3300048924 Ga0496121_0000276 Ga0496121_0000276_89765_90277 143
427 3300048924 Ga0496121_0392561 Ga0496121_0392561_299_793 143
428 3300048925 Ga0496122_0137465 Ga0496122_0137465_141_578 143
429 3300048926 Ga0496123_0055545 Ga0496123_0055545_636_1073 143
430 3300048927 Ga0496124_0000675 Ga0496124_0000675_48062_48499 143
431 3300048927 Ga0496124_0008603 Ga0496124_0008603_6771_7208 143
432 3300048928 Ga0496125_0184909 Ga0496125_0184909_225_662 143
433 3300048928 Ga0496125_0226076 Ga0496125_0226076_415_855 143
434 3300049513 Ga0501290_018506 Ga0501290_018506_219_653 143
435 3300049515 Ga0501292_000013 Ga0501292_000013_48384_48818 143
436 3300049516 Ga0501293_009077 Ga0501293_009077_177_611 143
437 3300049517 Ga0501294_004900 Ga0501294_004900_431_865 143
438 3300049523 Ga0501300_003447 Ga0501300_003447_1721_2155 143
439 3300049523 Ga0501300_006273 Ga0501300_006273_491_925 143
440 3300049531 Ga0501315_053374 Ga0501315_053374_186_620 143
441 3300049533 Ga0501317_055566 Ga0501317_055566_186_620 143
442 3300049571 Ga0501034_0009756 Ga0501034_0009756_8175_8624 143
443 3300049572 Ga0501036_0495554 Ga0501036_0495554_405_854 143
444 3300049573 Ga0501037_0358439 Ga0501037_0358439_235_702 143
445 3300049653 Ga0501206_021297 Ga0501206_021297_308_742 143
446 3300049662 Ga0501222_000744 Ga0501222_000744_318_752 143
447 3300049663 Ga0501223_000447 Ga0501223_000447_3378_3812 143
448 3300049664 Ga0501224_028867 Ga0501224_028867_223_657 143
449 3300049665 Ga0501227_039492 Ga0501227_039492_537_971 143
450 3300049665 Ga0501227_153721 Ga0501227_153721_12_446 143
451 3300049668 Ga0501233_000149 Ga0501233_000149_1237_1686 143
452 3300049668 Ga0501233_103076 Ga0501233_103076_119_553 143
453 3300049670 Ga0501236_054647 Ga0501236_054647_226_660 143
454 3300049686 Ga0501257_000010 Ga0501257_000010_25502_25936 143
455 3300049686 Ga0501257_111949 Ga0501257_111949_124_558 143
456 3300049688 Ga0501259_000881 Ga0501259_000881_706_1140 143
457 3300049690 Ga0501261_000272 Ga0501261_000272_480_914 143
458 3300049704 Ga0501221_008430 Ga0501221_008430_618_1052 143
459 3300049705 Ga0501225_0002623 Ga0501225_0002623_655_1089 143
460 3300049708 Ga0501245_026078 Ga0501245_026078_312_746 143
461 3300049758 Ga0501241_006510 Ga0501241_006510_351_785 143
462 3300049775 Ga0501279_000004 Ga0501279_000004_75909_76343 143
463 3300049776 Ga0501280_000054 Ga0501280_000054_25341_25775 143
464 3300049776 Ga0501280_015484 Ga0501280_015484_353_787 143
465 3300049777 Ga0501281_02871 Ga0501281_02871_568_1002 143
466 3300049778 Ga0501282_000366 Ga0501282_000366_1297_1731 143
467 3300049779 Ga0501283_021039 Ga0501283_021039_502_936 143
468 3300050489 nmdc:mga03683_298639_c1 nmdc:mga03683_298639_c1_214_672 143
469 3300050491 nmdc:mga00v17_82975_c1 nmdc:mga00v17_82975_c1_467_925 143
470 3300050496 nmdc:mga07m45_19876_c2 nmdc:mga07m45_19876_c2_2624_3091 143
471 3300053087 Ga0500643_000566 Ga0500643_000566_767_1201 143
472 3300053103 Ga0500555_033828 Ga0500555_033828_576_1043 143
473 3300053121 Ga0500607_000023 Ga0500607_000023_458_925 143
474 3300053128 Ga0500626_086911 Ga0500626_086911_698_1168 143
475 3300053131 Ga0500652_111710 Ga0500652_111710_654_1088 143
476 3300053136 Ga0500559_0001189 Ga0500559_0001189_487_954 143
477 3300053136 Ga0500559_0322127 Ga0500559_0322127_220_702 143
478 3300053139 Ga0500568_0017156 Ga0500568_0017156_373_810 143
479 3300053151 Ga0500604_0168030 Ga0500604_0168030_270_707 143
480 3300053153 Ga0500616_0099003 Ga0500616_0099003_70_507 143
481 3300053177 Ga0500636_0392927 Ga0500636_0392927_11_457 143
482 3300053178 Ga0500637_0022998 Ga0500637_0022998_371_838 143
483 3300053730 Ga0500645_001934 Ga0500645_001934_9026_9493 143
484 3300060353 Ga0501082_1193202 Ga0501082_1193202_112_603 143
485 iso_pu_bacteria 2512564014 2512641670 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12100

DUF3576

Domain of unknown function (DUF3576)

50

151

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bq1-assembly2.cif.gz_B crystal structure of of lamacat from zobellia galactanivorans 0.6694 64 110
4bow-assembly2.cif.gz_B crystal structure of lama_e269s from z. galactanivorans in complex with laminaritriose and laminaritetraose 0.6387 64 112
7rct-assembly2.cif.gz_A non-receptor protein tyrosine phosphatase shp2 in complex with allosteric inhibitor rmc-4550 0.634 64 118
8b5y-assembly2.cif.gz_B shp2 in complex with allosteric imidazopyrazine inhibitor 0.6279 64 118
5jk2-assembly10.cif.gz_C crystal structure of treponema pallidum tp0751 (pallilysin) 0.6197 57 116
ID Description Score Start End Superfamily
af_A4IC37_67_372_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6507 56 92 1.10.510.10
4bowB00 Mainly Beta;Sandwich;Jelly Rolls; 0.6387 64 112 2.60.120.200
af_A0A1D6IAQ7_358_563_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6367 58 119 2.120.10.80
af_Q9VYU8_55_295_2.60.40.4100 Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-C domain 0.6216 71 109 2.60.40.4100
af_Q553M5_423_536_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6174 103 143 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A6J4SWN4-F1-model_v4 Uncharacterized protein CC_3748 0.9896 38 143
AF-A0A2E6CB92-F1-model_v4 DUF3576 domain-containing protein 0.9827 39 142
AF-A0A3C0Q3Q6-F1-model_v4 DUF3576 domain-containing protein 0.9741 55 139
AF-A0A6J4SWN4-F1-model_v4 Uncharacterized protein CC_3748 0.9714 38 143
AF-A0A7C3C0K4-F1-model_v4 DUF3576 domain-containing protein 0.9685 64 142

Feature Viewer

pLDDT pTM Quality
78.81 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map