F453175
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 485 | 298 | 473 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0495642|Ga0501035_0495642_523_993 |
| Length | 156 |
| Sequence | LNIASSKPRTHFARRAGQALLVAAALASLGACGKKERPKADIAAAKITTIGVNAYLWKASLETLSFMPLLQTDSAGGVIVTDWYANPRNPAERMKVSVTILDQDLRADALRVAASRQVAVGGGTWVDAPVEAATVQKLEDIILTKARELRRSAIAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 3 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 4 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 5 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 6 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 7 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 8 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 9 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 10 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 11 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 12 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 13 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 14 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 170 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 175 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 190 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 191 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 194 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 197 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 198 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 199 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 202 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 203 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 233 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 234 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 235 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 236 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 237 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 242 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 243 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 244 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 245 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 246 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 260 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 261 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 267 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 269 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 270 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 272 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 273 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 274 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 275 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 276 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 277 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 278 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 281 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 282 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 283 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 285 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 286 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 287 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 288 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 289 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 290 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 291 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 293 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 296 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 297 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.11 |
| Metatranscriptomes | 0.41 |
| Isolates | 2.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.7 |
| Nodule | 0.41 |
| Rhizoplane | 5.15 |
| Rhizosphere | 69.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c004327 | 3300000041 | Bacteria | 1238 |
| 2 | ARcpr5yngRDRAFT_c005971 | 3300000043 | Bacteria | 1110 |
| 3 | JGI24740J21852_10005324 | 3300001979 | Bacteria | 5456 |
| 4 | JGI24739J22299_10031522 | 3300001989 | Bacteria | 1832 |
| 5 | JGI24739J22299_10041287 | 3300001989 | Bacteria | 1535 |
| 6 | JGI24751J29686_10000248 | 3300002459 | Bacteria | 21460 |
| 7 | JGI25150J39212_1000189 | 3300002774 | Bacteria | 34828 |
| 8 | JGI25150J39212_1014466 | 3300002774 | Bacteria | 1340 |
| 9 | JGI25151J46595_10037663 | 3300003187 | Bacteria | 1811 |
| 10 | JGI25165J46597_1000010 | 3300003214 | Bacteria | 442113 |
| 11 | JGI25153J46596_10000125 | 3300003215 | Bacteria | 86065 |
| 12 | JGI25153J46596_10021376 | 3300003215 | Bacteria | 2413 |
| 13 | rootL2_10265637 | 3300003322 | Bacteria | 1472 |
| 14 | Ga0055526_1026363 | 3300003771 | Bacteria | 1835 |
| 15 | Ga0055537_1000852 | 3300003773 | Bacteria | 14838 |
| 16 | Ga0055524_1000387 | 3300003775 | Bacteria | 37906 |
| 17 | Ga0055536_1002780 | 3300003781 | Bacteria | 9686 |
| 18 | Ga0055536_1005046 | 3300003781 | Bacteria | 6557 |
| 19 | Ga0055536_1010687 | 3300003781 | Bacteria | 3608 |
| 20 | Ga0055528_1020769 | 3300003790 | Bacteria | 2115 |
| 21 | Ga0055530_10000115 | 3300003791 | Bacteria | 70229 |
| 22 | Ga0055530_10001385 | 3300003791 | Bacteria | 17950 |
| 23 | Ga0055530_10011223 | 3300003791 | Bacteria | 3235 |
| 24 | Ga0055530_10031272 | 3300003791 | Bacteria | 1399 |
| 25 | Ga0055530_10046727 | 3300003791 | Bacteria | 1026 |
| 26 | Ga0055540_1001895 | 3300003792 | Bacteria | 11716 |
| 27 | Ga0055531_10007918 | 3300003794 | Bacteria | 5701 |
| 28 | Ga0055531_10039285 | 3300003794 | Bacteria | 1407 |
| 29 | Ga0055531_10039478 | 3300003794 | Bacteria | 1401 |
| 30 | Ga0055531_10041570 | 3300003794 | Bacteria | 1329 |
| 31 | Ga0055531_10058207 | 3300003794 | Bacteria | 963 |
| 32 | Ga0065165_1010466 | 3300005262 | Bacteria | 4004 |
| 33 | Ga0065165_1095073 | 3300005262 | Bacteria | 753 |
| 34 | Ga0065165_1100922 | 3300005262 | Bacteria | 722 |
| 35 | Ga0070658_10012594 | 3300005327 | Bacteria | 6784 |
| 36 | Ga0070658_10034843 | 3300005327 | Bacteria | 4051 |
| 37 | Ga0070658_10448353 | 3300005327 | Bacteria | 1112 |
| 38 | Ga0070658_10918574 | 3300005327 | Bacteria | 761 |
| 39 | Ga0070683_100677233 | 3300005329 | Bacteria | 988 |
| 40 | Ga0070690_100099382 | 3300005330 | Bacteria | 1927 |
| 41 | Ga0070670_100245654 | 3300005331 | Bacteria | 1559 |
| 42 | Ga0070677_10026023 | 3300005333 | Bacteria | 2190 |
| 43 | Ga0070666_10046282 | 3300005335 | Bacteria | 2917 |
| 44 | Ga0070666_10409910 | 3300005335 | Bacteria | 975 |
| 45 | Ga0070680_100004738 | 3300005336 | Bacteria | 10238 |
| 46 | Ga0068868_100436311 | 3300005338 | Bacteria | 1136 |
| 47 | Ga0070660_100001566 | 3300005339 | Bacteria | 15724 |
| 48 | Ga0070689_100097146 | 3300005340 | Bacteria | 2329 |
| 49 | Ga0070687_100332802 | 3300005343 | Bacteria | 974 |
| 50 | Ga0070661_100001080 | 3300005344 | Bacteria | 19297 |
| 51 | Ga0070692_10054709 | 3300005345 | Bacteria | 2085 |
| 52 | Ga0070669_100003265 | 3300005353 | Bacteria | 11653 |
| 53 | Ga0070675_100007371 | 3300005354 | Bacteria | 8496 |
| 54 | Ga0070675_100143703 | 3300005354 | Bacteria | 2041 |
| 55 | Ga0070671_100000268 | 3300005355 | Bacteria | 35150 |
| 56 | Ga0070671_100154261 | 3300005355 | Bacteria | 1940 |
| 57 | Ga0070671_100593314 | 3300005355 | Bacteria | 957 |
| 58 | Ga0070671_101145475 | 3300005355 | Bacteria | 684 |
| 59 | Ga0070673_100125776 | 3300005364 | Bacteria | 2145 |
| 60 | Ga0070659_100002055 | 3300005366 | Bacteria | 14366 |
| 61 | Ga0070659_100103597 | 3300005366 | Bacteria | 2292 |
| 62 | Ga0070667_100000377 | 3300005367 | Bacteria | 48838 |
| 63 | Ga0070667_100007492 | 3300005367 | Bacteria | 9056 |
| 64 | Ga0070667_100011507 | 3300005367 | Bacteria | 7318 |
| 65 | Ga0070667_100343349 | 3300005367 | Bacteria | 1351 |
| 66 | Ga0070663_100047846 | 3300005455 | Bacteria | 3030 |
| 67 | Ga0070663_100456199 | 3300005455 | Bacteria | 1054 |
| 68 | Ga0070678_100167875 | 3300005456 | Bacteria | 1784 |
| 69 | Ga0070662_100000296 | 3300005457 | Bacteria | 29421 |
| 70 | Ga0070662_100030113 | 3300005457 | Bacteria | 3794 |
| 71 | Ga0070662_100091571 | 3300005457 | Bacteria | 2284 |
| 72 | Ga0070681_10000704 | 3300005458 | Bacteria | 27767 |
| 73 | Ga0070685_10196035 | 3300005466 | Bacteria | 1310 |
| 74 | Ga0070679_100009470 | 3300005530 | Bacteria | 9213 |
| 75 | Ga0070679_100084575 | 3300005530 | Bacteria | 3160 |
| 76 | Ga0070684_100845035 | 3300005535 | Bacteria | 857 |
| 77 | Ga0068853_100005067 | 3300005539 | Bacteria | 10280 |
| 78 | Ga0068853_100035221 | 3300005539 | Bacteria | 4251 |
| 79 | Ga0068853_100641939 | 3300005539 | Bacteria | 1010 |
| 80 | Ga0070672_100072979 | 3300005543 | Bacteria | 2734 |
| 81 | Ga0070686_100010084 | 3300005544 | Bacteria | 5316 |
| 82 | Ga0070693_100087616 | 3300005547 | Bacteria | 1870 |
| 83 | Ga0070665_100023655 | 3300005548 | Bacteria | 6185 |
| 84 | Ga0070665_100025894 | 3300005548 | Bacteria | 5906 |
| 85 | Ga0070665_100392343 | 3300005548 | Bacteria | 1396 |
| 86 | Ga0070665_100861413 | 3300005548 | Bacteria | 919 |
| 87 | Ga0068855_100002306 | 3300005563 | Bacteria | 23590 |
| 88 | Ga0068855_100009460 | 3300005563 | Bacteria | 11770 |
| 89 | Ga0068855_100185629 | 3300005563 | Bacteria | 2349 |
| 90 | Ga0068855_100238359 | 3300005563 | Bacteria | 2033 |
| 91 | Ga0070664_100000599 | 3300005564 | Bacteria | 27555 |
| 92 | Ga0070664_100167768 | 3300005564 | Bacteria | 1946 |
| 93 | Ga0068857_100033196 | 3300005577 | Bacteria | 4564 |
| 94 | Ga0068857_100279118 | 3300005577 | Bacteria | 1536 |
| 95 | Ga0068857_100383943 | 3300005577 | Bacteria | 1305 |
| 96 | Ga0068854_100169228 | 3300005578 | Bacteria | 1699 |
| 97 | Ga0068854_100172336 | 3300005578 | Bacteria | 1685 |
| 98 | Ga0068854_100374948 | 3300005578 | Bacteria | 1171 |
| 99 | Ga0068856_100254561 | 3300005614 | Bacteria | 1771 |
| 100 | Ga0068856_100534174 | 3300005614 | Bacteria | 1194 |
| 101 | Ga0068859_100128494 | 3300005617 | Bacteria | 2605 |
| 102 | Ga0068859_100220912 | 3300005617 | Bacteria | 1982 |
| 103 | Ga0068859_100323717 | 3300005617 | Bacteria | 1635 |
| 104 | Ga0068864_100001638 | 3300005618 | Bacteria | 18469 |
| 105 | Ga0068864_100107408 | 3300005618 | Bacteria | 2483 |
| 106 | Ga0068851_10133232 | 3300005834 | Bacteria | 1346 |
| 107 | Ga0068851_10219683 | 3300005834 | Bacteria | 1067 |
| 108 | Ga0068851_10423387 | 3300005834 | Bacteria | 787 |
| 109 | Ga0068863_100000778 | 3300005841 | Bacteria | 32056 |
| 110 | Ga0068863_100097552 | 3300005841 | Bacteria | 2791 |
| 111 | Ga0068863_100147109 | 3300005841 | Bacteria | 2254 |
| 112 | Ga0068863_100476409 | 3300005841 | Bacteria | 1227 |
| 113 | Ga0068858_100000803 | 3300005842 | Bacteria | 32914 |
| 114 | Ga0068858_100048753 | 3300005842 | Bacteria | 3923 |
| 115 | Ga0068860_100000422 | 3300005843 | Bacteria | 54588 |
| 116 | Ga0068860_100002959 | 3300005843 | Bacteria | 17532 |
| 117 | Ga0068860_100106589 | 3300005843 | Bacteria | 2677 |
| 118 | Ga0068862_100022982 | 3300005844 | Bacteria | 5221 |
| 119 | Ga0068862_100083545 | 3300005844 | Bacteria | 2773 |
| 120 | Ga0068862_100854420 | 3300005844 | Bacteria | 892 |
| 121 | Ga0081539_10115794 | 3300005985 | Bacteria | 1340 |
| 122 | Ga0075364_10000934 | 3300006051 | Bacteria | 15423 |
| 123 | Ga0075366_10008138 | 3300006195 | Bacteria | 5817 |
| 124 | Ga0075366_10318475 | 3300006195 | Bacteria | 953 |
| 125 | Ga0097620_100128492 | 3300006931 | Bacteria | 2605 |
| 126 | Ga0097620_100220904 | 3300006931 | Bacteria | 1982 |
| 127 | Ga0097620_100323729 | 3300006931 | Bacteria | 1635 |
| 128 | Ga0097620_100384559 | 3300006931 | Bacteria | 1499 |
| 129 | Ga0079104_1011144 | 3300006946 | Bacteria | 2910 |
| 130 | Ga0105240_10205345 | 3300009093 | Bacteria | 2307 |
| 131 | Ga0105240_10369510 | 3300009093 | Bacteria | 1622 |
| 132 | Ga0105240_11217437 | 3300009093 | Bacteria | 797 |
| 133 | Ga0105245_10012492 | 3300009098 | Bacteria | 7389 |
| 134 | Ga0105247_10051830 | 3300009101 | Bacteria | 2528 |
| 135 | Ga0105243_10076652 | 3300009148 | Bacteria | 2718 |
| 136 | Ga0105241_10052927 | 3300009174 | Bacteria | 3102 |
| 137 | Ga0105242_10258378 | 3300009176 | Bacteria | 1572 |
| 138 | Ga0105248_10028901 | 3300009177 | Bacteria | 6180 |
| 139 | Ga0105248_10161041 | 3300009177 | Bacteria | 2531 |
| 140 | Ga0105237_10032356 | 3300009545 | Bacteria | 5295 |
| 141 | Ga0105237_10367034 | 3300009545 | Bacteria | 1444 |
| 142 | Ga0105237_10763565 | 3300009545 | Bacteria | 973 |
| 143 | Ga0105238_10721954 | 3300009551 | Bacteria | 1009 |
| 144 | Ga0105249_10197558 | 3300009553 | Bacteria | 1966 |
| 145 | Ga0105239_10312085 | 3300010375 | Bacteria | 1772 |
| 146 | Ga0105246_10003891 | 3300011119 | Bacteria | 9048 |
| 147 | Ga0157373_10042182 | 3300013100 | Bacteria | 3262 |
| 148 | Ga0157371_10000838 | 3300013102 | Bacteria | 35145 |
| 149 | Ga0157371_10048467 | 3300013102 | Bacteria | 3020 |
| 150 | Ga0157370_10000287 | 3300013104 | Bacteria | 64090 |
| 151 | Ga0157369_10097615 | 3300013105 | Bacteria | 3134 |
| 152 | Ga0157374_10342730 | 3300013296 | Bacteria | 1484 |
| 153 | Ga0157378_10036010 | 3300013297 | Bacteria | 4380 |
| 154 | Ga0163162_10097805 | 3300013306 | Bacteria | 3024 |
| 155 | Ga0163162_10351772 | 3300013306 | Bacteria | 1606 |
| 156 | Ga0157372_10004576 | 3300013307 | Bacteria | 14713 |
| 157 | Ga0157372_10266782 | 3300013307 | Bacteria | 1988 |
| 158 | Ga0157372_10466031 | 3300013307 | Bacteria | 1473 |
| 159 | Ga0157372_10524253 | 3300013307 | Bacteria | 1381 |
| 160 | Ga0157375_10113547 | 3300013308 | Bacteria | 2810 |
| 161 | Ga0157375_10924373 | 3300013308 | Bacteria | 1015 |
| 162 | Ga0163163_10191752 | 3300014325 | Bacteria | 2092 |
| 163 | Ga0157377_10485968 | 3300014745 | Bacteria | 860 |
| 164 | Ga0163161_10161869 | 3300017792 | Bacteria | 1707 |
| 165 | Ga0213875_10000166 | 3300021388 | Bacteria | 68786 |
| 166 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 167 | Ga0209026_1024863 | 3300025250 | Bacteria | 906 |
| 168 | Ga0209129_1000345 | 3300025258 | Bacteria | 39677 |
| 169 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 170 | Ga0209565_1000052 | 3300025263 | Bacteria | 212056 |
| 171 | Ga0209455_1018055 | 3300025272 | Bacteria | 1459 |
| 172 | Ga0209673_1051784 | 3300025273 | Bacteria | 1081 |
| 173 | Ga0209675_1000104 | 3300025291 | Bacteria | 121249 |
| 174 | Ga0209676_1000512 | 3300025292 | Bacteria | 61167 |
| 175 | Ga0209676_1001456 | 3300025292 | Bacteria | 22181 |
| 176 | Ga0209676_1012010 | 3300025292 | Bacteria | 3442 |
| 177 | Ga0209676_1018292 | 3300025292 | Bacteria | 2449 |
| 178 | Ga0209025_1001007 | 3300025294 | Bacteria | 41722 |
| 179 | Ga0209025_1020363 | 3300025294 | Bacteria | 3633 |
| 180 | Ga0209025_1056248 | 3300025294 | Bacteria | 1514 |
| 181 | Ga0209564_1018743 | 3300025295 | Bacteria | 2622 |
| 182 | Ga0209564_1022881 | 3300025295 | Bacteria | 2191 |
| 183 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 184 | Ga0209758_1041823 | 3300025297 | Bacteria | 1707 |
| 185 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 186 | Ga0209050_1000286 | 3300025298 | Bacteria | 106566 |
| 187 | Ga0209050_1003173 | 3300025298 | Bacteria | 12496 |
| 188 | Ga0209050_1021898 | 3300025298 | Bacteria | 2309 |
| 189 | Ga0207426_1006259 | 3300025302 | Bacteria | 5210 |
| 190 | Ga0209051_1000472 | 3300025303 | Bacteria | 52350 |
| 191 | Ga0209257_1000245 | 3300025304 | Bacteria | 125987 |
| 192 | Ga0209257_1000321 | 3300025304 | Bacteria | 100476 |
| 193 | Ga0209257_1002319 | 3300025304 | Bacteria | 19233 |
| 194 | Ga0209257_1011475 | 3300025304 | Bacteria | 4262 |
| 195 | Ga0209257_1041739 | 3300025304 | Bacteria | 1359 |
| 196 | Ga0207697_10043975 | 3300025315 | Bacteria | 1837 |
| 197 | Ga0207656_10246419 | 3300025321 | Bacteria | 874 |
| 198 | Ga0207710_10062599 | 3300025900 | Bacteria | 1691 |
| 199 | Ga0207680_10238749 | 3300025903 | Bacteria | 1252 |
| 200 | Ga0207705_10066559 | 3300025909 | Bacteria | 2606 |
| 201 | Ga0207705_10154843 | 3300025909 | Bacteria | 1719 |
| 202 | Ga0207705_10487187 | 3300025909 | Bacteria | 957 |
| 203 | Ga0207707_10015569 | 3300025912 | Bacteria | 6624 |
| 204 | Ga0207695_10617947 | 3300025913 | Bacteria | 965 |
| 205 | Ga0207671_10002056 | 3300025914 | Bacteria | 22074 |
| 206 | Ga0207671_10489463 | 3300025914 | Bacteria | 980 |
| 207 | Ga0207660_10004662 | 3300025917 | Bacteria | 8935 |
| 208 | Ga0207660_10376707 | 3300025917 | Bacteria | 1140 |
| 209 | Ga0207657_10000237 | 3300025919 | Bacteria | 58162 |
| 210 | Ga0207657_10038981 | 3300025919 | Bacteria | 4225 |
| 211 | Ga0207649_10137340 | 3300025920 | Bacteria | 1668 |
| 212 | Ga0207652_10003065 | 3300025921 | Bacteria | 13950 |
| 213 | Ga0207652_10022405 | 3300025921 | Bacteria | 5226 |
| 214 | Ga0207681_10000260 | 3300025923 | Bacteria | 40385 |
| 215 | Ga0207681_10213351 | 3300025923 | Bacteria | 1489 |
| 216 | Ga0207694_10023969 | 3300025924 | Bacteria | 4635 |
| 217 | Ga0207659_10021746 | 3300025926 | Bacteria | 4263 |
| 218 | Ga0207687_10003478 | 3300025927 | Bacteria | 10598 |
| 219 | Ga0207644_10000008 | 3300025931 | Bacteria | 354219 |
| 220 | Ga0207644_10319835 | 3300025931 | Bacteria | 1254 |
| 221 | Ga0207644_10449883 | 3300025931 | Bacteria | 1058 |
| 222 | Ga0207690_10000321 | 3300025932 | Bacteria | 32084 |
| 223 | Ga0207690_10125940 | 3300025932 | Bacteria | 1868 |
| 224 | Ga0207706_10001328 | 3300025933 | Bacteria | 24769 |
| 225 | Ga0207706_10008461 | 3300025933 | Bacteria | 9490 |
| 226 | Ga0207706_10076727 | 3300025933 | Bacteria | 2939 |
| 227 | Ga0207686_10155988 | 3300025934 | Bacteria | 1595 |
| 228 | Ga0207691_10109620 | 3300025940 | Bacteria | 2456 |
| 229 | Ga0207711_10119135 | 3300025941 | Bacteria | 2355 |
| 230 | Ga0207711_10142917 | 3300025941 | Bacteria | 2154 |
| 231 | Ga0207711_11209712 | 3300025941 | Bacteria | 697 |
| 232 | Ga0207661_10097375 | 3300025944 | Bacteria | 2463 |
| 233 | Ga0207679_10037614 | 3300025945 | Bacteria | 3442 |
| 234 | Ga0207667_10000686 | 3300025949 | Bacteria | 43969 |
| 235 | Ga0207667_10000881 | 3300025949 | Bacteria | 38298 |
| 236 | Ga0207667_10029439 | 3300025949 | Bacteria | 5956 |
| 237 | Ga0207667_10094877 | 3300025949 | Bacteria | 3080 |
| 238 | Ga0207667_10305402 | 3300025949 | Bacteria | 1626 |
| 239 | Ga0207651_10611176 | 3300025960 | Bacteria | 954 |
| 240 | Ga0207712_11109327 | 3300025961 | Bacteria | 704 |
| 241 | Ga0207668_10041281 | 3300025972 | Bacteria | 3118 |
| 242 | Ga0207668_10824170 | 3300025972 | Bacteria | 822 |
| 243 | Ga0207640_10003971 | 3300025981 | Bacteria | 7981 |
| 244 | Ga0207640_10118101 | 3300025981 | Bacteria | 1894 |
| 245 | Ga0207640_10441555 | 3300025981 | Bacteria | 1070 |
| 246 | Ga0207640_10540210 | 3300025981 | Bacteria | 977 |
| 247 | Ga0207658_10000813 | 3300025986 | Bacteria | 26103 |
| 248 | Ga0207658_10002531 | 3300025986 | Bacteria | 13305 |
| 249 | Ga0207658_10055762 | 3300025986 | Bacteria | 2930 |
| 250 | Ga0207658_10141750 | 3300025986 | Bacteria | 1946 |
| 251 | Ga0207677_10377139 | 3300026023 | Bacteria | 1196 |
| 252 | Ga0207703_10001170 | 3300026035 | Bacteria | 24778 |
| 253 | Ga0207703_10018441 | 3300026035 | Bacteria | 5449 |
| 254 | Ga0207703_10087280 | 3300026035 | Bacteria | 2615 |
| 255 | Ga0207639_10007020 | 3300026041 | Bacteria | 7678 |
| 256 | Ga0207639_10078805 | 3300026041 | Bacteria | 2602 |
| 257 | Ga0207639_10290415 | 3300026041 | Bacteria | 1442 |
| 258 | Ga0207639_10851319 | 3300026041 | Bacteria | 851 |
| 259 | Ga0207678_10038888 | 3300026067 | Bacteria | 4131 |
| 260 | Ga0207678_10071764 | 3300026067 | Bacteria | 2968 |
| 261 | Ga0207702_10163113 | 3300026078 | Bacteria | 2037 |
| 262 | Ga0207641_10000098 | 3300026088 | Bacteria | 123514 |
| 263 | Ga0207641_10083693 | 3300026088 | Bacteria | 2775 |
| 264 | Ga0207676_10010385 | 3300026095 | Bacteria | 6630 |
| 265 | Ga0207676_11459174 | 3300026095 | Bacteria | 681 |
| 266 | Ga0207674_10078554 | 3300026116 | Bacteria | 3305 |
| 267 | Ga0207674_10099465 | 3300026116 | Bacteria | 2891 |
| 268 | Ga0207674_10380065 | 3300026116 | Bacteria | 1365 |
| 269 | Ga0207674_10645308 | 3300026116 | Bacteria | 1022 |
| 270 | Ga0207675_100400608 | 3300026118 | Bacteria | 1352 |
| 271 | Ga0207683_10148294 | 3300026121 | Bacteria | 2116 |
| 272 | Ga0207698_10369724 | 3300026142 | Bacteria | 1360 |
| 273 | Ga0209281_1011771 | 3300027111 | Bacteria | 1945 |
| 274 | Ga0209983_1016964 | 3300027665 | Bacteria | 1505 |
| 275 | Ga0209998_10063992 | 3300027717 | Bacteria | 870 |
| 276 | Ga0268266_10005988 | 3300028379 | Bacteria | 11222 |
| 277 | Ga0268266_10021490 | 3300028379 | Bacteria | 5497 |
| 278 | Ga0268265_10002675 | 3300028380 | Bacteria | 13211 |
| 279 | Ga0268265_10128282 | 3300028380 | Bacteria | 2103 |
| 280 | Ga0268265_10633196 | 3300028380 | Bacteria | 1026 |
| 281 | Ga0268264_10000224 | 3300028381 | Bacteria | 110355 |
| 282 | Ga0268264_10081233 | 3300028381 | Bacteria | 2770 |
| 283 | Ga0268264_10111744 | 3300028381 | Bacteria | 2394 |
| 284 | Ga0265334_10234962 | 3300028573 | Bacteria | 633 |
| 285 | Ga0307517_10032173 | 3300028786 | Bacteria | 6073 |
| 286 | Ga0307517_10111580 | 3300028786 | Bacteria | 2077 |
| 287 | Ga0307515_10452649 | 3300028794 | Bacteria | 899 |
| 288 | Ga0307513_10030193 | 3300031456 | Bacteria | 6160 |
| 289 | Ga0307513_10099351 | 3300031456 | Bacteria | 2939 |
| 290 | Ga0307513_10231556 | 3300031456 | Bacteria | 1660 |
| 291 | Ga0307509_10199470 | 3300031507 | Bacteria | 1840 |
| 292 | Ga0307408_100074072 | 3300031548 | Bacteria | 2525 |
| 293 | Ga0307508_10000011 | 3300031616 | Bacteria | 248001 |
| 294 | Ga0316578_10107733 | 3300031728 | Bacteria | 1673 |
| 295 | Ga0307405_10345683 | 3300031731 | Bacteria | 1145 |
| 296 | Ga0307405_10613309 | 3300031731 | Bacteria | 890 |
| 297 | Ga0307405_11591679 | 3300031731 | Bacteria | 576 |
| 298 | Ga0307413_10184769 | 3300031824 | Bacteria | 1490 |
| 299 | Ga0307413_10202556 | 3300031824 | Bacteria | 1434 |
| 300 | Ga0307413_11111534 | 3300031824 | Bacteria | 683 |
| 301 | Ga0307410_10012878 | 3300031852 | Bacteria | 4856 |
| 302 | Ga0307410_10269910 | 3300031852 | Bacteria | 1330 |
| 303 | Ga0307410_10361342 | 3300031852 | Bacteria | 1163 |
| 304 | Ga0307410_10532590 | 3300031852 | Bacteria | 971 |
| 305 | Ga0307406_10103492 | 3300031901 | Bacteria | 1944 |
| 306 | Ga0307406_10288830 | 3300031901 | Bacteria | 1254 |
| 307 | Ga0307407_10005479 | 3300031903 | Bacteria | 5512 |
| 308 | Ga0307407_10402626 | 3300031903 | Bacteria | 982 |
| 309 | Ga0307412_10002381 | 3300031911 | Bacteria | 10439 |
| 310 | Ga0307412_10097536 | 3300031911 | Bacteria | 2071 |
| 311 | Ga0307412_10269069 | 3300031911 | Bacteria | 1332 |
| 312 | Ga0307412_10690497 | 3300031911 | Bacteria | 875 |
| 313 | Ga0307409_100715686 | 3300031995 | Bacteria | 1002 |
| 314 | Ga0307416_100160419 | 3300032002 | Bacteria | 2078 |
| 315 | Ga0307416_100227030 | 3300032002 | Bacteria | 1796 |
| 316 | Ga0307416_101992168 | 3300032002 | Bacteria | 683 |
| 317 | Ga0307414_10003045 | 3300032004 | Bacteria | 8890 |
| 318 | Ga0307414_10111869 | 3300032004 | Bacteria | 2080 |
| 319 | Ga0307414_10134838 | 3300032004 | Bacteria | 1923 |
| 320 | Ga0307414_10334220 | 3300032004 | Bacteria | 1294 |
| 321 | Ga0307414_10366076 | 3300032004 | Bacteria | 1242 |
| 322 | Ga0307414_10693448 | 3300032004 | Bacteria | 921 |
| 323 | Ga0307411_10025542 | 3300032005 | Bacteria | 3541 |
| 324 | Ga0307411_10207725 | 3300032005 | Bacteria | 1509 |
| 325 | Ga0307411_10252648 | 3300032005 | Bacteria | 1387 |
| 326 | Ga0307411_10337722 | 3300032005 | Bacteria | 1223 |
| 327 | Ga0307411_11517193 | 3300032005 | Bacteria | 616 |
| 328 | Ga0307415_100172675 | 3300032126 | Bacteria | 1687 |
| 329 | Ga0307415_100786044 | 3300032126 | Bacteria | 867 |
| 330 | Ga0316583_10001242 | 3300032133 | Bacteria | 8391 |
| 331 | Ga0373937_0198592 | 3300036401 | Bacteria | 1885 |
| 332 | Ga0316582_0020940 | 3300036647 | Bacteria | 3854 |
| 333 | Ga0316581_0158025 | 3300037588 | Bacteria | 699 |
| 334 | Ga0436364_0545952 | 3300037853 | Bacteria | 79385 |
| 335 | Ga0436365_1367690 | 3300039437 | Bacteria | 824 |
| 336 | Ga0439465_0058128 | 3300041413 | Bacteria | 1277 |
| 337 | Ga0451791_1274022 | 3300041451 | Bacteria | 589 |
| 338 | Ga0451791_1368899 | 3300041451 | Bacteria | 518 |
| 339 | Ga0451791_1794905 | 3300041451 | Bacteria | 609 |
| 340 | Ga0451807_2558812 | 3300041486 | Bacteria | 682 |
| 341 | Ga0451837_0388540 | 3300041494 | Bacteria | 500 |
| 342 | Ga0451847_0004174 | 3300041503 | Bacteria | 654 |
| 343 | Ga0451851_0890183 | 3300041507 | Bacteria | 810 |
| 344 | Ga0451843_1087739 | 3300041509 | Bacteria | 599 |
| 345 | Ga0451853_2126796 | 3300041512 | Bacteria | 849 |
| 346 | Ga0450890_018179 | 3300042127 | Bacteria | 940 |
| 347 | Ga0439434_0031460 | 3300042435 | Bacteria | 1613 |
| 348 | Ga0466965_0475167 | 3300044683 | Bacteria | 699 |
| 349 | Ga0451576_0000017 | 3300045051 | Bacteria | 558261 |
| 350 | Ga0451576_1284389 | 3300045051 | Bacteria | 763 |
| 351 | Ga0495650_0073152 | 3300046471 | Bacteria | 1340 |
| 352 | Ga0495585_0186864 | 3300046492 | Bacteria | 1062 |
| 353 | Ga0495648_0364478 | 3300046524 | Bacteria | 656 |
| 354 | Ga0495666_0039961 | 3300046526 | Bacteria | 2276 |
| 355 | Ga0495654_0302362 | 3300046530 | Bacteria | 653 |
| 356 | Ga0495598_0127566 | 3300046537 | Bacteria | 869 |
| 357 | Ga0495621_0010980 | 3300046539 | Bacteria | 2787 |
| 358 | Ga0495625_0000094 | 3300046660 | Bacteria | 144517 |
| 359 | Ga0495670_0000016 | 3300046691 | Bacteria | 128045 |
| 360 | Ga0495670_0054475 | 3300046691 | Bacteria | 2004 |
| 361 | Ga0495670_0466083 | 3300046691 | Bacteria | 685 |
| 362 | Ga0495672_0335753 | 3300047320 | Bacteria | 706 |
| 363 | Ga0495681_0214730 | 3300047470 | Bacteria | 774 |
| 364 | Ga0495686_0247187 | 3300047472 | Bacteria | 1004 |
| 365 | Ga0495615_0007307 | 3300048090 | Bacteria | 2091 |
| 366 | Ga0496100_0190025 | 3300048903 | Bacteria | 1490 |
| 367 | Ga0496100_0739465 | 3300048903 | Bacteria | 769 |
| 368 | Ga0496101_0046344 | 3300048904 | Bacteria | 3117 |
| 369 | Ga0496102_0067865 | 3300048905 | Bacteria | 3271 |
| 370 | Ga0496103_0017415 | 3300048906 | Bacteria | 4300 |
| 371 | Ga0496103_0629934 | 3300048906 | Bacteria | 682 |
| 372 | Ga0496103_0762269 | 3300048906 | Bacteria | 611 |
| 373 | Ga0496104_0090530 | 3300048907 | Bacteria | 2923 |
| 374 | Ga0496104_0408310 | 3300048907 | Bacteria | 1270 |
| 375 | Ga0496105_0013455 | 3300048908 | Bacteria | 6495 |
| 376 | Ga0496105_0076140 | 3300048908 | Bacteria | 2770 |
| 377 | Ga0496106_0005097 | 3300048909 | Bacteria | 9726 |
| 378 | Ga0496107_0010144 | 3300048910 | Bacteria | 6534 |
| 379 | Ga0496108_0021289 | 3300048911 | Bacteria | 5329 |
| 380 | Ga0496108_0168946 | 3300048911 | Bacteria | 1892 |
| 381 | Ga0496109_0106648 | 3300048912 | Bacteria | 2602 |
| 382 | Ga0496111_0027115 | 3300048914 | Bacteria | 4050 |
| 383 | Ga0496112_0282853 | 3300048915 | Bacteria | 1605 |
| 384 | Ga0496113_0020024 | 3300048916 | Bacteria | 4694 |
| 385 | Ga0496114_0413007 | 3300048917 | Bacteria | 1195 |
| 386 | Ga0496115_0001166 | 3300048918 | Bacteria | 18830 |
| 387 | Ga0496118_0109422 | 3300048921 | Bacteria | 1839 |
| 388 | Ga0496120_0056862 | 3300048923 | Bacteria | 2205 |
| 389 | Ga0496121_0000276 | 3300048924 | Bacteria | 107058 |
| 390 | Ga0496121_0392561 | 3300048924 | Bacteria | 911 |
| 391 | Ga0496122_0137465 | 3300048925 | Bacteria | 1536 |
| 392 | Ga0496123_0055545 | 3300048926 | Bacteria | 2596 |
| 393 | Ga0496124_0000675 | 3300048927 | Bacteria | 56113 |
| 394 | Ga0496124_0008603 | 3300048927 | Bacteria | 10645 |
| 395 | Ga0496125_0184909 | 3300048928 | Bacteria | 1383 |
| 396 | Ga0496125_0226076 | 3300048928 | Bacteria | 1201 |
| 397 | Ga0496125_0450855 | 3300048928 | Bacteria | 737 |
| 398 | Ga0496126_0138921 | 3300048929 | Bacteria | 2093 |
| 399 | Ga0501290_018506 | 3300049513 | Bacteria | 939 |
| 400 | Ga0501292_000013 | 3300049515 | Bacteria | 65866 |
| 401 | Ga0501293_009077 | 3300049516 | Bacteria | 844 |
| 402 | Ga0501294_004900 | 3300049517 | Bacteria | 1265 |
| 403 | Ga0501300_003447 | 3300049523 | Bacteria | 2364 |
| 404 | Ga0501300_006273 | 3300049523 | Bacteria | 1752 |
| 405 | Ga0501315_053374 | 3300049531 | Bacteria | 639 |
| 406 | Ga0501317_055566 | 3300049533 | Bacteria | 639 |
| 407 | Ga0501032_0909405 | 3300049569 | Bacteria | 554 |
| 408 | Ga0501033_0053763 | 3300049570 | Bacteria | 2981 |
| 409 | Ga0501034_0009756 | 3300049571 | Bacteria | 10040 |
| 410 | Ga0501034_0029942 | 3300049571 | Bacteria | 5533 |
| 411 | Ga0501036_0027242 | 3300049572 | Bacteria | 4828 |
| 412 | Ga0501036_0495554 | 3300049572 | Bacteria | 1017 |
| 413 | Ga0501037_0096601 | 3300049573 | Bacteria | 2135 |
| 414 | Ga0501037_0358439 | 3300049573 | Bacteria | 1005 |
| 415 | Ga0501038_0062429 | 3300049574 | Bacteria | 3183 |
| 416 | Ga0501040_0716979 | 3300049576 | Bacteria | 723 |
| 417 | Ga0501042_0095641 | 3300049578 | Bacteria | 2134 |
| 418 | Ga0501042_0343811 | 3300049578 | Bacteria | 1079 |
| 419 | Ga0501046_0498102 | 3300049580 | Bacteria | 873 |
| 420 | Ga0501047_0236348 | 3300049581 | Bacteria | 1679 |
| 421 | Ga0501048_0331102 | 3300049582 | Bacteria | 1085 |
| 422 | Ga0501206_021297 | 3300049653 | Bacteria | 925 |
| 423 | Ga0501222_000744 | 3300049662 | Bacteria | 4715 |
| 424 | Ga0501223_000447 | 3300049663 | Bacteria | 9956 |
| 425 | Ga0501224_028867 | 3300049664 | Bacteria | 830 |
| 426 | Ga0501227_039492 | 3300049665 | Bacteria | 1162 |
| 427 | Ga0501227_153721 | 3300049665 | Bacteria | 636 |
| 428 | Ga0501233_000149 | 3300049668 | Bacteria | 10087 |
| 429 | Ga0501233_103076 | 3300049668 | Bacteria | 756 |
| 430 | Ga0501236_054647 | 3300049670 | Bacteria | 694 |
| 431 | Ga0501257_000010 | 3300049686 | Bacteria | 53242 |
| 432 | Ga0501257_111949 | 3300049686 | Bacteria | 724 |
| 433 | Ga0501259_000881 | 3300049688 | Bacteria | 4947 |
| 434 | Ga0501261_000272 | 3300049690 | Bacteria | 7118 |
| 435 | Ga0501221_008430 | 3300049704 | Bacteria | 1792 |
| 436 | Ga0501225_0002623 | 3300049705 | Bacteria | 5521 |
| 437 | Ga0501245_026078 | 3300049708 | Bacteria | 942 |
| 438 | Ga0501241_006510 | 3300049758 | Bacteria | 2149 |
| 439 | Ga0501279_000004 | 3300049775 | Bacteria | 175612 |
| 440 | Ga0501280_000054 | 3300049776 | Bacteria | 33149 |
| 441 | Ga0501280_015484 | 3300049776 | Bacteria | 1093 |
| 442 | Ga0501281_02871 | 3300049777 | Bacteria | 1243 |
| 443 | Ga0501282_000366 | 3300049778 | Bacteria | 5425 |
| 444 | Ga0501283_021039 | 3300049779 | Bacteria | 1043 |
| 445 | Ga0501035_0090616 | 3300049822 | Bacteria | 2691 |
| 446 | Ga0501035_0495642 | 3300049822 | Bacteria | 1006 |
| 447 | Ga0501035_0524721 | 3300049822 | Bacteria | 972 |
| 448 | Ga0501035_1488216 | 3300049822 | Bacteria | 517 |
| 449 | Ga0501044_0383504 | 3300049823 | Bacteria | 1320 |
| 450 | Ga0501044_0791058 | 3300049823 | Bacteria | 828 |
| 451 | nmdc:mga03683_298639_c1 | 3300050489 | Bacteria | 755 |
| 452 | nmdc:mga00v17_23348_c1 | 3300050491 | Bacteria | 3576 |
| 453 | nmdc:mga00v17_82975_c1 | 3300050491 | Bacteria | 2004 |
| 454 | nmdc:mga0k408_96178_c1 | 3300050493 | Bacteria | 1743 |
| 455 | nmdc:mga07m45_19876_c2 | 3300050496 | Bacteria | 3242 |
| 456 | Ga0500643_000566 | 3300053087 | Bacteria | 25752 |
| 457 | Ga0500555_033828 | 3300053103 | Bacteria | 1440 |
| 458 | Ga0500595_022041 | 3300053119 | Bacteria | 2263 |
| 459 | Ga0500607_000023 | 3300053121 | Bacteria | 97892 |
| 460 | Ga0500626_086911 | 3300053128 | Bacteria | 1376 |
| 461 | Ga0500652_111710 | 3300053131 | Bacteria | 1142 |
| 462 | Ga0500559_0001189 | 3300053136 | Bacteria | 15470 |
| 463 | Ga0500559_0158151 | 3300053136 | Bacteria | 1064 |
| 464 | Ga0500559_0229684 | 3300053136 | Bacteria | 875 |
| 465 | Ga0500559_0322127 | 3300053136 | Bacteria | 724 |
| 466 | Ga0500568_0017156 | 3300053139 | Bacteria | 3203 |
| 467 | Ga0500604_0168030 | 3300053151 | Bacteria | 749 |
| 468 | Ga0500616_0099003 | 3300053153 | Bacteria | 1429 |
| 469 | Ga0500636_0392927 | 3300053177 | Bacteria | 646 |
| 470 | Ga0500637_0022998 | 3300053178 | Bacteria | 3402 |
| 471 | Ga0500645_001934 | 3300053730 | Bacteria | 9832 |
| 472 | Ga0500596_004081 | 3300053735 | Bacteria | 2708 |
| 473 | Ga0501082_1193202 | 3300060353 | Bacteria | 665 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_100097146 | Ga0070689_1000971462 | 130 |
| 2 | 3300031728 | Ga0316578_10107733 | Ga0316578_101077332 | 133 |
| 3 | 3300032133 | Ga0316583_10001242 | Ga0316583_100012426 | 133 |
| 4 | 3300036647 | Ga0316582_0020940 | Ga0316582_0020940_2517_2978 | 133 |
| 5 | 3300037588 | Ga0316581_0158025 | Ga0316581_0158025_115_576 | 133 |
| 6 | 3300005327 | Ga0070658_10012594 | Ga0070658_100125942 | 135 |
| 7 | 3300005329 | Ga0070683_100677233 | Ga0070683_1006772332 | 135 |
| 8 | 3300005336 | Ga0070680_100004738 | Ga0070680_1000047386 | 135 |
| 9 | 3300005339 | Ga0070660_100001566 | Ga0070660_1000015664 | 135 |
| 10 | 3300005344 | Ga0070661_100001080 | Ga0070661_1000010801 | 135 |
| 11 | 3300005345 | Ga0070692_10054709 | Ga0070692_100547092 | 135 |
| 12 | 3300005366 | Ga0070659_100002055 | Ga0070659_1000020558 | 135 |
| 13 | 3300005457 | Ga0070662_100000296 | Ga0070662_10000029610 | 135 |
| 14 | 3300005458 | Ga0070681_10000704 | Ga0070681_1000070414 | 135 |
| 15 | 3300005530 | Ga0070679_100009470 | Ga0070679_1000094704 | 135 |
| 16 | 3300005539 | Ga0068853_100005067 | Ga0068853_1000050676 | 135 |
| 17 | 3300005547 | Ga0070693_100087616 | Ga0070693_1000876162 | 135 |
| 18 | 3300005563 | Ga0068855_100002306 | Ga0068855_10000230622 | 135 |
| 19 | 3300005564 | Ga0070664_100000599 | Ga0070664_10000059923 | 135 |
| 20 | 3300005577 | Ga0068857_100279118 | Ga0068857_1002791181 | 135 |
| 21 | 3300005578 | Ga0068854_100374948 | Ga0068854_1003749483 | 135 |
| 22 | 3300005614 | Ga0068856_100254561 | Ga0068856_1002545612 | 135 |
| 23 | 3300005834 | Ga0068851_10219683 | Ga0068851_102196832 | 135 |
| 24 | 3300006195 | Ga0075366_10318475 | Ga0075366_103184751 | 135 |
| 25 | 3300009174 | Ga0105241_10052927 | Ga0105241_100529272 | 135 |
| 26 | 3300013100 | Ga0157373_10042182 | Ga0157373_100421822 | 135 |
| 27 | 3300013102 | Ga0157371_10000838 | Ga0157371_1000083811 | 135 |
| 28 | 3300013104 | Ga0157370_10000287 | Ga0157370_1000028720 | 135 |
| 29 | 3300013105 | Ga0157369_10097615 | Ga0157369_100976152 | 135 |
| 30 | 3300013307 | Ga0157372_10004576 | Ga0157372_1000457613 | 135 |
| 31 | 3300025321 | Ga0207656_10246419 | Ga0207656_102464191 | 135 |
| 32 | 3300025909 | Ga0207705_10154843 | Ga0207705_101548432 | 135 |
| 33 | 3300025912 | Ga0207707_10015569 | Ga0207707_100155692 | 135 |
| 34 | 3300025917 | Ga0207660_10004662 | Ga0207660_100046624 | 135 |
| 35 | 3300025919 | Ga0207657_10000237 | Ga0207657_1000023725 | 135 |
| 36 | 3300025921 | Ga0207652_10003065 | Ga0207652_1000306510 | 135 |
| 37 | 3300025932 | Ga0207690_10000321 | Ga0207690_100003214 | 135 |
| 38 | 3300025933 | Ga0207706_10001328 | Ga0207706_100013289 | 135 |
| 39 | 3300025944 | Ga0207661_10097375 | Ga0207661_100973753 | 135 |
| 40 | 3300025945 | Ga0207679_10037614 | Ga0207679_100376142 | 135 |
| 41 | 3300025949 | Ga0207667_10000686 | Ga0207667_1000068626 | 135 |
| 42 | 3300025981 | Ga0207640_10118101 | Ga0207640_101181012 | 135 |
| 43 | 3300026041 | Ga0207639_10007020 | Ga0207639_100070209 | 135 |
| 44 | 3300026078 | Ga0207702_10163113 | Ga0207702_101631132 | 135 |
| 45 | 3300026095 | Ga0207676_11459174 | Ga0207676_114591741 | 135 |
| 46 | 3300026116 | Ga0207674_10099465 | Ga0207674_100994653 | 135 |
| 47 | 3300032005 | Ga0307411_10337722 | Ga0307411_103377221 | 135 |
| 48 | 3300046537 | Ga0495598_0127566 | Ga0495598_0127566_162_611 | 135 |
| 49 | 3300046539 | Ga0495621_0010980 | Ga0495621_0010980_687_1136 | 135 |
| 50 | 3300048090 | Ga0495615_0007307 | Ga0495615_0007307_584_1033 | 135 |
| 51 | 3300050493 | nmdc:mga0k408_96178_c1 | nmdc:mga0k408_96178_c1_734_1183 | 135 |
| 52 | 3300005834 | Ga0068851_10423387 | Ga0068851_104233872 | 136 |
| 53 | 3300025972 | Ga0207668_10824170 | Ga0207668_108241702 | 136 |
| 54 | 3300026142 | Ga0207698_10369724 | Ga0207698_103697242 | 136 |
| 55 | 3300049576 | Ga0501040_0716979 | Ga0501040_0716979_64_507 | 136 |
| 56 | 3300049578 | Ga0501042_0095641 | Ga0501042_0095641_1330_1773 | 136 |
| 57 | 3300048929 | Ga0496126_0138921 | Ga0496126_0138921_1155_1604 | 137 |
| 58 | 3300005327 | Ga0070658_10034843 | Ga0070658_100348433 | 138 |
| 59 | 3300013307 | Ga0157372_10524253 | Ga0157372_105242532 | 138 |
| 60 | 3300027665 | Ga0209983_1016964 | Ga0209983_10169642 | 138 |
| 61 | 3300005539 | Ga0068853_100035221 | Ga0068853_1000352211 | 139 |
| 62 | 3300013307 | Ga0157372_10466031 | Ga0157372_104660312 | 139 |
| 63 | 3300025981 | Ga0207640_10540210 | Ga0207640_105402102 | 139 |
| 64 | 3300026041 | Ga0207639_10851319 | Ga0207639_108513192 | 139 |
| 65 | 3300031731 | Ga0307405_11591679 | Ga0307405_115916791 | 139 |
| 66 | 3300031824 | Ga0307413_11111534 | Ga0307413_111115342 | 139 |
| 67 | 3300031852 | Ga0307410_10012878 | Ga0307410_100128781 | 139 |
| 68 | 3300031901 | Ga0307406_10288830 | Ga0307406_102888301 | 139 |
| 69 | 3300031903 | Ga0307407_10005479 | Ga0307407_100054794 | 139 |
| 70 | 3300031903 | Ga0307407_10402626 | Ga0307407_104026261 | 139 |
| 71 | 3300032002 | Ga0307416_100160419 | Ga0307416_1001604192 | 139 |
| 72 | 3300032002 | Ga0307416_101992168 | Ga0307416_1019921681 | 139 |
| 73 | 3300032004 | Ga0307414_10366076 | Ga0307414_103660762 | 139 |
| 74 | 3300032005 | Ga0307411_10025542 | Ga0307411_100255422 | 139 |
| 75 | 3300032126 | Ga0307415_100172675 | Ga0307415_1001726752 | 139 |
| 76 | 3300032126 | Ga0307415_100786044 | Ga0307415_1007860441 | 139 |
| 77 | 3300041494 | Ga0451837_0388540 | Ga0451837_0388540_44_481 | 139 |
| 78 | 3300048928 | Ga0496125_0450855 | Ga0496125_0450855_188_673 | 140 |
| 79 | 3300050491 | nmdc:mga00v17_23348_c1 | nmdc:mga00v17_23348_c1_702_1190 | 140 |
| 80 | 3300005327 | Ga0070658_10918574 | Ga0070658_109185741 | 141 |
| 81 | 3300005354 | Ga0070675_100143703 | Ga0070675_1001437033 | 141 |
| 82 | 3300005355 | Ga0070671_101145475 | Ga0070671_1011454751 | 141 |
| 83 | 3300005366 | Ga0070659_100103597 | Ga0070659_1001035972 | 141 |
| 84 | 3300005455 | Ga0070663_100047846 | Ga0070663_1000478462 | 141 |
| 85 | 3300005455 | Ga0070663_100456199 | Ga0070663_1004561991 | 141 |
| 86 | 3300005457 | Ga0070662_100030113 | Ga0070662_1000301134 | 141 |
| 87 | 3300005457 | Ga0070662_100091571 | Ga0070662_1000915712 | 141 |
| 88 | 3300005530 | Ga0070679_100084575 | Ga0070679_1000845752 | 141 |
| 89 | 3300005535 | Ga0070684_100845035 | Ga0070684_1008450352 | 141 |
| 90 | 3300005539 | Ga0068853_100641939 | Ga0068853_1006419392 | 141 |
| 91 | 3300005563 | Ga0068855_100009460 | Ga0068855_1000094609 | 141 |
| 92 | 3300005563 | Ga0068855_100185629 | Ga0068855_1001856292 | 141 |
| 93 | 3300005563 | Ga0068855_100238359 | Ga0068855_1002383592 | 141 |
| 94 | 3300005577 | Ga0068857_100033196 | Ga0068857_1000331962 | 141 |
| 95 | 3300009093 | Ga0105240_10369510 | Ga0105240_103695102 | 141 |
| 96 | 3300011119 | Ga0105246_10003891 | Ga0105246_1000389110 | 141 |
| 97 | 3300013307 | Ga0157372_10266782 | Ga0157372_102667823 | 141 |
| 98 | 3300025909 | Ga0207705_10066559 | Ga0207705_100665591 | 141 |
| 99 | 3300025909 | Ga0207705_10487187 | Ga0207705_104871872 | 141 |
| 100 | 3300025914 | Ga0207671_10489463 | Ga0207671_104894631 | 141 |
| 101 | 3300025917 | Ga0207660_10376707 | Ga0207660_103767072 | 141 |
| 102 | 3300025919 | Ga0207657_10038981 | Ga0207657_100389812 | 141 |
| 103 | 3300025920 | Ga0207649_10137340 | Ga0207649_101373402 | 141 |
| 104 | 3300025921 | Ga0207652_10022405 | Ga0207652_100224055 | 141 |
| 105 | 3300025932 | Ga0207690_10125940 | Ga0207690_101259402 | 141 |
| 106 | 3300025933 | Ga0207706_10008461 | Ga0207706_100084615 | 141 |
| 107 | 3300025933 | Ga0207706_10076727 | Ga0207706_100767273 | 141 |
| 108 | 3300025949 | Ga0207667_10029439 | Ga0207667_100294392 | 141 |
| 109 | 3300025949 | Ga0207667_10094877 | Ga0207667_100948772 | 141 |
| 110 | 3300026041 | Ga0207639_10290415 | Ga0207639_102904152 | 141 |
| 111 | 3300026067 | Ga0207678_10038888 | Ga0207678_100388884 | 141 |
| 112 | 3300026067 | Ga0207678_10071764 | Ga0207678_100717642 | 141 |
| 113 | 3300026116 | Ga0207674_10078554 | Ga0207674_100785544 | 141 |
| 114 | 3300028573 | Ga0265334_10234962 | Ga0265334_102349622 | 141 |
| 115 | 3300045051 | Ga0451576_1284389 | Ga0451576_1284389_32_517 | 141 |
| 116 | 3300001979 | JGI24740J21852_10005324 | JGI24740J21852_100053247 | 142 |
| 117 | 3300001989 | JGI24739J22299_10031522 | JGI24739J22299_100315222 | 142 |
| 118 | 3300002459 | JGI24751J29686_10000248 | JGI24751J29686_1000024810 | 142 |
| 119 | 3300003322 | rootL2_10265637 | rootL2_102656372 | 142 |
| 120 | 3300003781 | Ga0055536_1002780 | Ga0055536_10027806 | 142 |
| 121 | 3300003781 | Ga0055536_1010687 | Ga0055536_10106872 | 142 |
| 122 | 3300003791 | Ga0055530_10000115 | Ga0055530_100001152 | 142 |
| 123 | 3300003791 | Ga0055530_10046727 | Ga0055530_100467271 | 142 |
| 124 | 3300003794 | Ga0055531_10039285 | Ga0055531_100392852 | 142 |
| 125 | 3300003794 | Ga0055531_10039478 | Ga0055531_100394782 | 142 |
| 126 | 3300005327 | Ga0070658_10448353 | Ga0070658_104483532 | 142 |
| 127 | 3300005330 | Ga0070690_100099382 | Ga0070690_1000993823 | 142 |
| 128 | 3300005331 | Ga0070670_100245654 | Ga0070670_1002456542 | 142 |
| 129 | 3300005333 | Ga0070677_10026023 | Ga0070677_100260232 | 142 |
| 130 | 3300005335 | Ga0070666_10046282 | Ga0070666_100462824 | 142 |
| 131 | 3300005338 | Ga0068868_100436311 | Ga0068868_1004363112 | 142 |
| 132 | 3300005343 | Ga0070687_100332802 | Ga0070687_1003328021 | 142 |
| 133 | 3300005353 | Ga0070669_100003265 | Ga0070669_1000032652 | 142 |
| 134 | 3300005354 | Ga0070675_100007371 | Ga0070675_1000073712 | 142 |
| 135 | 3300005355 | Ga0070671_100000268 | Ga0070671_1000002687 | 142 |
| 136 | 3300005355 | Ga0070671_100154261 | Ga0070671_1001542612 | 142 |
| 137 | 3300005364 | Ga0070673_100125776 | Ga0070673_1001257762 | 142 |
| 138 | 3300005367 | Ga0070667_100000377 | Ga0070667_10000037718 | 142 |
| 139 | 3300005367 | Ga0070667_100007492 | Ga0070667_1000074923 | 142 |
| 140 | 3300005367 | Ga0070667_100343349 | Ga0070667_1003433492 | 142 |
| 141 | 3300005456 | Ga0070678_100167875 | Ga0070678_1001678751 | 142 |
| 142 | 3300005466 | Ga0070685_10196035 | Ga0070685_101960351 | 142 |
| 143 | 3300005543 | Ga0070672_100072979 | Ga0070672_1000729794 | 142 |
| 144 | 3300005544 | Ga0070686_100010084 | Ga0070686_1000100844 | 142 |
| 145 | 3300005548 | Ga0070665_100023655 | Ga0070665_1000236556 | 142 |
| 146 | 3300005548 | Ga0070665_100392343 | Ga0070665_1003923432 | 142 |
| 147 | 3300005548 | Ga0070665_100861413 | Ga0070665_1008614132 | 142 |
| 148 | 3300005564 | Ga0070664_100167768 | Ga0070664_1001677681 | 142 |
| 149 | 3300005577 | Ga0068857_100383943 | Ga0068857_1003839432 | 142 |
| 150 | 3300005578 | Ga0068854_100172336 | Ga0068854_1001723363 | 142 |
| 151 | 3300005614 | Ga0068856_100534174 | Ga0068856_1005341741 | 142 |
| 152 | 3300005617 | Ga0068859_100128494 | Ga0068859_1001284942 | 142 |
| 153 | 3300005617 | Ga0068859_100220912 | Ga0068859_1002209121 | 142 |
| 154 | 3300005617 | Ga0068859_100323717 | Ga0068859_1003237172 | 142 |
| 155 | 3300005618 | Ga0068864_100107408 | Ga0068864_1001074083 | 142 |
| 156 | 3300005834 | Ga0068851_10133232 | Ga0068851_101332322 | 142 |
| 157 | 3300005841 | Ga0068863_100097552 | Ga0068863_1000975522 | 142 |
| 158 | 3300005841 | Ga0068863_100147109 | Ga0068863_1001471092 | 142 |
| 159 | 3300005841 | Ga0068863_100476409 | Ga0068863_1004764092 | 142 |
| 160 | 3300005842 | Ga0068858_100000803 | Ga0068858_10000080313 | 142 |
| 161 | 3300005842 | Ga0068858_100048753 | Ga0068858_1000487533 | 142 |
| 162 | 3300005843 | Ga0068860_100002959 | Ga0068860_10000295912 | 142 |
| 163 | 3300005843 | Ga0068860_100106589 | Ga0068860_1001065892 | 142 |
| 164 | 3300005844 | Ga0068862_100083545 | Ga0068862_1000835452 | 142 |
| 165 | 3300005844 | Ga0068862_100854420 | Ga0068862_1008544202 | 142 |
| 166 | 3300006195 | Ga0075366_10008138 | Ga0075366_100081384 | 142 |
| 167 | 3300006931 | Ga0097620_100128492 | Ga0097620_1001284922 | 142 |
| 168 | 3300006931 | Ga0097620_100220904 | Ga0097620_1002209042 | 142 |
| 169 | 3300006931 | Ga0097620_100323729 | Ga0097620_1003237292 | 142 |
| 170 | 3300006931 | Ga0097620_100384559 | Ga0097620_1003845592 | 142 |
| 171 | 3300006946 | Ga0079104_1011144 | Ga0079104_10111442 | 142 |
| 172 | 3300009093 | Ga0105240_10205345 | Ga0105240_102053452 | 142 |
| 173 | 3300009093 | Ga0105240_11217437 | Ga0105240_112174371 | 142 |
| 174 | 3300009098 | Ga0105245_10012492 | Ga0105245_100124922 | 142 |
| 175 | 3300009101 | Ga0105247_10051830 | Ga0105247_100518301 | 142 |
| 176 | 3300009148 | Ga0105243_10076652 | Ga0105243_100766522 | 142 |
| 177 | 3300009176 | Ga0105242_10258378 | Ga0105242_102583782 | 142 |
| 178 | 3300009177 | Ga0105248_10028901 | Ga0105248_100289013 | 142 |
| 179 | 3300009545 | Ga0105237_10367034 | Ga0105237_103670342 | 142 |
| 180 | 3300009545 | Ga0105237_10763565 | Ga0105237_107635651 | 142 |
| 181 | 3300009551 | Ga0105238_10721954 | Ga0105238_107219542 | 142 |
| 182 | 3300009553 | Ga0105249_10197558 | Ga0105249_101975582 | 142 |
| 183 | 3300013296 | Ga0157374_10342730 | Ga0157374_103427302 | 142 |
| 184 | 3300013297 | Ga0157378_10036010 | Ga0157378_100360102 | 142 |
| 185 | 3300013306 | Ga0163162_10097805 | Ga0163162_100978052 | 142 |
| 186 | 3300013306 | Ga0163162_10351772 | Ga0163162_103517721 | 142 |
| 187 | 3300013308 | Ga0157375_10113547 | Ga0157375_101135472 | 142 |
| 188 | 3300013308 | Ga0157375_10924373 | Ga0157375_109243732 | 142 |
| 189 | 3300014325 | Ga0163163_10191752 | Ga0163163_101917521 | 142 |
| 190 | 3300014745 | Ga0157377_10485968 | Ga0157377_104859681 | 142 |
| 191 | 3300017792 | Ga0163161_10161869 | Ga0163161_101618692 | 142 |
| 192 | 3300025250 | Ga0209026_1024863 | Ga0209026_10248632 | 142 |
| 193 | 3300025272 | Ga0209455_1018055 | Ga0209455_10180552 | 142 |
| 194 | 3300025291 | Ga0209675_1000104 | Ga0209675_100010452 | 142 |
| 195 | 3300025292 | Ga0209676_1000512 | Ga0209676_100051233 | 142 |
| 196 | 3300025292 | Ga0209676_1001456 | Ga0209676_10014562 | 142 |
| 197 | 3300025292 | Ga0209676_1018292 | Ga0209676_10182923 | 142 |
| 198 | 3300025294 | Ga0209025_1020363 | Ga0209025_10203633 | 142 |
| 199 | 3300025294 | Ga0209025_1056248 | Ga0209025_10562482 | 142 |
| 200 | 3300025297 | Ga0209758_1041823 | Ga0209758_10418232 | 142 |
| 201 | 3300025298 | Ga0209050_1000286 | Ga0209050_100028665 | 142 |
| 202 | 3300025298 | Ga0209050_1003173 | Ga0209050_10031732 | 142 |
| 203 | 3300025304 | Ga0209257_1000245 | Ga0209257_100024561 | 142 |
| 204 | 3300025304 | Ga0209257_1000321 | Ga0209257_100032127 | 142 |
| 205 | 3300025304 | Ga0209257_1002319 | Ga0209257_100231913 | 142 |
| 206 | 3300025315 | Ga0207697_10043975 | Ga0207697_100439752 | 142 |
| 207 | 3300025900 | Ga0207710_10062599 | Ga0207710_100625991 | 142 |
| 208 | 3300025913 | Ga0207695_10617947 | Ga0207695_106179472 | 142 |
| 209 | 3300025923 | Ga0207681_10000260 | Ga0207681_100002602 | 142 |
| 210 | 3300025924 | Ga0207694_10023969 | Ga0207694_100239694 | 142 |
| 211 | 3300025926 | Ga0207659_10021746 | Ga0207659_100217462 | 142 |
| 212 | 3300025927 | Ga0207687_10003478 | Ga0207687_100034788 | 142 |
| 213 | 3300025931 | Ga0207644_10000008 | Ga0207644_10000008350 | 142 |
| 214 | 3300025931 | Ga0207644_10319835 | Ga0207644_103198352 | 142 |
| 215 | 3300025940 | Ga0207691_10109620 | Ga0207691_101096202 | 142 |
| 216 | 3300025941 | Ga0207711_10119135 | Ga0207711_101191353 | 142 |
| 217 | 3300025941 | Ga0207711_10142917 | Ga0207711_101429172 | 142 |
| 218 | 3300025949 | Ga0207667_10000881 | Ga0207667_1000088110 | 142 |
| 219 | 3300025949 | Ga0207667_10305402 | Ga0207667_103054021 | 142 |
| 220 | 3300025960 | Ga0207651_10611176 | Ga0207651_106111761 | 142 |
| 221 | 3300025972 | Ga0207668_10041281 | Ga0207668_100412812 | 142 |
| 222 | 3300025986 | Ga0207658_10000813 | Ga0207658_100008136 | 142 |
| 223 | 3300025986 | Ga0207658_10055762 | Ga0207658_100557622 | 142 |
| 224 | 3300025986 | Ga0207658_10141750 | Ga0207658_101417502 | 142 |
| 225 | 3300026023 | Ga0207677_10377139 | Ga0207677_103771392 | 142 |
| 226 | 3300026035 | Ga0207703_10001170 | Ga0207703_1000117014 | 142 |
| 227 | 3300026035 | Ga0207703_10018441 | Ga0207703_100184412 | 142 |
| 228 | 3300026035 | Ga0207703_10087280 | Ga0207703_100872802 | 142 |
| 229 | 3300026088 | Ga0207641_10083693 | Ga0207641_100836932 | 142 |
| 230 | 3300026116 | Ga0207674_10380065 | Ga0207674_103800652 | 142 |
| 231 | 3300026116 | Ga0207674_10645308 | Ga0207674_106453081 | 142 |
| 232 | 3300026118 | Ga0207675_100400608 | Ga0207675_1004006081 | 142 |
| 233 | 3300026121 | Ga0207683_10148294 | Ga0207683_101482942 | 142 |
| 234 | 3300027111 | Ga0209281_1011771 | Ga0209281_10117712 | 142 |
| 235 | 3300028379 | Ga0268266_10021490 | Ga0268266_100214907 | 142 |
| 236 | 3300028380 | Ga0268265_10128282 | Ga0268265_101282823 | 142 |
| 237 | 3300028380 | Ga0268265_10633196 | Ga0268265_106331961 | 142 |
| 238 | 3300028381 | Ga0268264_10081233 | Ga0268264_100812331 | 142 |
| 239 | 3300028381 | Ga0268264_10111744 | Ga0268264_101117442 | 142 |
| 240 | 3300028786 | Ga0307517_10032173 | Ga0307517_100321737 | 142 |
| 241 | 3300028794 | Ga0307515_10452649 | Ga0307515_104526492 | 142 |
| 242 | 3300031456 | Ga0307513_10030193 | Ga0307513_100301937 | 142 |
| 243 | 3300031456 | Ga0307513_10099351 | Ga0307513_100993512 | 142 |
| 244 | 3300031507 | Ga0307509_10199470 | Ga0307509_101994702 | 142 |
| 245 | 3300031616 | Ga0307508_10000011 | Ga0307508_1000001117 | 142 |
| 246 | 3300031911 | Ga0307412_10097536 | Ga0307412_100975362 | 142 |
| 247 | 3300032004 | Ga0307414_10003045 | Ga0307414_100030451 | 142 |
| 248 | 3300032004 | Ga0307414_10134838 | Ga0307414_101348381 | 142 |
| 249 | 3300032004 | Ga0307414_10334220 | Ga0307414_103342202 | 142 |
| 250 | 3300032005 | Ga0307411_10207725 | Ga0307411_102077252 | 142 |
| 251 | 3300036401 | Ga0373937_0198592 | Ga0373937_0198592_704_1141 | 142 |
| 252 | 3300041451 | Ga0451791_1368899 | Ga0451791_1368899_11_457 | 142 |
| 253 | 3300041486 | Ga0451807_2558812 | Ga0451807_2558812_133_567 | 142 |
| 254 | 3300041507 | Ga0451851_0890183 | Ga0451851_0890183_148_582 | 142 |
| 255 | 3300041512 | Ga0451853_2126796 | Ga0451853_2126796_209_643 | 142 |
| 256 | 3300045051 | Ga0451576_0000017 | Ga0451576_0000017_108642_109109 | 142 |
| 257 | 3300046471 | Ga0495650_0073152 | Ga0495650_0073152_692_1129 | 142 |
| 258 | 3300046492 | Ga0495585_0186864 | Ga0495585_0186864_70_513 | 142 |
| 259 | 3300047320 | Ga0495672_0335753 | Ga0495672_0335753_133_567 | 142 |
| 260 | 3300047470 | Ga0495681_0214730 | Ga0495681_0214730_43_516 | 142 |
| 261 | 3300048903 | Ga0496100_0190025 | Ga0496100_0190025_585_1073 | 142 |
| 262 | 3300048904 | Ga0496101_0046344 | Ga0496101_0046344_1340_1828 | 142 |
| 263 | 3300048905 | Ga0496102_0067865 | Ga0496102_0067865_811_1299 | 142 |
| 264 | 3300048906 | Ga0496103_0017415 | Ga0496103_0017415_2553_3041 | 142 |
| 265 | 3300048907 | Ga0496104_0090530 | Ga0496104_0090530_1553_2041 | 142 |
| 266 | 3300048908 | Ga0496105_0076140 | Ga0496105_0076140_86_574 | 142 |
| 267 | 3300048909 | Ga0496106_0005097 | Ga0496106_0005097_418_906 | 142 |
| 268 | 3300048910 | Ga0496107_0010144 | Ga0496107_0010144_1978_2466 | 142 |
| 269 | 3300048911 | Ga0496108_0021289 | Ga0496108_0021289_3398_3886 | 142 |
| 270 | 3300048911 | Ga0496108_0168946 | Ga0496108_0168946_1279_1713 | 142 |
| 271 | 3300048912 | Ga0496109_0106648 | Ga0496109_0106648_1584_2072 | 142 |
| 272 | 3300048914 | Ga0496111_0027115 | Ga0496111_0027115_1838_2326 | 142 |
| 273 | 3300048915 | Ga0496112_0282853 | Ga0496112_0282853_481_969 | 142 |
| 274 | 3300048916 | Ga0496113_0020024 | Ga0496113_0020024_3215_3703 | 142 |
| 275 | 3300048917 | Ga0496114_0413007 | Ga0496114_0413007_110_598 | 142 |
| 276 | 3300049569 | Ga0501032_0909405 | Ga0501032_0909405_107_541 | 142 |
| 277 | 3300049570 | Ga0501033_0053763 | Ga0501033_0053763_1879_2331 | 142 |
| 278 | 3300049571 | Ga0501034_0029942 | Ga0501034_0029942_208_660 | 142 |
| 279 | 3300049572 | Ga0501036_0027242 | Ga0501036_0027242_1659_2111 | 142 |
| 280 | 3300049573 | Ga0501037_0096601 | Ga0501037_0096601_1360_1812 | 142 |
| 281 | 3300049574 | Ga0501038_0062429 | Ga0501038_0062429_2684_3136 | 142 |
| 282 | 3300049578 | Ga0501042_0343811 | Ga0501042_0343811_160_612 | 142 |
| 283 | 3300049580 | Ga0501046_0498102 | Ga0501046_0498102_159_611 | 142 |
| 284 | 3300049581 | Ga0501047_0236348 | Ga0501047_0236348_811_1245 | 142 |
| 285 | 3300049582 | Ga0501048_0331102 | Ga0501048_0331102_171_623 | 142 |
| 286 | 3300049822 | Ga0501035_0090616 | Ga0501035_0090616_373_825 | 142 |
| 287 | 3300049822 | Ga0501035_0495642 | Ga0501035_0495642_523_993 | 142 |
| 288 | 3300049822 | Ga0501035_0524721 | Ga0501035_0524721_269_721 | 142 |
| 289 | 3300049822 | Ga0501035_1488216 | Ga0501035_1488216_37_471 | 142 |
| 290 | 3300049823 | Ga0501044_0383504 | Ga0501044_0383504_81_515 | 142 |
| 291 | 3300049823 | Ga0501044_0791058 | Ga0501044_0791058_221_655 | 142 |
| 292 | 3300053119 | Ga0500595_022041 | Ga0500595_022041_268_729 | 142 |
| 293 | 3300053136 | Ga0500559_0158151 | Ga0500559_0158151_598_1041 | 142 |
| 294 | 3300053136 | Ga0500559_0229684 | Ga0500559_0229684_185_622 | 142 |
| 295 | 3300053735 | Ga0500596_004081 | Ga0500596_004081_895_1332 | 142 |
| 296 | iso_pu_bacteria | 2643221563 | 2643834965 | 142 |
| 297 | iso_pu_bacteria | 2643221608 | 2644055892 | 142 |
| 298 | iso_pu_bacteria | 2738541275 | 2738711220 | 142 |
| 299 | iso_pu_bacteria | 2738541301 | 2738849645 | 142 |
| 300 | iso_pu_bacteria | 2738541304 | 2738865374 | 142 |
| 301 | iso_pu_bacteria | 2738543022 | 2739297892 | 142 |
| 302 | iso_pu_bacteria | 2738543033 | 2739359570 | 142 |
| 303 | iso_pu_bacteria | 2852653556 | 2852655836 | 142 |
| 304 | iso_pu_bacteria | 2895880812 | 2895882321 | 142 |
| 305 | iso_pu_bacteria | 2928100450 | 2928103964 | 142 |
| 306 | iso_pu_bacteria | 2928959182 | 2928961492 | 142 |
| 307 | 3300000041 | ARcpr5oldR_c004327 | ARcpr5oldR_0043272 | 143 |
| 308 | 3300000043 | ARcpr5yngRDRAFT_c005971 | ARcpr5yngRDRAFT_0059712 | 143 |
| 309 | 3300001989 | JGI24739J22299_10041287 | JGI24739J22299_100412871 | 143 |
| 310 | 3300002774 | JGI25150J39212_1000189 | JGI25150J39212_10001891 | 143 |
| 311 | 3300002774 | JGI25150J39212_1014466 | JGI25150J39212_10144662 | 143 |
| 312 | 3300003187 | JGI25151J46595_10037663 | JGI25151J46595_100376633 | 143 |
| 313 | 3300003214 | JGI25165J46597_1000010 | JGI25165J46597_1000010106 | 143 |
| 314 | 3300003215 | JGI25153J46596_10000125 | JGI25153J46596_1000012575 | 143 |
| 315 | 3300003215 | JGI25153J46596_10021376 | JGI25153J46596_100213763 | 143 |
| 316 | 3300003771 | Ga0055526_1026363 | Ga0055526_10263632 | 143 |
| 317 | 3300003773 | Ga0055537_1000852 | Ga0055537_100085216 | 143 |
| 318 | 3300003775 | Ga0055524_1000387 | Ga0055524_10003878 | 143 |
| 319 | 3300003781 | Ga0055536_1005046 | Ga0055536_10050463 | 143 |
| 320 | 3300003790 | Ga0055528_1020769 | Ga0055528_10207692 | 143 |
| 321 | 3300003791 | Ga0055530_10001385 | Ga0055530_100013857 | 143 |
| 322 | 3300003791 | Ga0055530_10011223 | Ga0055530_100112234 | 143 |
| 323 | 3300003791 | Ga0055530_10031272 | Ga0055530_100312721 | 143 |
| 324 | 3300003792 | Ga0055540_1001895 | Ga0055540_100189510 | 143 |
| 325 | 3300003794 | Ga0055531_10007918 | Ga0055531_100079182 | 143 |
| 326 | 3300003794 | Ga0055531_10041570 | Ga0055531_100415701 | 143 |
| 327 | 3300003794 | Ga0055531_10058207 | Ga0055531_100582072 | 143 |
| 328 | 3300005262 | Ga0065165_1010466 | Ga0065165_10104662 | 143 |
| 329 | 3300005262 | Ga0065165_1095073 | Ga0065165_10950732 | 143 |
| 330 | 3300005262 | Ga0065165_1100922 | Ga0065165_11009221 | 143 |
| 331 | 3300005335 | Ga0070666_10409910 | Ga0070666_104099101 | 143 |
| 332 | 3300005355 | Ga0070671_100593314 | Ga0070671_1005933142 | 143 |
| 333 | 3300005367 | Ga0070667_100011507 | Ga0070667_1000115074 | 143 |
| 334 | 3300005548 | Ga0070665_100025894 | Ga0070665_1000258942 | 143 |
| 335 | 3300005578 | Ga0068854_100169228 | Ga0068854_1001692282 | 143 |
| 336 | 3300005618 | Ga0068864_100001638 | Ga0068864_1000016387 | 143 |
| 337 | 3300005841 | Ga0068863_100000778 | Ga0068863_1000007782 | 143 |
| 338 | 3300005843 | Ga0068860_100000422 | Ga0068860_10000042232 | 143 |
| 339 | 3300005844 | Ga0068862_100022982 | Ga0068862_1000229823 | 143 |
| 340 | 3300005985 | Ga0081539_10115794 | Ga0081539_101157941 | 143 |
| 341 | 3300006051 | Ga0075364_10000934 | Ga0075364_100009348 | 143 |
| 342 | 3300009177 | Ga0105248_10161041 | Ga0105248_101610412 | 143 |
| 343 | 3300009545 | Ga0105237_10032356 | Ga0105237_100323564 | 143 |
| 344 | 3300010375 | Ga0105239_10312085 | Ga0105239_103120853 | 143 |
| 345 | 3300013102 | Ga0157371_10048467 | Ga0157371_100484671 | 143 |
| 346 | 3300021388 | Ga0213875_10000166 | Ga0213875_1000016645 | 143 |
| 347 | 3300025245 | Ga0207425_1000005 | Ga0207425_1000005838 | 143 |
| 348 | 3300025258 | Ga0209129_1000345 | Ga0209129_10003451 | 143 |
| 349 | 3300025261 | Ga0209233_1000044 | Ga0209233_1000044377 | 143 |
| 350 | 3300025263 | Ga0209565_1000052 | Ga0209565_1000052215 | 143 |
| 351 | 3300025273 | Ga0209673_1051784 | Ga0209673_10517842 | 143 |
| 352 | 3300025292 | Ga0209676_1012010 | Ga0209676_10120102 | 143 |
| 353 | 3300025294 | Ga0209025_1001007 | Ga0209025_100100741 | 143 |
| 354 | 3300025295 | Ga0209564_1018743 | Ga0209564_10187434 | 143 |
| 355 | 3300025295 | Ga0209564_1022881 | Ga0209564_10228813 | 143 |
| 356 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002507 | 143 |
| 357 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001458 | 143 |
| 358 | 3300025298 | Ga0209050_1021898 | Ga0209050_10218983 | 143 |
| 359 | 3300025302 | Ga0207426_1006259 | Ga0207426_10062591 | 143 |
| 360 | 3300025303 | Ga0209051_1000472 | Ga0209051_100047246 | 143 |
| 361 | 3300025304 | Ga0209257_1011475 | Ga0209257_10114752 | 143 |
| 362 | 3300025304 | Ga0209257_1041739 | Ga0209257_10417392 | 143 |
| 363 | 3300025903 | Ga0207680_10238749 | Ga0207680_102387491 | 143 |
| 364 | 3300025914 | Ga0207671_10002056 | Ga0207671_1000205624 | 143 |
| 365 | 3300025923 | Ga0207681_10213351 | Ga0207681_102133512 | 143 |
| 366 | 3300025931 | Ga0207644_10449883 | Ga0207644_104498831 | 143 |
| 367 | 3300025934 | Ga0207686_10155988 | Ga0207686_101559882 | 143 |
| 368 | 3300025941 | Ga0207711_11209712 | Ga0207711_112097122 | 143 |
| 369 | 3300025961 | Ga0207712_11109327 | Ga0207712_111093272 | 143 |
| 370 | 3300025981 | Ga0207640_10003971 | Ga0207640_100039715 | 143 |
| 371 | 3300025981 | Ga0207640_10441555 | Ga0207640_104415551 | 143 |
| 372 | 3300025986 | Ga0207658_10002531 | Ga0207658_100025315 | 143 |
| 373 | 3300026041 | Ga0207639_10078805 | Ga0207639_100788052 | 143 |
| 374 | 3300026088 | Ga0207641_10000098 | Ga0207641_10000098101 | 143 |
| 375 | 3300026095 | Ga0207676_10010385 | Ga0207676_100103854 | 143 |
| 376 | 3300027717 | Ga0209998_10063992 | Ga0209998_100639922 | 143 |
| 377 | 3300028379 | Ga0268266_10005988 | Ga0268266_100059885 | 143 |
| 378 | 3300028380 | Ga0268265_10002675 | Ga0268265_100026752 | 143 |
| 379 | 3300028381 | Ga0268264_10000224 | Ga0268264_1000022416 | 143 |
| 380 | 3300028786 | Ga0307517_10111580 | Ga0307517_101115802 | 143 |
| 381 | 3300031456 | Ga0307513_10231556 | Ga0307513_102315561 | 143 |
| 382 | 3300031548 | Ga0307408_100074072 | Ga0307408_1000740722 | 143 |
| 383 | 3300031731 | Ga0307405_10345683 | Ga0307405_103456832 | 143 |
| 384 | 3300031731 | Ga0307405_10613309 | Ga0307405_106133091 | 143 |
| 385 | 3300031824 | Ga0307413_10184769 | Ga0307413_101847692 | 143 |
| 386 | 3300031824 | Ga0307413_10202556 | Ga0307413_102025561 | 143 |
| 387 | 3300031852 | Ga0307410_10269910 | Ga0307410_102699102 | 143 |
| 388 | 3300031852 | Ga0307410_10361342 | Ga0307410_103613421 | 143 |
| 389 | 3300031852 | Ga0307410_10532590 | Ga0307410_105325902 | 143 |
| 390 | 3300031901 | Ga0307406_10103492 | Ga0307406_101034923 | 143 |
| 391 | 3300031911 | Ga0307412_10002381 | Ga0307412_1000238111 | 143 |
| 392 | 3300031911 | Ga0307412_10269069 | Ga0307412_102690692 | 143 |
| 393 | 3300031911 | Ga0307412_10690497 | Ga0307412_106904971 | 143 |
| 394 | 3300031995 | Ga0307409_100715686 | Ga0307409_1007156862 | 143 |
| 395 | 3300032002 | Ga0307416_100227030 | Ga0307416_1002270302 | 143 |
| 396 | 3300032004 | Ga0307414_10111869 | Ga0307414_101118692 | 143 |
| 397 | 3300032004 | Ga0307414_10693448 | Ga0307414_106934481 | 143 |
| 398 | 3300032005 | Ga0307411_10252648 | Ga0307411_102526481 | 143 |
| 399 | 3300032005 | Ga0307411_11517193 | Ga0307411_115171931 | 143 |
| 400 | 3300037853 | Ga0436364_0545952 | Ga0436364_0545952_37068_37523 | 143 |
| 401 | 3300039437 | Ga0436365_1367690 | Ga0436365_1367690_174_629 | 143 |
| 402 | 3300041413 | Ga0439465_0058128 | Ga0439465_0058128_310_780 | 143 |
| 403 | 3300041451 | Ga0451791_1274022 | Ga0451791_1274022_119_574 | 143 |
| 404 | 3300041451 | Ga0451791_1794905 | Ga0451791_1794905_14_448 | 143 |
| 405 | 3300041503 | Ga0451847_0004174 | Ga0451847_0004174_137_577 | 143 |
| 406 | 3300041509 | Ga0451843_1087739 | Ga0451843_1087739_76_543 | 143 |
| 407 | 3300042127 | Ga0450890_018179 | Ga0450890_018179_194_664 | 143 |
| 408 | 3300042435 | Ga0439434_0031460 | Ga0439434_0031460_650_1120 | 143 |
| 409 | 3300044683 | Ga0466965_0475167 | Ga0466965_0475167_131_565 | 143 |
| 410 | 3300046524 | Ga0495648_0364478 | Ga0495648_0364478_149_583 | 143 |
| 411 | 3300046526 | Ga0495666_0039961 | Ga0495666_0039961_1530_1991 | 143 |
| 412 | 3300046530 | Ga0495654_0302362 | Ga0495654_0302362_69_521 | 143 |
| 413 | 3300046660 | Ga0495625_0000094 | Ga0495625_0000094_82371_82808 | 143 |
| 414 | 3300046691 | Ga0495670_0000016 | Ga0495670_0000016_69229_69663 | 143 |
| 415 | 3300046691 | Ga0495670_0054475 | Ga0495670_0054475_1006_1443 | 143 |
| 416 | 3300046691 | Ga0495670_0466083 | Ga0495670_0466083_37_471 | 143 |
| 417 | 3300047472 | Ga0495686_0247187 | Ga0495686_0247187_154_588 | 143 |
| 418 | 3300048903 | Ga0496100_0739465 | Ga0496100_0739465_22_459 | 143 |
| 419 | 3300048906 | Ga0496103_0629934 | Ga0496103_0629934_162_599 | 143 |
| 420 | 3300048906 | Ga0496103_0762269 | Ga0496103_0762269_149_586 | 143 |
| 421 | 3300048907 | Ga0496104_0408310 | Ga0496104_0408310_692_1186 | 143 |
| 422 | 3300048908 | Ga0496105_0013455 | Ga0496105_0013455_5545_6039 | 143 |
| 423 | 3300048918 | Ga0496115_0001166 | Ga0496115_0001166_5919_6362 | 143 |
| 424 | 3300048921 | Ga0496118_0109422 | Ga0496118_0109422_321_833 | 143 |
| 425 | 3300048923 | Ga0496120_0056862 | Ga0496120_0056862_179_616 | 143 |
| 426 | 3300048924 | Ga0496121_0000276 | Ga0496121_0000276_89765_90277 | 143 |
| 427 | 3300048924 | Ga0496121_0392561 | Ga0496121_0392561_299_793 | 143 |
| 428 | 3300048925 | Ga0496122_0137465 | Ga0496122_0137465_141_578 | 143 |
| 429 | 3300048926 | Ga0496123_0055545 | Ga0496123_0055545_636_1073 | 143 |
| 430 | 3300048927 | Ga0496124_0000675 | Ga0496124_0000675_48062_48499 | 143 |
| 431 | 3300048927 | Ga0496124_0008603 | Ga0496124_0008603_6771_7208 | 143 |
| 432 | 3300048928 | Ga0496125_0184909 | Ga0496125_0184909_225_662 | 143 |
| 433 | 3300048928 | Ga0496125_0226076 | Ga0496125_0226076_415_855 | 143 |
| 434 | 3300049513 | Ga0501290_018506 | Ga0501290_018506_219_653 | 143 |
| 435 | 3300049515 | Ga0501292_000013 | Ga0501292_000013_48384_48818 | 143 |
| 436 | 3300049516 | Ga0501293_009077 | Ga0501293_009077_177_611 | 143 |
| 437 | 3300049517 | Ga0501294_004900 | Ga0501294_004900_431_865 | 143 |
| 438 | 3300049523 | Ga0501300_003447 | Ga0501300_003447_1721_2155 | 143 |
| 439 | 3300049523 | Ga0501300_006273 | Ga0501300_006273_491_925 | 143 |
| 440 | 3300049531 | Ga0501315_053374 | Ga0501315_053374_186_620 | 143 |
| 441 | 3300049533 | Ga0501317_055566 | Ga0501317_055566_186_620 | 143 |
| 442 | 3300049571 | Ga0501034_0009756 | Ga0501034_0009756_8175_8624 | 143 |
| 443 | 3300049572 | Ga0501036_0495554 | Ga0501036_0495554_405_854 | 143 |
| 444 | 3300049573 | Ga0501037_0358439 | Ga0501037_0358439_235_702 | 143 |
| 445 | 3300049653 | Ga0501206_021297 | Ga0501206_021297_308_742 | 143 |
| 446 | 3300049662 | Ga0501222_000744 | Ga0501222_000744_318_752 | 143 |
| 447 | 3300049663 | Ga0501223_000447 | Ga0501223_000447_3378_3812 | 143 |
| 448 | 3300049664 | Ga0501224_028867 | Ga0501224_028867_223_657 | 143 |
| 449 | 3300049665 | Ga0501227_039492 | Ga0501227_039492_537_971 | 143 |
| 450 | 3300049665 | Ga0501227_153721 | Ga0501227_153721_12_446 | 143 |
| 451 | 3300049668 | Ga0501233_000149 | Ga0501233_000149_1237_1686 | 143 |
| 452 | 3300049668 | Ga0501233_103076 | Ga0501233_103076_119_553 | 143 |
| 453 | 3300049670 | Ga0501236_054647 | Ga0501236_054647_226_660 | 143 |
| 454 | 3300049686 | Ga0501257_000010 | Ga0501257_000010_25502_25936 | 143 |
| 455 | 3300049686 | Ga0501257_111949 | Ga0501257_111949_124_558 | 143 |
| 456 | 3300049688 | Ga0501259_000881 | Ga0501259_000881_706_1140 | 143 |
| 457 | 3300049690 | Ga0501261_000272 | Ga0501261_000272_480_914 | 143 |
| 458 | 3300049704 | Ga0501221_008430 | Ga0501221_008430_618_1052 | 143 |
| 459 | 3300049705 | Ga0501225_0002623 | Ga0501225_0002623_655_1089 | 143 |
| 460 | 3300049708 | Ga0501245_026078 | Ga0501245_026078_312_746 | 143 |
| 461 | 3300049758 | Ga0501241_006510 | Ga0501241_006510_351_785 | 143 |
| 462 | 3300049775 | Ga0501279_000004 | Ga0501279_000004_75909_76343 | 143 |
| 463 | 3300049776 | Ga0501280_000054 | Ga0501280_000054_25341_25775 | 143 |
| 464 | 3300049776 | Ga0501280_015484 | Ga0501280_015484_353_787 | 143 |
| 465 | 3300049777 | Ga0501281_02871 | Ga0501281_02871_568_1002 | 143 |
| 466 | 3300049778 | Ga0501282_000366 | Ga0501282_000366_1297_1731 | 143 |
| 467 | 3300049779 | Ga0501283_021039 | Ga0501283_021039_502_936 | 143 |
| 468 | 3300050489 | nmdc:mga03683_298639_c1 | nmdc:mga03683_298639_c1_214_672 | 143 |
| 469 | 3300050491 | nmdc:mga00v17_82975_c1 | nmdc:mga00v17_82975_c1_467_925 | 143 |
| 470 | 3300050496 | nmdc:mga07m45_19876_c2 | nmdc:mga07m45_19876_c2_2624_3091 | 143 |
| 471 | 3300053087 | Ga0500643_000566 | Ga0500643_000566_767_1201 | 143 |
| 472 | 3300053103 | Ga0500555_033828 | Ga0500555_033828_576_1043 | 143 |
| 473 | 3300053121 | Ga0500607_000023 | Ga0500607_000023_458_925 | 143 |
| 474 | 3300053128 | Ga0500626_086911 | Ga0500626_086911_698_1168 | 143 |
| 475 | 3300053131 | Ga0500652_111710 | Ga0500652_111710_654_1088 | 143 |
| 476 | 3300053136 | Ga0500559_0001189 | Ga0500559_0001189_487_954 | 143 |
| 477 | 3300053136 | Ga0500559_0322127 | Ga0500559_0322127_220_702 | 143 |
| 478 | 3300053139 | Ga0500568_0017156 | Ga0500568_0017156_373_810 | 143 |
| 479 | 3300053151 | Ga0500604_0168030 | Ga0500604_0168030_270_707 | 143 |
| 480 | 3300053153 | Ga0500616_0099003 | Ga0500616_0099003_70_507 | 143 |
| 481 | 3300053177 | Ga0500636_0392927 | Ga0500636_0392927_11_457 | 143 |
| 482 | 3300053178 | Ga0500637_0022998 | Ga0500637_0022998_371_838 | 143 |
| 483 | 3300053730 | Ga0500645_001934 | Ga0500645_001934_9026_9493 | 143 |
| 484 | 3300060353 | Ga0501082_1193202 | Ga0501082_1193202_112_603 | 143 |
| 485 | iso_pu_bacteria | 2512564014 | 2512641670 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bq1-assembly2.cif.gz_B | crystal structure of of lamacat from zobellia galactanivorans | 0.6694 | 64 | 110 |
| 4bow-assembly2.cif.gz_B | crystal structure of lama_e269s from z. galactanivorans in complex with laminaritriose and laminaritetraose | 0.6387 | 64 | 112 |
| 7rct-assembly2.cif.gz_A | non-receptor protein tyrosine phosphatase shp2 in complex with allosteric inhibitor rmc-4550 | 0.634 | 64 | 118 |
| 8b5y-assembly2.cif.gz_B | shp2 in complex with allosteric imidazopyrazine inhibitor | 0.6279 | 64 | 118 |
| 5jk2-assembly10.cif.gz_C | crystal structure of treponema pallidum tp0751 (pallilysin) | 0.6197 | 57 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4IC37_67_372_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.6507 | 56 | 92 | 1.10.510.10 |
| 4bowB00 | Mainly Beta;Sandwich;Jelly Rolls; | 0.6387 | 64 | 112 | 2.60.120.200 |
| af_A0A1D6IAQ7_358_563_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.6367 | 58 | 119 | 2.120.10.80 |
| af_Q9VYU8_55_295_2.60.40.4100 | Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-C domain | 0.6216 | 71 | 109 | 2.60.40.4100 |
| af_Q553M5_423_536_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.6174 | 103 | 143 | 2.30.29.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4SWN4-F1-model_v4 | Uncharacterized protein CC_3748 | 0.9896 | 38 | 143 |
|
| AF-A0A2E6CB92-F1-model_v4 | DUF3576 domain-containing protein | 0.9827 | 39 | 142 |
|
| AF-A0A3C0Q3Q6-F1-model_v4 | DUF3576 domain-containing protein | 0.9741 | 55 | 139 |
|
| AF-A0A6J4SWN4-F1-model_v4 | Uncharacterized protein CC_3748 | 0.9714 | 38 | 143 |
|
| AF-A0A7C3C0K4-F1-model_v4 | DUF3576 domain-containing protein | 0.9685 | 64 | 142 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar