F453285

General Info

Members Datasets Scaffolds Average Seq Length
486 274 972 145

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10000051|Ga0307513_1000005157
Length 156
Sequence MKGWEEVMNFGADIPFVNHLGFELELFTGGASAIGYTPKPEHLNSFAVTHGGAIMTLLDVTMATAARSVDKDMGVVTIEMKTSFMRPAPGDGSRLTAKGRLMHRTKTMAFTEATLYDVLGQACAHSTGTFKYVKRLPTGPESANAPNGPDGAISTD

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
166 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
167 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
168 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
169 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
172 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
173 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
176 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
177 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
180 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
181 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
224 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
240 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
255 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
256 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
257 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
264 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
265 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
266 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
267 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
268 2643221570 Acidovorax sp. Root568 Isolate Unclassified
269 2643221596 Acidovorax sp. Root70 Isolate Unclassified
270 2643221652 Acidovorax sp. Root402 Isolate Unclassified
271 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
272 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
273 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
274 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.25
Nodule 0.21
Rhizoplane 1.03
Rhizosphere 59.26
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10000051 3300031456 Bacteria 149733
2 JGI25155J39150_1000002 3300002704 Bacteria 292156
3 JGI25156J39149_1000003 3300002705 Bacteria 305434
4 JGI25154J39366_1000009 3300002738 Bacteria 305408
5 JGI25157J39369_1000002 3300002741 Bacteria 305434
6 JGI25159J45721_1000302 3300002987 Bacteria 23151
7 JGI25159J45721_1000502 3300002987 Bacteria 17895
8 JGI25151J46595_10017838 3300003187 Bacteria 3065
9 JGI25151J46595_10025203 3300003187 Bacteria 2423
10 JGI25151J46595_10044421 3300003187 Bacteria 1578
11 rootH1_10025590 3300003316 Bacteria 1210
12 JGI25160J50197_1000145 3300003354 Bacteria 63479
13 JGI25161J50226_1000032 3300003374 Bacteria 138440
14 JGI25161J50226_1000064 3300003374 Bacteria 99448
15 Ga0055526_1003563 3300003771 Bacteria 9805
16 Ga0055526_1009997 3300003771 Bacteria 4477
17 Ga0055537_1000043 3300003773 Bacteria 90816
18 Ga0055537_1008563 3300003773 Bacteria 2346
19 Ga0055524_1000012 3300003775 Bacteria 260384
20 Ga0055536_1004794 3300003781 Bacteria 6779
21 Ga0055534_1005165 3300003784 Bacteria 3576
22 Ga0055528_1000717 3300003790 Bacteria 23401
23 Ga0055530_10000015 3300003791 Bacteria 148790
24 Ga0055530_10035307 3300003791 Bacteria 1269
25 Ga0055530_10089805 3300003791 Bacteria 632
26 Ga0055540_1000012 3300003792 Bacteria 262667
27 Ga0055540_1000039 3300003792 Bacteria 161844
28 Ga0055540_1013853 3300003792 Bacteria 2440
29 Ga0055531_10001591 3300003794 Bacteria 16513
30 Ga0055531_10006340 3300003794 Bacteria 6734
31 Ga0055531_10114267 3300003794 Bacteria 535
32 Ga0055543_1000752 3300004625 Bacteria 16244
33 Ga0065165_1007478 3300005262 Bacteria 5355
34 Ga0065165_1016049 3300005262 Bacteria 2823
35 Ga0065165_1016671 3300005262 Bacteria 2741
36 Ga0065165_1065678 3300005262 Bacteria 978
37 Ga0065704_10162087 3300005289 Bacteria 1347
38 Ga0070658_10449559 3300005327 Bacteria 1110
39 Ga0070658_10690412 3300005327 Bacteria 886
40 Ga0070676_10006620 3300005328 Bacteria 6199
41 Ga0070676_10539101 3300005328 Bacteria 834
42 Ga0070670_100086168 3300005331 Bacteria 2699
43 Ga0070677_10029917 3300005333 Bacteria 2069
44 Ga0068869_100126428 3300005334 Bacteria 1961
45 Ga0068869_100621262 3300005334 Bacteria 915
46 Ga0068869_100918619 3300005334 Bacteria 758
47 Ga0070660_100018535 3300005339 Bacteria 5087
48 Ga0070660_100138639 3300005339 Bacteria 1950
49 Ga0070660_100550925 3300005339 Bacteria 962
50 Ga0070675_100052440 3300005354 Bacteria 3354
51 Ga0070675_101290187 3300005354 Bacteria 673
52 Ga0070675_101356500 3300005354 Bacteria 655
53 Ga0070671_100005987 3300005355 Bacteria 9690
54 Ga0070674_100175406 3300005356 Bacteria 1637
55 Ga0070688_100414238 3300005365 Bacteria 1000
56 Ga0070659_100311208 3300005366 Bacteria 1315
57 Ga0070659_101104825 3300005366 Bacteria 699
58 Ga0070667_101011891 3300005367 Bacteria 775
59 Ga0070708_100136582 3300005445 Bacteria 2272
60 Ga0070678_100081929 3300005456 Bacteria 2448
61 Ga0070678_100252417 3300005456 Bacteria 1479
62 Ga0070662_100116649 3300005457 Bacteria 2041
63 Ga0070662_100228057 3300005457 Bacteria 1489
64 Ga0068867_100003980 3300005459 Bacteria 10393
65 Ga0070706_100001360 3300005467 Bacteria 25993
66 Ga0070707_100026346 3300005468 Bacteria 5520
67 Ga0070698_100735145 3300005471 Bacteria 929
68 Ga0070679_100032501 3300005530 Bacteria 5162
69 Ga0068853_100051532 3300005539 Bacteria 3542
70 Ga0068853_100177477 3300005539 Bacteria 1930
71 Ga0070672_100089700 3300005543 Bacteria 2477
72 Ga0070665_100178385 3300005548 Bacteria 2125
73 Ga0070665_100253303 3300005548 Bacteria 1761
74 Ga0068855_100143829 3300005563 Bacteria 2716
75 Ga0068855_100211523 3300005563 Bacteria 2179
76 Ga0068857_100064931 3300005577 Bacteria 3245
77 Ga0068857_101365537 3300005577 Bacteria 689
78 Ga0068852_100026931 3300005616 Bacteria 4680
79 Ga0068859_100151336 3300005617 Bacteria 2396
80 Ga0068859_100477168 3300005617 Bacteria 1343
81 Ga0068859_100891965 3300005617 Bacteria 974
82 Ga0068864_100045701 3300005618 Bacteria 3756
83 Ga0068866_10925132 3300005718 Bacteria 615
84 Ga0068870_10046046 3300005840 Bacteria 2286
85 Ga0068863_100032370 3300005841 Bacteria 4984
86 Ga0068863_101183712 3300005841 Bacteria 770
87 Ga0068860_101294542 3300005843 Bacteria 750
88 Ga0068862_102651930 3300005844 Bacteria 513
89 Ga0075365_10122998 3300006038 Bacteria 1791
90 Ga0075365_10443517 3300006038 Bacteria 917
91 Ga0075365_10539421 3300006038 Bacteria 825
92 Ga0075368_10024418 3300006042 Bacteria 2316
93 Ga0075368_10050310 3300006042 Bacteria 1655
94 Ga0075363_100039003 3300006048 Bacteria 2499
95 Ga0075363_100039336 3300006048 Bacteria 2489
96 Ga0075363_100065425 3300006048 Bacteria 1966
97 Ga0075363_100080366 3300006048 Bacteria 1783
98 Ga0075364_10036191 3300006051 Bacteria 3191
99 Ga0075362_10002742 3300006177 Bacteria 6002
100 Ga0075362_10008420 3300006177 Bacteria 3942
101 Ga0075362_10091260 3300006177 Bacteria 1414
102 Ga0075362_10257762 3300006177 Bacteria 859
103 Ga0075362_10385898 3300006177 Bacteria 705
104 Ga0075367_10030320 3300006178 Bacteria 3100
105 Ga0075367_10246968 3300006178 Bacteria 1119
106 Ga0075367_10348576 3300006178 Bacteria 934
107 Ga0075367_10378481 3300006178 Bacteria 894
108 Ga0075367_10626653 3300006178 Bacteria 684
109 Ga0075369_10025400 3300006186 Bacteria 2463
110 Ga0075366_10002134 3300006195 Bacteria 10056
111 Ga0075366_10014460 3300006195 Bacteria 4508
112 Ga0075366_10054094 3300006195 Bacteria 2384
113 Ga0075366_10216685 3300006195 Bacteria 1166
114 Ga0075366_10347115 3300006195 Bacteria 911
115 Ga0075366_10787175 3300006195 Bacteria 591
116 Ga0097621_100355824 3300006237 Bacteria 1303
117 Ga0097621_100713975 3300006237 Bacteria 924
118 Ga0075370_10002071 3300006353 Bacteria 9132
119 Ga0075370_10033696 3300006353 Bacteria 2868
120 Ga0075370_10087589 3300006353 Bacteria 1794
121 Ga0075370_10088879 3300006353 Bacteria 1781
122 Ga0075370_10195532 3300006353 Bacteria 1193
123 Ga0075370_10410574 3300006353 Bacteria 813
124 Ga0075430_100135513 3300006846 Bacteria 2052
125 Ga0068865_100126747 3300006881 Bacteria 1907
126 Ga0068865_101480328 3300006881 Bacteria 608
127 Ga0097620_100151343 3300006931 Bacteria 2396
128 Ga0097620_100477191 3300006931 Bacteria 1343
129 Ga0097620_100892237 3300006931 Bacteria 974
130 Ga0079104_1016249 3300006946 Bacteria 2182
131 Ga0105240_10001089 3300009093 Bacteria 47935
132 Ga0105245_10022835 3300009098 Bacteria 5489
133 Ga0105245_10218041 3300009098 Bacteria 1840
134 Ga0105245_11547564 3300009098 Bacteria 714
135 Ga0105243_10025185 3300009148 Bacteria 4544
136 Ga0105243_10295782 3300009148 Bacteria 1465
137 Ga0105243_10685493 3300009148 Bacteria 997
138 Ga0105243_12021905 3300009148 Bacteria 611
139 Ga0105241_10097627 3300009174 Bacteria 2330
140 Ga0105242_10006633 3300009176 Bacteria 8927
141 Ga0105242_11292997 3300009176 Bacteria 753
142 Ga0105237_10052299 3300009545 Bacteria 4101
143 Ga0105238_10052600 3300009551 Bacteria 4094
144 Ga0105238_11056861 3300009551 Bacteria 834
145 Ga0105249_12196901 3300009553 Bacteria 625
146 Ga0105239_10021489 3300010375 Bacteria 7115
147 Ga0105246_10030595 3300011119 Bacteria 3557
148 Ga0163162_10281552 3300013306 Bacteria 1795
149 Ga0163162_10402132 3300013306 Bacteria 1502
150 Ga0157375_10041640 3300013308 Bacteria 4437
151 Ga0157375_10551604 3300013308 Bacteria 1314
152 Ga0157380_10661754 3300014326 Bacteria 1043
153 Ga0157377_10371993 3300014745 Bacteria 965
154 Ga0209435_100001 3300025206 Bacteria 1424171
155 Ga0207425_1008756 3300025245 Bacteria 2563
156 Ga0209646_1000001 3300025246 Bacteria 3092932
157 Ga0209026_1000003 3300025250 Bacteria 1060571
158 Ga0209759_1000001 3300025256 Bacteria 2799452
159 Ga0209565_1000004 3300025263 Bacteria 983150
160 Ga0209565_1001286 3300025263 Bacteria 11626
161 Ga0209673_1000357 3300025273 Bacteria 82249
162 Ga0209673_1050378 3300025273 Bacteria 1106
163 Ga0209130_1000082 3300025284 Bacteria 164441
164 Ga0209130_1000094 3300025284 Bacteria 145569
165 Ga0209675_1000061 3300025291 Bacteria 181096
166 Ga0209675_1006569 3300025291 Bacteria 4633
167 Ga0209676_1000029 3300025292 Bacteria 520536
168 Ga0209676_1003883 3300025292 Bacteria 8718
169 Ga0209025_1006826 3300025294 Bacteria 8715
170 Ga0209025_1007422 3300025294 Bacteria 8182
171 Ga0209025_1033881 3300025294 Bacteria 2348
172 Ga0209025_1058171 3300025294 Bacteria 1471
173 Ga0209564_1000969 3300025295 Bacteria 36292
174 Ga0209564_1002810 3300025295 Bacteria 12935
175 Ga0209564_1010108 3300025295 Bacteria 4392
176 Ga0209758_1003972 3300025297 Bacteria 12820
177 Ga0209050_1000003 3300025298 Bacteria 1609245
178 Ga0209050_1005923 3300025298 Bacteria 7452
179 Ga0209050_1015438 3300025298 Bacteria 3208
180 Ga0209256_1000001 3300025299 Bacteria 2166974
181 Ga0207426_1000025 3300025302 Bacteria 532921
182 Ga0207426_1033316 3300025302 Bacteria 1662
183 Ga0209051_1000003 3300025303 Bacteria 1609245
184 Ga0209051_1000078 3300025303 Bacteria 201965
185 Ga0209051_1107143 3300025303 Bacteria 737
186 Ga0209257_1000012 3300025304 Bacteria 1111138
187 Ga0209257_1000018 3300025304 Bacteria 836016
188 Ga0209257_1014547 3300025304 Bacteria 3372
189 Ga0207682_10217373 3300025893 Bacteria 883
190 Ga0207645_10002443 3300025907 Bacteria 14624
191 Ga0207645_10271683 3300025907 Bacteria 1124
192 Ga0207643_10091900 3300025908 Bacteria 1770
193 Ga0207705_10220744 3300025909 Bacteria 1440
194 Ga0207705_10626424 3300025909 Bacteria 836
195 Ga0207684_10029430 3300025910 Bacteria 4677
196 Ga0207654_10170131 3300025911 Bacteria 1414
197 Ga0207695_10038007 3300025913 Bacteria 5189
198 Ga0207695_10049144 3300025913 Bacteria 4449
199 Ga0207671_10028247 3300025914 Bacteria 4192
200 Ga0207657_10054433 3300025919 Bacteria 3460
201 Ga0207657_10139848 3300025919 Bacteria 1979
202 Ga0207657_10538331 3300025919 Bacteria 913
203 Ga0207652_10073160 3300025921 Bacteria 2981
204 Ga0207694_10127612 3300025924 Bacteria 2036
205 Ga0207650_10065460 3300025925 Bacteria 2724
206 Ga0207650_10164783 3300025925 Bacteria 1758
207 Ga0207659_10030899 3300025926 Bacteria 3663
208 Ga0207659_10256582 3300025926 Bacteria 1421
209 Ga0207687_10229185 3300025927 Bacteria 1467
210 Ga0207687_10350600 3300025927 Bacteria 1202
211 Ga0207644_10034779 3300025931 Bacteria 3527
212 Ga0207690_10172889 3300025932 Bacteria 1620
213 Ga0207690_10554196 3300025932 Bacteria 935
214 Ga0207706_10036208 3300025933 Bacteria 4384
215 Ga0207706_10420501 3300025933 Bacteria 1158
216 Ga0207686_10009207 3300025934 Bacteria 5356
217 Ga0207709_10344530 3300025935 Bacteria 1123
218 Ga0207709_10353165 3300025935 Bacteria 1110
219 Ga0207669_10719812 3300025937 Bacteria 822
220 Ga0207669_11068475 3300025937 Bacteria 680
221 Ga0207704_10065298 3300025938 Bacteria 2278
222 Ga0207691_10019248 3300025940 Bacteria 6463
223 Ga0207689_10051305 3300025942 Bacteria 3401
224 Ga0207689_10346437 3300025942 Bacteria 1235
225 Ga0207667_10114656 3300025949 Bacteria 2778
226 Ga0207667_10281311 3300025949 Bacteria 1700
227 Ga0207668_10899026 3300025972 Bacteria 788
228 Ga0207677_10702109 3300026023 Bacteria 898
229 Ga0207639_10066789 3300026041 Bacteria 2797
230 Ga0207639_10070432 3300026041 Bacteria 2731
231 Ga0207639_10713879 3300026041 Bacteria 931
232 Ga0207648_10005998 3300026089 Bacteria 12142
233 Ga0207648_10139452 3300026089 Bacteria 2137
234 Ga0207676_10074356 3300026095 Bacteria 2737
235 Ga0207674_10011244 3300026116 Bacteria 10060
236 Ga0207674_10097996 3300026116 Bacteria 2915
237 Ga0207675_100745939 3300026118 Bacteria 990
238 Ga0207683_10079277 3300026121 Bacteria 2911
239 Ga0209813_10007691 3300027866 Bacteria 2693
240 Ga0209813_10048137 3300027866 Bacteria 1322
241 Ga0209813_10075203 3300027866 Bacteria 1106
242 Ga0207428_10177411 3300027907 Bacteria 1611
243 Ga0268266_10032323 3300028379 Bacteria 4446
244 Ga0268266_10864171 3300028379 Bacteria 874
245 Ga0268265_10471422 3300028380 Bacteria 1177
246 Ga0268264_10376828 3300028381 Bacteria 1358
247 Ga0268264_11984408 3300028381 Bacteria 591
248 Ga0307517_10105031 3300028786 Bacteria 2195
249 Ga0307517_10125962 3300028786 Bacteria 1869
250 Ga0307517_10160721 3300028786 Bacteria 1509
251 Ga0307515_10002977 3300028794 Bacteria 35954
252 Ga0307515_10103741 3300028794 Bacteria 3405
253 Ga0307515_10121837 3300028794 Bacteria 2947
254 Ga0307515_10249927 3300028794 Bacteria 1528
255 Ga0307515_10350102 3300028794 Bacteria 1124
256 Ga0307515_10720200 3300028794 Unclassified 615
257 Ga0265330_10084490 3300031235 Bacteria 1366
258 Ga0265332_10054502 3300031238 Bacteria 1715
259 Ga0307513_10000019 3300031456 Bacteria 231194
260 Ga0307513_10010735 3300031456 Bacteria 11451
261 Ga0307513_10422266 3300031456 Bacteria 1063
262 Ga0307509_10003890 3300031507 Bacteria 22097
263 Ga0307509_10271141 3300031507 Bacteria 1464
264 Ga0307408_100000407 3300031548 Bacteria 38725
265 Ga0307408_100005073 3300031548 Bacteria 8837
266 Ga0307408_100058277 3300031548 Bacteria 2807
267 Ga0307408_100311888 3300031548 Bacteria 1322
268 Ga0307408_100380430 3300031548 Bacteria 1207
269 Ga0307408_101098163 3300031548 Bacteria 738
270 Ga0307408_102259560 3300031548 Bacteria 526
271 Ga0307508_10009033 3300031616 Bacteria 9182
272 Ga0307508_10011731 3300031616 Bacteria 8008
273 Ga0307508_10266442 3300031616 Bacteria 1307
274 Ga0307508_10460082 3300031616 Bacteria 865
275 Ga0307514_10003221 3300031649 Bacteria 15940
276 Ga0307514_10483651 3300031649 Bacteria 595
277 Ga0265314_10003396 3300031711 Bacteria 15427
278 Ga0307516_10008844 3300031730 Bacteria 11310
279 Ga0307516_10108290 3300031730 Bacteria 2586
280 Ga0307516_10193844 3300031730 Bacteria 1756
281 Ga0307410_10524908 3300031852 Bacteria 978
282 Ga0307406_10039594 3300031901 Bacteria 2926
283 Ga0307406_10072159 3300031901 Bacteria 2265
284 Ga0307406_12079202 3300031901 Bacteria 509
285 Ga0307416_100425576 3300032002 Bacteria 1373
286 Ga0307416_102092897 3300032002 Bacteria 668
287 Ga0307411_11539708 3300032005 Bacteria 612
288 Ga0307510_10001792 3300033180 Bacteria 23968
289 Ga0307510_10257348 3300033180 Bacteria 1229
290 Ga0307510_10294015 3300033180 Bacteria 1089
291 Ga0373932_0005175 3300035112 Bacteria 3067
292 Ga0373939_0275934 3300035114 Bacteria 662
293 Ga0373960_0328839 3300035121 Bacteria 575
294 Ga0373931_0020008 3300035691 Bacteria 3346
295 Ga0373931_0087776 3300035691 Bacteria 1728
296 Ga0373947_0316436 3300035725 Bacteria 1043
297 Ga0373925_0159514 3300037068 Bacteria 1776
298 Ga0395899_0002622 3300037312 Bacteria 14501
299 Ga0395899_0029980 3300037312 Bacteria 4094
300 Ga0395899_0647276 3300037312 Bacteria 668
301 Ga0395900_0078158 3300037418 Bacteria 3400
302 Ga0395900_0185104 3300037418 Bacteria 2114
303 Ga0395900_0398849 3300037418 Bacteria 1340
304 Ga0395900_0404209 3300037418 Bacteria 1329
305 Ga0395900_0966929 3300037418 Bacteria 772
306 Ga0395898_0037857 3300037466 Bacteria 4782
307 Ga0395905_0000148 3300037471 Bacteria 116301
308 Ga0395905_0000443 3300037471 Bacteria 58027
309 Ga0395905_0027898 3300037471 Bacteria 5323
310 Ga0395905_0065049 3300037471 Bacteria 3413
311 Ga0395905_0123694 3300037471 Bacteria 2432
312 Ga0395905_0131818 3300037471 Bacteria 2350
313 Ga0395905_0544960 3300037471 Bacteria 1061
314 Ga0395905_0571366 3300037471 Bacteria 1032
315 Ga0395905_0604300 3300037471 Bacteria 999
316 Ga0395901_0086684 3300038443 Bacteria 3274
317 Ga0395901_0139747 3300038443 Bacteria 2545
318 Ga0395901_0220882 3300038443 Bacteria 1981
319 Ga0395901_0305687 3300038443 Bacteria 1648
320 Ga0395901_0329215 3300038443 Bacteria 1579
321 Ga0395901_0958472 3300038443 Bacteria 834
322 Ga0439439_0057378 3300041406 Bacteria 1029
323 Ga0439453_0014878 3300041408 Bacteria 1340
324 Ga0451797_0866692 3300041453 Bacteria 703
325 Ga0451800_0609522 3300041459 Bacteria 545
326 Ga0451849_0298659 3300041505 Bacteria 808
327 Ga0451853_0206703 3300041512 Bacteria 1313
328 Ga0451853_1434675 3300041512 Bacteria 777
329 Ga0439431_0054761 3300041997 Bacteria 1041
330 Ga0439433_0012841 3300041999 Bacteria 1838
331 Ga0439437_016454 3300042000 Bacteria 873
332 Ga0439441_053851 3300042001 Bacteria 834
333 Ga0439442_125685 3300042002 Bacteria 563
334 Ga0439449_0001507 3300042007 Bacteria 9126
335 Ga0439452_090254 3300042010 Bacteria 662
336 Ga0439462_0019094 3300042015 Bacteria 1782
337 Ga0439462_0047212 3300042015 Bacteria 1154
338 Ga0450923_018629 3300042125 Bacteria 1330
339 Ga0450895_006737 3300042132 Bacteria 945
340 Ga0450903_026535 3300042138 Bacteria 883
341 Ga0439446_0059109 3300042156 Bacteria 1157
342 Ga0450909_038410 3300042185 Bacteria 734
343 Ga0439435_0272273 3300042436 Bacteria 575
344 Ga0439464_0007722 3300042439 Bacteria 2815
345 Ga0451577_0010101 3300042876 Bacteria 9044
346 Ga0451577_0104069 3300042876 Bacteria 2537
347 Ga0451577_0956491 3300042876 Bacteria 770
348 Ga0466969_0016312 3300044656 Bacteria 3890
349 Ga0466969_0080128 3300044656 Bacteria 1560
350 Ga0453683_0009651 3300044673 Bacteria 6436
351 Ga0453683_0011859 3300044673 Bacteria 5735
352 Ga0466966_0016959 3300044684 Bacteria 4813
353 Ga0466966_0461986 3300044684 Bacteria 763
354 Ga0466966_0480511 3300044684 Bacteria 747
355 Ga0466961_0026070 3300044693 Bacteria 3758
356 Ga0466961_0460775 3300044693 Bacteria 769
357 Ga0453684_1276089 3300044712 Bacteria 767
358 Ga0466970_0093791 3300044765 Bacteria 1631
359 Ga0466957_0254304 3300044842 Bacteria 1169
360 Ga0466959_0047085 3300045049 Bacteria 3172
361 Ga0451576_0045100 3300045051 Bacteria 4644
362 Ga0451576_0053188 3300045051 Bacteria 4242
363 Ga0451576_0087179 3300045051 Bacteria 3247
364 Ga0451576_0176080 3300045051 Bacteria 2233
365 Ga0451576_0534061 3300045051 Bacteria 1232
366 Ga0466967_0196006 3300045976 Bacteria 1911
367 Ga0466967_1179821 3300045976 Bacteria 763
368 Ga0495617_161958 3300046452 Bacteria 709
369 Ga0495638_0206153 3300046460 Bacteria 1107
370 Ga0495650_0171811 3300046471 Bacteria 767
371 Ga0495605_0087836 3300046474 Bacteria 1445
372 Ga0495606_0332296 3300046507 Bacteria 813
373 Ga0495620_0273502 3300046515 Bacteria 643
374 Ga0495630_0038959 3300046517 Bacteria 3555
375 Ga0495632_0023318 3300046519 Bacteria 3306
376 Ga0495642_0010858 3300046528 Bacteria 3491
377 Ga0495609_0063873 3300046538 Bacteria 1625
378 Ga0495597_0023755 3300046542 Bacteria 2834
379 Ga0495597_0187540 3300046542 Bacteria 833
380 Ga0495656_0008104 3300046615 Bacteria 3740
381 Ga0495656_0015334 3300046615 Bacteria 2891
382 Ga0495668_0113849 3300046616 Bacteria 1479
383 Ga0495668_0183512 3300046616 Bacteria 1146
384 Ga0495668_0397374 3300046616 Bacteria 757
385 Ga0495625_0071156 3300046660 Bacteria 2441
386 Ga0495635_0411126 3300046663 Bacteria 898
387 Ga0495659_0510645 3300046664 Unclassified 527
388 Ga0495658_0169795 3300046683 Bacteria 1349
389 Ga0495669_0217959 3300046684 Bacteria 914
390 Ga0495613_0430251 3300046689 Bacteria 897
391 Ga0495624_0156216 3300046690 Bacteria 1394
392 Ga0495671_0067453 3300046692 Bacteria 1760
393 Ga0495649_0003708 3300046694 Bacteria 10162
394 Ga0495660_0047442 3300046810 Bacteria 2352
395 Ga0495636_0176768 3300047318 Bacteria 967
396 Ga0495636_0441368 3300047318 Bacteria 624
397 Ga0495676_0062662 3300047321 Bacteria 2902
398 Ga0495687_010796 3300047443 Bacteria 4971
399 Ga0495687_017419 3300047443 Bacteria 3585
400 Ga0495615_0011836 3300048090 Bacteria 1784
401 Ga0495626_0051749 3300048091 Bacteria 1894
402 Ga0495626_0097039 3300048091 Bacteria 1289
403 Ga0496110_0820351 3300048913 Bacteria 835
404 Ga0496113_1126587 3300048916 Bacteria 615
405 Ga0496114_0802325 3300048917 Bacteria 820
406 Ga0496126_0539642 3300048929 Bacteria 927
407 Ga0495682_0196024 3300049460 Bacteria 717
408 Ga0501032_0037733 3300049569 Bacteria 3294
409 Ga0501032_0299521 3300049569 Bacteria 1040
410 Ga0501034_0145532 3300049571 Bacteria 2347
411 Ga0501037_0275722 3300049573 Bacteria 1173
412 Ga0501037_0334732 3300049573 Bacteria 1046
413 Ga0501037_0421131 3300049573 Bacteria 914
414 Ga0501038_0462437 3300049574 Bacteria 974
415 Ga0501043_0121898 3300049579 Bacteria 2045
416 Ga0501043_0498571 3300049579 Bacteria 910
417 Ga0501046_0044943 3300049580 Bacteria 3511
418 Ga0501047_0206307 3300049581 Bacteria 1824
419 Ga0501047_0238280 3300049581 Bacteria 1671
420 Ga0501048_0292393 3300049582 Bacteria 1159
421 Ga0501080_0079221 3300049742 Bacteria 3054
422 Ga0501263_003341 3300049760 Bacteria 1707
423 Ga0501266_001326 3300049763 Bacteria 3156
424 Ga0501044_0040510 3300049823 Bacteria 4855
425 Ga0501044_0393482 3300049823 Bacteria 1299
426 nmdc:mga03683_149108_c1 3300050489 Bacteria 1055
427 nmdc:mga03683_508449_c1 3300050489 Bacteria 584
428 nmdc:mga03683_51377_c1 3300050489 Bacteria 1720
429 nmdc:mga03n38_51798_c1 3300050490 Bacteria 1834
430 nmdc:mga03n38_693512_c1 3300050490 Bacteria 586
431 nmdc:mga03n38_714730_c1 3300050490 Bacteria 578
432 nmdc:mga00v17_225202_c1 3300050491 Bacteria 1214
433 nmdc:mga00v17_340549_c1 3300050491 Bacteria 975
434 nmdc:mga0k408_235734_c1 3300050493 Bacteria 1093
435 nmdc:mga0k408_238215_c1 3300050493 Bacteria 704
436 nmdc:mga0k408_452078_c1 3300050493 Bacteria 763
437 nmdc:mga0k408_473163_c1 3300050493 Bacteria 743
438 nmdc:mga0k408_504_c1 3300050493 Bacteria 21443
439 nmdc:mga0k408_7882_c1 3300050493 Bacteria 5702
440 nmdc:mga0k408_8130_c1 3300050493 Bacteria 5622
441 nmdc:mga0k408_9301_c1 3300050493 Bacteria 5296
442 nmdc:mga06z11_106701_c1 3300050494 Bacteria 1545
443 nmdc:mga06z11_146399_c1 3300050494 Bacteria 1339
444 nmdc:mga06z11_258125_c1 3300050494 Bacteria 1028
445 nmdc:mga06z11_587941_c1 3300050494 Bacteria 677
446 nmdc:mga04h51_113124_c1 3300050495 Bacteria 1003
447 nmdc:mga04h51_26458_c1 3300050495 Bacteria 1794
448 nmdc:mga04h51_63046_c1 3300050495 Bacteria 1275
449 nmdc:mga07m45_10888_c1 3300050496 Bacteria 4762
450 nmdc:mga07m45_150_c1 3300050496 Bacteria 27900
451 nmdc:mga07m45_2017_c1 3300050496 Bacteria 9417
452 nmdc:mga07m45_24397_c1 3300050496 Bacteria 3312
453 nmdc:mga07m45_344078_c1 3300050496 Bacteria 866
454 nmdc:mga07m45_399176_c1 3300050496 Bacteria 798
455 nmdc:mga07m45_804644_c1 3300050496 Bacteria 539
456 nmdc:mga07m45_8835_c1 3300050496 Bacteria 5198
457 nmdc:mga0qj67_109111_c1 3300050509 Bacteria 1673
458 nmdc:mga0sz30_354721_c1 3300050516 Bacteria 656
459 nmdc:mga0sz30_9248_c2 3300050516 Bacteria 1285
460 Ga0495655_0233632 3300053083 Bacteria 613
461 Ga0495619_1025056 3300053085 Bacteria 551
462 Ga0500644_0016039 3300053088 Bacteria 2150
463 Ga0500651_0235474 3300053093 Bacteria 1069
464 Ga0500660_237644 3300053100 Bacteria 577
465 Ga0500562_044638 3300053108 Bacteria 1180
466 Ga0500593_016489 3300053117 Bacteria 3202
467 Ga0500658_0003736 3300053134 Bacteria 5733
468 Ga0500559_0000948 3300053136 Bacteria 18266
469 Ga0500559_0524381 3300053136 Bacteria 542
470 Ga0500568_0019208 3300053139 Bacteria 2975
471 Ga0500586_205174 3300053145 Bacteria 644
472 Ga0500616_0168909 3300053153 Bacteria 995
473 Ga0500620_214222 3300053155 Bacteria 653
474 Ga0500627_0199747 3300053158 Bacteria 896
475 Ga0500645_001435 3300053730 Bacteria 12097
476 Ga0500645_002264 3300053730 Bacteria 8744
477 Ga0500645_079960 3300053730 Bacteria 933
478 Ga0500661_001087 3300055283 Bacteria 5115
479 2511247026 2511231002 Bacteria 5042903
480 2643866698 2643221570 Bacteria 5103772
481 2643993431 2643221596 Bacteria 5006805
482 2644294569 2643221652 Bacteria 5140275
483 2644305109 2643221654 Bacteria 5273570
484 2881101925 2881101125 Bacteria 4590519
485 2974323103 2974320154 Bacteria 4571377
486 2990712667 2990710928 Bacteria 5002431
487 Ga0307513_10000051
488 JGI25155J39150_1000002
489 JGI25156J39149_1000003
490 JGI25154J39366_1000009
491 JGI25157J39369_1000002
492 JGI25159J45721_1000302
493 JGI25159J45721_1000502
494 JGI25151J46595_10017838
495 JGI25151J46595_10025203
496 JGI25151J46595_10044421
497 rootH1_10025590
498 JGI25160J50197_1000145
499 JGI25161J50226_1000032
500 JGI25161J50226_1000064
501 Ga0055526_1003563
502 Ga0055526_1009997
503 Ga0055537_1000043
504 Ga0055537_1008563
505 Ga0055524_1000012
506 Ga0055536_1004794
507 Ga0055534_1005165
508 Ga0055528_1000717
509 Ga0055530_10000015
510 Ga0055530_10035307
511 Ga0055530_10089805
512 Ga0055540_1000012
513 Ga0055540_1000039
514 Ga0055540_1013853
515 Ga0055531_10001591
516 Ga0055531_10006340
517 Ga0055531_10114267
518 Ga0055543_1000752
519 Ga0065165_1007478
520 Ga0065165_1016049
521 Ga0065165_1016671
522 Ga0065165_1065678
523 Ga0065704_10162087
524 Ga0070658_10449559
525 Ga0070658_10690412
526 Ga0070676_10006620
527 Ga0070676_10539101
528 Ga0070670_100086168
529 Ga0070677_10029917
530 Ga0068869_100126428
531 Ga0068869_100621262
532 Ga0068869_100918619
533 Ga0070660_100018535
534 Ga0070660_100138639
535 Ga0070660_100550925
536 Ga0070675_100052440
537 Ga0070675_101290187
538 Ga0070675_101356500
539 Ga0070671_100005987
540 Ga0070674_100175406
541 Ga0070688_100414238
542 Ga0070659_100311208
543 Ga0070659_101104825
544 Ga0070667_101011891
545 Ga0070708_100136582
546 Ga0070678_100081929
547 Ga0070678_100252417
548 Ga0070662_100116649
549 Ga0070662_100228057
550 Ga0068867_100003980
551 Ga0070706_100001360
552 Ga0070707_100026346
553 Ga0070698_100735145
554 Ga0070679_100032501
555 Ga0068853_100051532
556 Ga0068853_100177477
557 Ga0070672_100089700
558 Ga0070665_100178385
559 Ga0070665_100253303
560 Ga0068855_100143829
561 Ga0068855_100211523
562 Ga0068857_100064931
563 Ga0068857_101365537
564 Ga0068852_100026931
565 Ga0068859_100151336
566 Ga0068859_100477168
567 Ga0068859_100891965
568 Ga0068864_100045701
569 Ga0068866_10925132
570 Ga0068870_10046046
571 Ga0068863_100032370
572 Ga0068863_101183712
573 Ga0068860_101294542
574 Ga0068862_102651930
575 Ga0075365_10122998
576 Ga0075365_10443517
577 Ga0075365_10539421
578 Ga0075368_10024418
579 Ga0075368_10050310
580 Ga0075363_100039003
581 Ga0075363_100039336
582 Ga0075363_100065425
583 Ga0075363_100080366
584 Ga0075364_10036191
585 Ga0075362_10002742
586 Ga0075362_10008420
587 Ga0075362_10091260
588 Ga0075362_10257762
589 Ga0075362_10385898
590 Ga0075367_10030320
591 Ga0075367_10246968
592 Ga0075367_10348576
593 Ga0075367_10378481
594 Ga0075367_10626653
595 Ga0075369_10025400
596 Ga0075366_10002134
597 Ga0075366_10014460
598 Ga0075366_10054094
599 Ga0075366_10216685
600 Ga0075366_10347115
601 Ga0075366_10787175
602 Ga0097621_100355824
603 Ga0097621_100713975
604 Ga0075370_10002071
605 Ga0075370_10033696
606 Ga0075370_10087589
607 Ga0075370_10088879
608 Ga0075370_10195532
609 Ga0075370_10410574
610 Ga0075430_100135513
611 Ga0068865_100126747
612 Ga0068865_101480328
613 Ga0097620_100151343
614 Ga0097620_100477191
615 Ga0097620_100892237
616 Ga0079104_1016249
617 Ga0105240_10001089
618 Ga0105245_10022835
619 Ga0105245_10218041
620 Ga0105245_11547564
621 Ga0105243_10025185
622 Ga0105243_10295782
623 Ga0105243_10685493
624 Ga0105243_12021905
625 Ga0105241_10097627
626 Ga0105242_10006633
627 Ga0105242_11292997
628 Ga0105237_10052299
629 Ga0105238_10052600
630 Ga0105238_11056861
631 Ga0105249_12196901
632 Ga0105239_10021489
633 Ga0105246_10030595
634 Ga0163162_10281552
635 Ga0163162_10402132
636 Ga0157375_10041640
637 Ga0157375_10551604
638 Ga0157380_10661754
639 Ga0157377_10371993
640 Ga0209435_100001
641 Ga0207425_1008756
642 Ga0209646_1000001
643 Ga0209026_1000003
644 Ga0209759_1000001
645 Ga0209565_1000004
646 Ga0209565_1001286
647 Ga0209673_1000357
648 Ga0209673_1050378
649 Ga0209130_1000082
650 Ga0209130_1000094
651 Ga0209675_1000061
652 Ga0209675_1006569
653 Ga0209676_1000029
654 Ga0209676_1003883
655 Ga0209025_1006826
656 Ga0209025_1007422
657 Ga0209025_1033881
658 Ga0209025_1058171
659 Ga0209564_1000969
660 Ga0209564_1002810
661 Ga0209564_1010108
662 Ga0209758_1003972
663 Ga0209050_1000003
664 Ga0209050_1005923
665 Ga0209050_1015438
666 Ga0209256_1000001
667 Ga0207426_1000025
668 Ga0207426_1033316
669 Ga0209051_1000003
670 Ga0209051_1000078
671 Ga0209051_1107143
672 Ga0209257_1000012
673 Ga0209257_1000018
674 Ga0209257_1014547
675 Ga0207682_10217373
676 Ga0207645_10002443
677 Ga0207645_10271683
678 Ga0207643_10091900
679 Ga0207705_10220744
680 Ga0207705_10626424
681 Ga0207684_10029430
682 Ga0207654_10170131
683 Ga0207695_10038007
684 Ga0207695_10049144
685 Ga0207671_10028247
686 Ga0207657_10054433
687 Ga0207657_10139848
688 Ga0207657_10538331
689 Ga0207652_10073160
690 Ga0207694_10127612
691 Ga0207650_10065460
692 Ga0207650_10164783
693 Ga0207659_10030899
694 Ga0207659_10256582
695 Ga0207687_10229185
696 Ga0207687_10350600
697 Ga0207644_10034779
698 Ga0207690_10172889
699 Ga0207690_10554196
700 Ga0207706_10036208
701 Ga0207706_10420501
702 Ga0207686_10009207
703 Ga0207709_10344530
704 Ga0207709_10353165
705 Ga0207669_10719812
706 Ga0207669_11068475
707 Ga0207704_10065298
708 Ga0207691_10019248
709 Ga0207689_10051305
710 Ga0207689_10346437
711 Ga0207667_10114656
712 Ga0207667_10281311
713 Ga0207668_10899026
714 Ga0207677_10702109
715 Ga0207639_10066789
716 Ga0207639_10070432
717 Ga0207639_10713879
718 Ga0207648_10005998
719 Ga0207648_10139452
720 Ga0207676_10074356
721 Ga0207674_10011244
722 Ga0207674_10097996
723 Ga0207675_100745939
724 Ga0207683_10079277
725 Ga0209813_10007691
726 Ga0209813_10048137
727 Ga0209813_10075203
728 Ga0207428_10177411
729 Ga0268266_10032323
730 Ga0268266_10864171
731 Ga0268265_10471422
732 Ga0268264_10376828
733 Ga0268264_11984408
734 Ga0307517_10105031
735 Ga0307517_10125962
736 Ga0307517_10160721
737 Ga0307515_10002977
738 Ga0307515_10103741
739 Ga0307515_10121837
740 Ga0307515_10249927
741 Ga0307515_10350102
742 Ga0307515_10720200
743 Ga0265330_10084490
744 Ga0265332_10054502
745 Ga0307513_10000019
746 Ga0307513_10010735
747 Ga0307513_10422266
748 Ga0307509_10003890
749 Ga0307509_10271141
750 Ga0307408_100000407
751 Ga0307408_100005073
752 Ga0307408_100058277
753 Ga0307408_100311888
754 Ga0307408_100380430
755 Ga0307408_101098163
756 Ga0307408_102259560
757 Ga0307508_10009033
758 Ga0307508_10011731
759 Ga0307508_10266442
760 Ga0307508_10460082
761 Ga0307514_10003221
762 Ga0307514_10483651
763 Ga0265314_10003396
764 Ga0307516_10008844
765 Ga0307516_10108290
766 Ga0307516_10193844
767 Ga0307410_10524908
768 Ga0307406_10039594
769 Ga0307406_10072159
770 Ga0307406_12079202
771 Ga0307416_100425576
772 Ga0307416_102092897
773 Ga0307411_11539708
774 Ga0307510_10001792
775 Ga0307510_10257348
776 Ga0307510_10294015
777 Ga0373932_0005175
778 Ga0373939_0275934
779 Ga0373960_0328839
780 Ga0373931_0020008
781 Ga0373931_0087776
782 Ga0373947_0316436
783 Ga0373925_0159514
784 Ga0395899_0002622
785 Ga0395899_0029980
786 Ga0395899_0647276
787 Ga0395900_0078158
788 Ga0395900_0185104
789 Ga0395900_0398849
790 Ga0395900_0404209
791 Ga0395900_0966929
792 Ga0395898_0037857
793 Ga0395905_0000148
794 Ga0395905_0000443
795 Ga0395905_0027898
796 Ga0395905_0065049
797 Ga0395905_0123694
798 Ga0395905_0131818
799 Ga0395905_0544960
800 Ga0395905_0571366
801 Ga0395905_0604300
802 Ga0395901_0086684
803 Ga0395901_0139747
804 Ga0395901_0220882
805 Ga0395901_0305687
806 Ga0395901_0329215
807 Ga0395901_0958472
808 Ga0439439_0057378
809 Ga0439453_0014878
810 Ga0451797_0866692
811 Ga0451800_0609522
812 Ga0451849_0298659
813 Ga0451853_0206703
814 Ga0451853_1434675
815 Ga0439431_0054761
816 Ga0439433_0012841
817 Ga0439437_016454
818 Ga0439441_053851
819 Ga0439442_125685
820 Ga0439449_0001507
821 Ga0439452_090254
822 Ga0439462_0019094
823 Ga0439462_0047212
824 Ga0450923_018629
825 Ga0450895_006737
826 Ga0450903_026535
827 Ga0439446_0059109
828 Ga0450909_038410
829 Ga0439435_0272273
830 Ga0439464_0007722
831 Ga0451577_0010101
832 Ga0451577_0104069
833 Ga0451577_0956491
834 Ga0466969_0016312
835 Ga0466969_0080128
836 Ga0453683_0009651
837 Ga0453683_0011859
838 Ga0466966_0016959
839 Ga0466966_0461986
840 Ga0466966_0480511
841 Ga0466961_0026070
842 Ga0466961_0460775
843 Ga0453684_1276089
844 Ga0466970_0093791
845 Ga0466957_0254304
846 Ga0466959_0047085
847 Ga0451576_0045100
848 Ga0451576_0053188
849 Ga0451576_0087179
850 Ga0451576_0176080
851 Ga0451576_0534061
852 Ga0466967_0196006
853 Ga0466967_1179821
854 Ga0495617_161958
855 Ga0495638_0206153
856 Ga0495650_0171811
857 Ga0495605_0087836
858 Ga0495606_0332296
859 Ga0495620_0273502
860 Ga0495630_0038959
861 Ga0495632_0023318
862 Ga0495642_0010858
863 Ga0495609_0063873
864 Ga0495597_0023755
865 Ga0495597_0187540
866 Ga0495656_0008104
867 Ga0495656_0015334
868 Ga0495668_0113849
869 Ga0495668_0183512
870 Ga0495668_0397374
871 Ga0495625_0071156
872 Ga0495635_0411126
873 Ga0495659_0510645
874 Ga0495658_0169795
875 Ga0495669_0217959
876 Ga0495613_0430251
877 Ga0495624_0156216
878 Ga0495671_0067453
879 Ga0495649_0003708
880 Ga0495660_0047442
881 Ga0495636_0176768
882 Ga0495636_0441368
883 Ga0495676_0062662
884 Ga0495687_010796
885 Ga0495687_017419
886 Ga0495615_0011836
887 Ga0495626_0051749
888 Ga0495626_0097039
889 Ga0496110_0820351
890 Ga0496113_1126587
891 Ga0496114_0802325
892 Ga0496126_0539642
893 Ga0495682_0196024
894 Ga0501032_0037733
895 Ga0501032_0299521
896 Ga0501034_0145532
897 Ga0501037_0275722
898 Ga0501037_0334732
899 Ga0501037_0421131
900 Ga0501038_0462437
901 Ga0501043_0121898
902 Ga0501043_0498571
903 Ga0501046_0044943
904 Ga0501047_0206307
905 Ga0501047_0238280
906 Ga0501048_0292393
907 Ga0501080_0079221
908 Ga0501263_003341
909 Ga0501266_001326
910 Ga0501044_0040510
911 Ga0501044_0393482
912 nmdc:mga03683_149108_c1
913 nmdc:mga03683_508449_c1
914 nmdc:mga03683_51377_c1
915 nmdc:mga03n38_51798_c1
916 nmdc:mga03n38_693512_c1
917 nmdc:mga03n38_714730_c1
918 nmdc:mga00v17_225202_c1
919 nmdc:mga00v17_340549_c1
920 nmdc:mga0k408_235734_c1
921 nmdc:mga0k408_238215_c1
922 nmdc:mga0k408_452078_c1
923 nmdc:mga0k408_473163_c1
924 nmdc:mga0k408_504_c1
925 nmdc:mga0k408_7882_c1
926 nmdc:mga0k408_8130_c1
927 nmdc:mga0k408_9301_c1
928 nmdc:mga06z11_106701_c1
929 nmdc:mga06z11_146399_c1
930 nmdc:mga06z11_258125_c1
931 nmdc:mga06z11_587941_c1
932 nmdc:mga04h51_113124_c1
933 nmdc:mga04h51_26458_c1
934 nmdc:mga04h51_63046_c1
935 nmdc:mga07m45_10888_c1
936 nmdc:mga07m45_150_c1
937 nmdc:mga07m45_2017_c1
938 nmdc:mga07m45_24397_c1
939 nmdc:mga07m45_344078_c1
940 nmdc:mga07m45_399176_c1
941 nmdc:mga07m45_804644_c1
942 nmdc:mga07m45_8835_c1
943 nmdc:mga0qj67_109111_c1
944 nmdc:mga0sz30_354721_c1
945 nmdc:mga0sz30_9248_c2
946 Ga0495655_0233632
947 Ga0495619_1025056
948 Ga0500644_0016039
949 Ga0500651_0235474
950 Ga0500660_237644
951 Ga0500562_044638
952 Ga0500593_016489
953 Ga0500658_0003736
954 Ga0500559_0000948
955 Ga0500559_0524381
956 Ga0500568_0019208
957 Ga0500586_205174
958 Ga0500616_0168909
959 Ga0500620_214222
960 Ga0500627_0199747
961 Ga0500645_001435
962 Ga0500645_002264
963 Ga0500645_079960
964 Ga0500661_001087
965 2511247026
966 2643866698
967 2643993431
968 2644294569
969 2644305109
970 2881101925
971 2974323103
972 2990712667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

46

124

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9728 3 127
2fs2-assembly1.cif.gz_B structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.9553 6 126
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9466 4 126
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9434 7 124
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9425 3 127
ID Description Score Start End Superfamily
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9731 3 126 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9495 6 126 3.10.129.10
2fs2B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9483 6 126 3.10.129.10
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9415 3 126 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9368 5 124 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7J3SJJ5-F1-model_v4 PaaI family thioesterase 0.9613 8 124 GO:0047617
AF-A0A843A950-F1-model_v4 PaaI family thioesterase 0.955 8 127 GO:0047617
AF-A0A4R4M627-F1-model_v4 PaaI family thioesterase 0.952 6 131 GO:0047617
AF-A0A7K4FWL5-F1-model_v4 PaaI family thioesterase 0.9512 8 127 GO:0047617
AF-A0A3D2FXV3-F1-model_v4 Thioesterase domain-containing protein 0.9503 6 126 GO:0016289

Map