F453300

General Info

Members Datasets Scaffolds Average Seq Length
486 162 972 73

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000687|Ga0395899_0000687_9141_9392
Length 83
Sequence MPQFIWREINTMLGKLAGAWLGEKVAGRNEGAKGAILGYGAAALAKRSVPALAALALAGWAFRKWRDKRRANPSYPSDATPSS

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
121 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
122 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.56
Rhizosphere 93.83
Stem 0
Stem Tuber 0
Unclassified 6.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0000687 3300037312 Bacteria 34067
2 JGI24740J21852_10007005 3300001979 Bacteria 4623
3 JGI24740J21852_10046210 3300001979 Bacteria 1279
4 JGI24740J21852_10070193 3300001979 Bacteria 940
5 JGI24737J22298_10081347 3300001990 Bacteria 964
6 JGI24735J21928_10001751 3300002067 Bacteria 7651
7 JGI24735J21928_10034226 3300002067 Bacteria 1498
8 Ga0070658_10022571 3300005327 Bacteria 5050
9 Ga0070658_10022687 3300005327 Bacteria 5037
10 Ga0070658_10093420 3300005327 Bacteria 2481
11 Ga0070658_10265187 3300005327 Bacteria 1459
12 Ga0070658_10753286 3300005327 Bacteria 846
13 Ga0070658_11238112 3300005327 Bacteria 649
14 Ga0070658_11450157 3300005327 Bacteria 595
15 Ga0070658_11967618 3300005327 Unclassified 505
16 Ga0070676_10020753 3300005328 Bacteria 3672
17 Ga0070676_10093857 3300005328 Bacteria 1843
18 Ga0070676_10238340 3300005328 Bacteria 1209
19 Ga0070676_10314483 3300005328 Bacteria 1066
20 Ga0070683_100020702 3300005329 Bacteria 5857
21 Ga0070683_100062614 3300005329 Bacteria 3459
22 Ga0070683_101654130 3300005329 Bacteria 616
23 Ga0070690_100006157 3300005330 Bacteria 6796
24 Ga0070690_100936977 3300005330 Unclassified 679
25 Ga0070670_100112229 3300005331 Bacteria 2349
26 Ga0070670_101426540 3300005331 Unclassified 635
27 Ga0070670_101978524 3300005331 Unclassified 537
28 Ga0070670_102118659 3300005331 Unclassified 518
29 Ga0068869_100772367 3300005334 Bacteria 824
30 Ga0070666_10204472 3300005335 Bacteria 1389
31 Ga0070666_10632587 3300005335 Bacteria 782
32 Ga0070666_10681746 3300005335 Bacteria 753
33 Ga0070680_100045610 3300005336 Bacteria 3564
34 Ga0070680_100111862 3300005336 Bacteria 2274
35 Ga0070680_100232449 3300005336 Bacteria 1557
36 Ga0070682_100471554 3300005337 Bacteria 966
37 Ga0070682_100502469 3300005337 Bacteria 940
38 Ga0070682_100718942 3300005337 Bacteria 803
39 Ga0068868_100338617 3300005338 Bacteria 1286
40 Ga0068868_101516501 3300005338 Unclassified 628
41 Ga0070660_100029089 3300005339 Bacteria 4138
42 Ga0070660_100091463 3300005339 Bacteria 2400
43 Ga0070660_100119503 3300005339 Bacteria 2102
44 Ga0070660_100189549 3300005339 Bacteria 1665
45 Ga0070660_100249638 3300005339 Bacteria 1447
46 Ga0070660_100282742 3300005339 Bacteria 1358
47 Ga0070660_100484750 3300005339 Bacteria 1028
48 Ga0070660_100643718 3300005339 Bacteria 887
49 Ga0070660_101769222 3300005339 Bacteria 526
50 Ga0070691_10509166 3300005341 Bacteria 697
51 Ga0070687_100945514 3300005343 Archaea 621
52 Ga0070661_100025737 3300005344 Bacteria 4229
53 Ga0070661_100040851 3300005344 Bacteria 3385
54 Ga0070661_100073683 3300005344 Bacteria 2514
55 Ga0070661_100131087 3300005344 Bacteria 1883
56 Ga0070661_100211830 3300005344 Bacteria 1484
57 Ga0070661_100316462 3300005344 Bacteria 1218
58 Ga0070661_100337734 3300005344 Bacteria 1179
59 Ga0070661_100388498 3300005344 Bacteria 1101
60 Ga0070661_101155198 3300005344 Archaea 646
61 Ga0070661_101601060 3300005344 Bacteria 551
62 Ga0070692_10049607 3300005345 Bacteria 2178
63 Ga0070692_10084159 3300005345 Bacteria 1719
64 Ga0070692_10414223 3300005345 Bacteria 854
65 Ga0070668_100558524 3300005347 Bacteria 997
66 Ga0070671_100069046 3300005355 Bacteria 2947
67 Ga0070671_100077853 3300005355 Bacteria 2771
68 Ga0070671_100130181 3300005355 Bacteria 2119
69 Ga0070671_100155246 3300005355 Bacteria 1933
70 Ga0070671_100654620 3300005355 Bacteria 910
71 Ga0070671_101075532 3300005355 Bacteria 706
72 Ga0070674_100045171 3300005356 Bacteria 3009
73 Ga0070673_100112309 3300005364 Bacteria 2262
74 Ga0070673_100363513 3300005364 Bacteria 1287
75 Ga0070673_100556369 3300005364 Bacteria 1042
76 Ga0070659_100056788 3300005366 Bacteria 3087
77 Ga0070659_100321548 3300005366 Bacteria 1293
78 Ga0070659_100479122 3300005366 Bacteria 1059
79 Ga0070659_100656047 3300005366 Bacteria 905
80 Ga0070659_100707079 3300005366 Bacteria 872
81 Ga0070659_100742897 3300005366 Bacteria 851
82 Ga0070659_100841398 3300005366 Archaea 799
83 Ga0070659_100974505 3300005366 Bacteria 743
84 Ga0070659_101203613 3300005366 Unclassified 670
85 Ga0070659_102118854 3300005366 Unclassified 505
86 Ga0070667_100002994 3300005367 Bacteria 14513
87 Ga0070667_100077300 3300005367 Bacteria 2842
88 Ga0070667_100085939 3300005367 Bacteria 2698
89 Ga0070667_100321690 3300005367 Bacteria 1396
90 Ga0070667_100386037 3300005367 Bacteria 1273
91 Ga0070663_100003596 3300005455 Bacteria 8952
92 Ga0070663_100040829 3300005455 Bacteria 3251
93 Ga0070663_100047634 3300005455 Bacteria 3036
94 Ga0070663_100053532 3300005455 Bacteria 2881
95 Ga0070663_100102352 3300005455 Bacteria 2139
96 Ga0070663_100995260 3300005455 Bacteria 729
97 Ga0070663_101832700 3300005455 Bacteria 544
98 Ga0070662_100046174 3300005457 Bacteria 3129
99 Ga0070662_100050593 3300005457 Bacteria 2997
100 Ga0070662_100103337 3300005457 Bacteria 2161
101 Ga0070662_100394615 3300005457 Bacteria 1141
102 Ga0070662_100651468 3300005457 Unclassified 888
103 Ga0070662_101632898 3300005457 Bacteria 556
104 Ga0070681_10248157 3300005458 Bacteria 1693
105 Ga0070681_11026336 3300005458 Bacteria 745
106 Ga0068867_100003335 3300005459 Bacteria 11308
107 Ga0068867_100074564 3300005459 Bacteria 2543
108 Ga0070679_100090769 3300005530 Bacteria 3043
109 Ga0070679_100121162 3300005530 Bacteria 2600
110 Ga0070679_100231988 3300005530 Bacteria 1805
111 Ga0070679_100334435 3300005530 Bacteria 1463
112 Ga0070679_100667304 3300005530 Bacteria 982
113 Ga0070679_101145506 3300005530 Bacteria 723
114 Ga0070679_101895329 3300005530 Bacteria 545
115 Ga0070684_100101583 3300005535 Bacteria 2570
116 Ga0070684_100354084 3300005535 Bacteria 1351
117 Ga0070684_101021750 3300005535 Bacteria 776
118 Ga0068853_100026634 3300005539 Bacteria 4856
119 Ga0068853_100632680 3300005539 Bacteria 1017
120 Ga0068853_100692779 3300005539 Bacteria 971
121 Ga0068853_100900122 3300005539 Bacteria 850
122 Ga0068853_101095442 3300005539 Bacteria 768
123 Ga0068853_102016709 3300005539 Bacteria 559
124 Ga0068853_102298013 3300005539 Archaea 522
125 Ga0070672_100024498 3300005543 Bacteria 4462
126 Ga0070672_100857579 3300005543 Bacteria 801
127 Ga0070686_100062147 3300005544 Bacteria 2416
128 Ga0070665_100003304 3300005548 Bacteria 17277
129 Ga0070665_100107006 3300005548 Bacteria 2799
130 Ga0070665_101185442 3300005548 Bacteria 775
131 Ga0068855_100065754 3300005563 Bacteria 4227
132 Ga0068855_100154261 3300005563 Bacteria 2610
133 Ga0068855_102522662 3300005563 Unclassified 511
134 Ga0070664_100247418 3300005564 Bacteria 1602
135 Ga0070664_100324054 3300005564 Bacteria 1397
136 Ga0070664_100388729 3300005564 Bacteria 1274
137 Ga0068857_100167299 3300005577 Bacteria 1997
138 Ga0068854_100028580 3300005578 Bacteria 3854
139 Ga0068854_100044520 3300005578 Bacteria 3151
140 Ga0068854_100172964 3300005578 Bacteria 1682
141 Ga0068854_100360397 3300005578 Bacteria 1193
142 Ga0068854_100434106 3300005578 Bacteria 1093
143 Ga0068854_101890397 3300005578 Archaea 548
144 Ga0068856_100115951 3300005614 Bacteria 2679
145 Ga0068856_100992927 3300005614 Bacteria 858
146 Ga0068856_102184001 3300005614 Bacteria 563
147 Ga0068852_100013647 3300005616 Bacteria 6222
148 Ga0068852_100048423 3300005616 Bacteria 3631
149 Ga0068852_100381679 3300005616 Bacteria 1382
150 Ga0068852_100604968 3300005616 Bacteria 1101
151 Ga0068852_100648859 3300005616 Bacteria 1063
152 Ga0068852_100978517 3300005616 Bacteria 864
153 Ga0068859_100059511 3300005617 Bacteria 3849
154 Ga0068864_100007569 3300005618 Bacteria 8949
155 Ga0068864_100063614 3300005618 Bacteria 3197
156 Ga0068866_10899199 3300005718 Bacteria 623
157 Ga0068861_102668026 3300005719 Bacteria 504
158 Ga0068851_10000614 3300005834 Bacteria 15293
159 Ga0068851_10006809 3300005834 Bacteria 5231
160 Ga0068851_10023104 3300005834 Bacteria 3036
161 Ga0068851_10213965 3300005834 Bacteria 1080
162 Ga0068863_100038339 3300005841 Bacteria 4560
163 Ga0068863_101404696 3300005841 Bacteria 706
164 Ga0068858_100026684 3300005842 Bacteria 5365
165 Ga0068858_100278310 3300005842 Bacteria 1593
166 Ga0068860_100086471 3300005843 Bacteria 2984
167 Ga0068860_100614693 3300005843 Bacteria 1093
168 Ga0068860_100671262 3300005843 Bacteria 1045
169 Ga0070712_100005615 3300006175 Bacteria 7762
170 Ga0097621_100034531 3300006237 Bacteria 4035
171 Ga0068871_100124595 3300006358 Bacteria 2179
172 Ga0068871_100316611 3300006358 Bacteria 1373
173 Ga0068871_100512679 3300006358 Bacteria 1082
174 Ga0068871_100686582 3300006358 Bacteria 937
175 Ga0068865_100014117 3300006881 Bacteria 5069
176 Ga0068865_101043016 3300006881 Bacteria 718
177 Ga0097620_100059510 3300006931 Bacteria 3849
178 Ga0105240_12402335 3300009093 Unclassified 545
179 Ga0105247_11205079 3300009101 Bacteria 603
180 Ga0105248_10232121 3300009177 Bacteria 2077
181 Ga0105248_12064951 3300009177 Archaea 648
182 Ga0105238_10554249 3300009551 Bacteria 1154
183 Ga0105249_11461672 3300009553 Unclassified 756
184 Ga0105249_11957666 3300009553 Bacteria 659
185 Ga0157373_10132017 3300013100 Unclassified 1756
186 Ga0157373_10239387 3300013100 Bacteria 1283
187 Ga0157373_10474468 3300013100 Bacteria 902
188 Ga0157373_10531156 3300013100 Unclassified 852
189 Ga0157371_10046657 3300013102 Bacteria 3081
190 Ga0157371_10048819 3300013102 Bacteria 3009
191 Ga0157371_10780457 3300013102 Bacteria 719
192 Ga0157371_11054360 3300013102 Unclassified 622
193 Ga0157371_11585374 3300013102 Unclassified 512
194 Ga0157370_10066476 3300013104 Bacteria 3410
195 Ga0157370_10200817 3300013104 Bacteria 1849
196 Ga0157370_10573619 3300013104 Bacteria 1034
197 Ga0157369_10253999 3300013105 Bacteria 1834
198 Ga0157369_10264039 3300013105 Bacteria 1795
199 Ga0157369_11778262 3300013105 Unclassified 626
200 Ga0157369_12386891 3300013105 Bacteria 536
201 Ga0157374_10026332 3300013296 Bacteria 5232
202 Ga0157374_10353644 3300013296 Bacteria 1460
203 Ga0157378_10247236 3300013297 Bacteria 1706
204 Ga0157378_11976735 3300013297 Bacteria 633
205 Ga0157372_10162225 3300013307 Bacteria 2584
206 Ga0157372_11655012 3300013307 Unclassified 737
207 Ga0157372_12197097 3300013307 Bacteria 634
208 Ga0157372_12684479 3300013307 Bacteria 571
209 Ga0157375_10613912 3300013308 Bacteria 1246
210 Ga0163163_11209036 3300014325 Bacteria 818
211 Ga0182008_10270907 3300014497 Bacteria 881
212 Ga0182008_10726835 3300014497 Unclassified 570
213 Ga0182008_10789417 3300014497 Unclassified 550
214 Ga0163161_10672772 3300017792 Bacteria 860
215 Ga0197907_11077738 3300020069 Bacteria 720
216 Ga0206353_11436948 3300020082 Bacteria 966
217 Ga0206353_11977083 3300020082 Bacteria 1349
218 Ga0213875_10004626 3300021388 Bacteria 7508
219 Ga0207656_10013621 3300025321 Bacteria 3113
220 Ga0207656_10033991 3300025321 Bacteria 2126
221 Ga0207656_10043489 3300025321 Bacteria 1916
222 Ga0207656_10165585 3300025321 Bacteria 1054
223 Ga0207688_10239673 3300025901 Bacteria 1097
224 Ga0207688_10873686 3300025901 Unclassified 569
225 Ga0207680_10032424 3300025903 Bacteria 2970
226 Ga0207680_10744394 3300025903 Bacteria 703
227 Ga0207647_10009704 3300025904 Bacteria 6829
228 Ga0207647_10066223 3300025904 Bacteria 2191
229 Ga0207647_10073545 3300025904 Bacteria 2059
230 Ga0207645_10096509 3300025907 Bacteria 1904
231 Ga0207645_10304959 3300025907 Bacteria 1061
232 Ga0207645_10419760 3300025907 Bacteria 901
233 Ga0207705_10006976 3300025909 Bacteria 8340
234 Ga0207705_10010955 3300025909 Bacteria 6584
235 Ga0207705_10015490 3300025909 Bacteria 5471
236 Ga0207705_10024351 3300025909 Bacteria 4320
237 Ga0207705_10032035 3300025909 Bacteria 3755
238 Ga0207705_10070029 3300025909 Bacteria 2541
239 Ga0207705_10100335 3300025909 Bacteria 2129
240 Ga0207705_10578449 3300025909 Bacteria 873
241 Ga0207705_10898453 3300025909 Unclassified 686
242 Ga0207705_11163016 3300025909 Unclassified 593
243 Ga0207705_11344610 3300025909 Bacteria 544
244 Ga0207705_11479750 3300025909 Bacteria 515
245 Ga0207654_10500630 3300025911 Bacteria 858
246 Ga0207707_10433970 3300025912 Bacteria 1125
247 Ga0207707_10998200 3300025912 Unclassified 687
248 Ga0207707_11346426 3300025912 Unclassified 572
249 Ga0207707_11513238 3300025912 Bacteria 531
250 Ga0207693_10062090 3300025915 Bacteria 2927
251 Ga0207660_10006226 3300025917 Bacteria 7749
252 Ga0207660_10748996 3300025917 Bacteria 797
253 Ga0207657_10007286 3300025919 Bacteria 11349
254 Ga0207657_10014645 3300025919 Bacteria 7642
255 Ga0207657_10018456 3300025919 Bacteria 6657
256 Ga0207657_10023090 3300025919 Bacteria 5800
257 Ga0207657_10040471 3300025919 Bacteria 4129
258 Ga0207657_10094491 3300025919 Bacteria 2490
259 Ga0207657_10118540 3300025919 Bacteria 2179
260 Ga0207657_10152277 3300025919 Bacteria 1883
261 Ga0207657_10560746 3300025919 Bacteria 893
262 Ga0207649_10007324 3300025920 Bacteria 6005
263 Ga0207649_10012659 3300025920 Bacteria 4687
264 Ga0207649_10074585 3300025920 Bacteria 2177
265 Ga0207649_10090821 3300025920 Bacteria 1999
266 Ga0207649_10206137 3300025920 Bacteria 1392
267 Ga0207649_10511762 3300025920 Bacteria 914
268 Ga0207649_10536039 3300025920 Bacteria 894
269 Ga0207649_10851735 3300025920 Bacteria 713
270 Ga0207649_11441324 3300025920 Bacteria 545
271 Ga0207652_10055683 3300025921 Bacteria 3402
272 Ga0207652_10063115 3300025921 Bacteria 3203
273 Ga0207652_10199268 3300025921 Bacteria 1802
274 Ga0207652_10386628 3300025921 Bacteria 1263
275 Ga0207652_10775171 3300025921 Bacteria 852
276 Ga0207652_10842964 3300025921 Bacteria 812
277 Ga0207694_10076107 3300025924 Bacteria 2628
278 Ga0207694_10882675 3300025924 Bacteria 756
279 Ga0207650_10305557 3300025925 Bacteria 1300
280 Ga0207650_11737671 3300025925 Unclassified 528
281 Ga0207644_10001216 3300025931 Bacteria 16579
282 Ga0207644_10006405 3300025931 Bacteria 7670
283 Ga0207644_10149922 3300025931 Bacteria 1804
284 Ga0207644_10430808 3300025931 Bacteria 1081
285 Ga0207644_10632011 3300025931 Bacteria 890
286 Ga0207644_11795316 3300025931 Bacteria 513
287 Ga0207690_10021881 3300025932 Bacteria 3971
288 Ga0207690_10022553 3300025932 Bacteria 3919
289 Ga0207690_10102090 3300025932 Bacteria 2050
290 Ga0207690_10251620 3300025932 Bacteria 1365
291 Ga0207690_10552335 3300025932 Bacteria 936
292 Ga0207706_10019154 3300025933 Bacteria 6155
293 Ga0207706_10027412 3300025933 Bacteria 5093
294 Ga0207706_10036352 3300025933 Bacteria 4374
295 Ga0207706_10090707 3300025933 Bacteria 2687
296 Ga0207686_10047965 3300025934 Bacteria 2643
297 Ga0207686_10439301 3300025934 Bacteria 1002
298 Ga0207670_10370486 3300025936 Bacteria 1138
299 Ga0207669_10083432 3300025937 Bacteria 2055
300 Ga0207704_10166227 3300025938 Bacteria 1576
301 Ga0207704_10712619 3300025938 Bacteria 832
302 Ga0207691_10003697 3300025940 Bacteria 14837
303 Ga0207691_10415915 3300025940 Bacteria 1146
304 Ga0207711_10011158 3300025941 Bacteria 7467
305 Ga0207711_10019716 3300025941 Bacteria 5617
306 Ga0207711_10036896 3300025941 Bacteria 4148
307 Ga0207711_10080893 3300025941 Bacteria 2838
308 Ga0207711_10183586 3300025941 Bacteria 1903
309 Ga0207711_10631268 3300025941 Bacteria 999
310 Ga0207711_11341953 3300025941 Bacteria 657
311 Ga0207661_10103025 3300025944 Bacteria 2401
312 Ga0207661_10454089 3300025944 Bacteria 1167
313 Ga0207661_11929417 3300025944 Unclassified 536
314 Ga0207679_10058105 3300025945 Bacteria 2864
315 Ga0207679_10119546 3300025945 Bacteria 2095
316 Ga0207679_10209548 3300025945 Bacteria 1633
317 Ga0207679_10214710 3300025945 Bacteria 1615
318 Ga0207679_10594385 3300025945 Bacteria 997
319 Ga0207667_10041106 3300025949 Bacteria 4919
320 Ga0207667_10377103 3300025949 Bacteria 1445
321 Ga0207667_11901054 3300025949 Bacteria 557
322 Ga0207651_10010199 3300025960 Bacteria 5193
323 Ga0207651_11461714 3300025960 Bacteria 615
324 Ga0207712_10818711 3300025961 Bacteria 819
325 Ga0207668_10222436 3300025972 Bacteria 1517
326 Ga0207668_10974895 3300025972 Bacteria 757
327 Ga0207640_10139123 3300025981 Bacteria 1767
328 Ga0207640_10276365 3300025981 Bacteria 1317
329 Ga0207640_10680509 3300025981 Bacteria 880
330 Ga0207640_10821999 3300025981 Bacteria 806
331 Ga0207640_11953893 3300025981 Bacteria 531
332 Ga0207658_10018323 3300025986 Bacteria 4834
333 Ga0207658_10616222 3300025986 Bacteria 976
334 Ga0207658_10653033 3300025986 Bacteria 948
335 Ga0207658_10696393 3300025986 Bacteria 918
336 Ga0207658_12110918 3300025986 Archaea 512
337 Ga0207677_10023956 3300026023 Bacteria 3781
338 Ga0207703_10034315 3300026035 Bacteria 4025
339 Ga0207703_10124282 3300026035 Bacteria 2219
340 Ga0207639_10075060 3300026041 Bacteria 2657
341 Ga0207639_10165632 3300026041 Bacteria 1867
342 Ga0207639_10652338 3300026041 Bacteria 974
343 Ga0207678_10001579 3300026067 Bacteria 20944
344 Ga0207678_10002108 3300026067 Bacteria 18018
345 Ga0207678_10002370 3300026067 Bacteria 17093
346 Ga0207678_10013886 3300026067 Bacteria 7076
347 Ga0207678_10139444 3300026067 Bacteria 2069
348 Ga0207678_11981482 3300026067 Bacteria 507
349 Ga0207702_10108742 3300026078 Bacteria 2461
350 Ga0207702_10557412 3300026078 Bacteria 1121
351 Ga0207702_10626666 3300026078 Bacteria 1057
352 Ga0207702_10775818 3300026078 Bacteria 947
353 Ga0207702_10789221 3300026078 Bacteria 938
354 Ga0207702_11093741 3300026078 Bacteria 791
355 Ga0207702_11396466 3300026078 Bacteria 694
356 Ga0207641_10019019 3300026088 Bacteria 5634
357 Ga0207641_10090412 3300026088 Bacteria 2677
358 Ga0207648_10001378 3300026089 Bacteria 26765
359 Ga0207676_10089238 3300026095 Bacteria 2526
360 Ga0207676_10559626 3300026095 Bacteria 1093
361 Ga0207676_10600073 3300026095 Bacteria 1057
362 Ga0207674_10020188 3300026116 Bacteria 7204
363 Ga0207674_10042457 3300026116 Bacteria 4696
364 Ga0207683_10003456 3300026121 Bacteria 13779
365 Ga0207683_10382417 3300026121 Bacteria 1294
366 Ga0207698_10076726 3300026142 Bacteria 2676
367 Ga0207698_10109760 3300026142 Bacteria 2309
368 Ga0207698_10216108 3300026142 Bacteria 1729
369 Ga0207698_10578862 3300026142 Bacteria 1104
370 Ga0268266_10011030 3300028379 Bacteria 7869
371 Ga0268266_10181339 3300028379 Bacteria 1917
372 Ga0268265_11138959 3300028380 Bacteria 776
373 Ga0268264_10046990 3300028381 Bacteria 3588
374 Ga0268264_10056052 3300028381 Bacteria 3294
375 Ga0268264_10640657 3300028381 Bacteria 1051
376 Ga0373930_0010780 3300034816 Bacteria 1640
377 Ga0373959_0050600 3300034820 Bacteria 896
378 Ga0373949_0163988 3300035090 Bacteria 650
379 Ga0373952_0286945 3300035092 Bacteria 509
380 Ga0373960_0040176 3300035121 Bacteria 1349
381 Ga0373942_0047508 3300035207 Bacteria 1193
382 Ga0373962_0024499 3300035242 Bacteria 1614
383 Ga0373931_0133131 3300035691 Bacteria 1433
384 Ga0373931_0320317 3300035691 Bacteria 963
385 Ga0395899_0000211 3300037312 Bacteria 85166
386 Ga0395899_0162816 3300037312 Bacteria 1575
387 Ga0395899_0189938 3300037312 Bacteria 1437
388 Ga0395899_0230991 3300037312 Bacteria 1277
389 Ga0395899_0336143 3300037312 Bacteria 1014
390 Ga0395899_0436068 3300037312 Unclassified 861
391 Ga0395899_0810791 3300037312 Unclassified 577
392 Ga0395900_0000578 3300037418 Bacteria 50604
393 Ga0395900_0010418 3300037418 Bacteria 9505
394 Ga0395900_0125572 3300037418 Bacteria 2631
395 Ga0395900_0378712 3300037418 Bacteria 1384
396 Ga0395900_0399018 3300037418 Bacteria 1340
397 Ga0395900_0411061 3300037418 Bacteria 1315
398 Ga0395900_0623821 3300037418 Bacteria 1017
399 Ga0395900_1373826 3300037418 Bacteria 619
400 Ga0395900_1622840 3300037418 Bacteria 558
401 Ga0395898_0000087 3300037466 Bacteria 239211
402 Ga0395898_0017845 3300037466 Bacteria 7240
403 Ga0395898_0101067 3300037466 Bacteria 2769
404 Ga0395898_0373616 3300037466 Bacteria 1359
405 Ga0395898_1070725 3300037466 Unclassified 740
406 Ga0395898_1434074 3300037466 Archaea 617
407 Ga0395905_0000005 3300037471 Bacteria 557808
408 Ga0395905_0001106 3300037471 Bacteria 33891
409 Ga0395905_0001847 3300037471 Bacteria 24433
410 Ga0395905_0003773 3300037471 Bacteria 16039
411 Ga0395905_0029534 3300037471 Bacteria 5165
412 Ga0395905_0099608 3300037471 Bacteria 2729
413 Ga0395905_0107716 3300037471 Bacteria 2616
414 Ga0395905_0119468 3300037471 Bacteria 2477
415 Ga0395905_0134824 3300037471 Bacteria 2322
416 Ga0395905_0216439 3300037471 Bacteria 1793
417 Ga0395905_0489673 3300037471 Bacteria 1129
418 Ga0395905_0574124 3300037471 Bacteria 1029
419 Ga0395905_1368880 3300037471 Bacteria 612
420 Ga0436364_0593521 3300037853 Bacteria 910
421 Ga0395901_0000746 3300038443 Bacteria 36782
422 Ga0395901_0009313 3300038443 Bacteria 9952
423 Ga0395901_0096256 3300038443 Bacteria 3102
424 Ga0395901_0148612 3300038443 Bacteria 2462
425 Ga0395901_0165435 3300038443 Bacteria 2322
426 Ga0395901_0166750 3300038443 Bacteria 2312
427 Ga0395901_0237085 3300038443 Bacteria 1903
428 Ga0395901_0843264 3300038443 Bacteria 902
429 Ga0395901_1697563 3300038443 Bacteria 583
430 Ga0451837_0746989 3300041494 Bacteria 626
431 Ga0466969_0036008 3300044656 Bacteria 2502
432 Ga0466972_0025646 3300044658 Bacteria 2920
433 Ga0466961_0022821 3300044693 Bacteria 4025
434 Ga0466961_0040942 3300044693 Bacteria 2970
435 Ga0466963_0464919 3300044694 Bacteria 893
436 Ga0466964_0226386 3300044706 Bacteria 910
437 Ga0466971_0427659 3300044719 Bacteria 648
438 Ga0466971_0599297 3300044719 Bacteria 549
439 Ga0466968_0015274 3300044735 Bacteria 3041
440 Ga0466970_0291314 3300044765 Bacteria 919
441 Ga0466957_0324240 3300044842 Bacteria 1040
442 Ga0466957_1323300 3300044842 Bacteria 523
443 Ga0466960_0444624 3300044901 Bacteria 753
444 Ga0466959_0018193 3300045049 Bacteria 5158
445 Ga0466959_0023048 3300045049 Bacteria 4605
446 Ga0466958_0022063 3300045836 Bacteria 3725
447 Ga0466967_0038497 3300045976 Bacteria 4102
448 Ga0466967_0087028 3300045976 Bacteria 2832
449 Ga0466967_0363808 3300045976 Bacteria 1402
450 Ga0466967_0556844 3300045976 Bacteria 1129
451 Ga0466967_0579635 3300045976 Bacteria 1106
452 Ga0466967_1254727 3300045976 Bacteria 738
453 Ga0495621_0023029 3300046539 Bacteria 2070
454 Ga0495621_0034731 3300046539 Bacteria 1743
455 Ga0495669_0019818 3300046684 Bacteria 2905
456 Ga0495669_0090086 3300046684 Bacteria 1415
457 Ga0495669_0098208 3300046684 Bacteria 1358
458 Ga0495669_0105482 3300046684 Bacteria 1312
459 Ga0495672_0375456 3300047320 Bacteria 655
460 Ga0496100_0019877 3300048903 Bacteria 4016
461 Ga0496101_0450734 3300048904 Bacteria 1015
462 Ga0496103_0093876 3300048906 Bacteria 1895
463 Ga0496105_0034054 3300048908 Bacteria 4188
464 Ga0496106_0059069 3300048909 Bacteria 2904
465 Ga0496107_0104531 3300048910 Bacteria 2078
466 Ga0496107_0530176 3300048910 Bacteria 873
467 Ga0496107_0861998 3300048910 Unclassified 661
468 Ga0496108_0008683 3300048911 Bacteria 8238
469 Ga0496108_0082549 3300048911 Bacteria 2725
470 Ga0496108_0096017 3300048911 Bacteria 2524
471 Ga0496109_0013691 3300048912 Bacteria 7044
472 Ga0496109_1082930 3300048912 Bacteria 738
473 Ga0496109_1085563 3300048912 Bacteria 737
474 Ga0496110_0002297 3300048913 Bacteria 14294
475 Ga0496110_0027918 3300048913 Bacteria 4842
476 Ga0496110_0188801 3300048913 Bacteria 1871
477 Ga0496110_1170652 3300048913 Unclassified 677
478 Ga0496111_0002692 3300048914 Bacteria 10794
479 Ga0496111_0010894 3300048914 Bacteria 6116
480 Ga0496111_1123158 3300048914 Unclassified 559
481 Ga0496112_0079120 3300048915 Bacteria 3251
482 Ga0496112_0087887 3300048915 Bacteria 3075
483 Ga0496113_0012734 3300048916 Bacteria 5664
484 Ga0496113_0031217 3300048916 Bacteria 3864
485 Ga0496113_0394852 3300048916 Bacteria 1110
486 Ga0496114_0239309 3300048917 Bacteria 1596
487 Ga0395899_0000687
488 JGI24740J21852_10007005
489 JGI24740J21852_10046210
490 JGI24740J21852_10070193
491 JGI24737J22298_10081347
492 JGI24735J21928_10001751
493 JGI24735J21928_10034226
494 Ga0070658_10022571
495 Ga0070658_10022687
496 Ga0070658_10093420
497 Ga0070658_10265187
498 Ga0070658_10753286
499 Ga0070658_11238112
500 Ga0070658_11450157
501 Ga0070658_11967618
502 Ga0070676_10020753
503 Ga0070676_10093857
504 Ga0070676_10238340
505 Ga0070676_10314483
506 Ga0070683_100020702
507 Ga0070683_100062614
508 Ga0070683_101654130
509 Ga0070690_100006157
510 Ga0070690_100936977
511 Ga0070670_100112229
512 Ga0070670_101426540
513 Ga0070670_101978524
514 Ga0070670_102118659
515 Ga0068869_100772367
516 Ga0070666_10204472
517 Ga0070666_10632587
518 Ga0070666_10681746
519 Ga0070680_100045610
520 Ga0070680_100111862
521 Ga0070680_100232449
522 Ga0070682_100471554
523 Ga0070682_100502469
524 Ga0070682_100718942
525 Ga0068868_100338617
526 Ga0068868_101516501
527 Ga0070660_100029089
528 Ga0070660_100091463
529 Ga0070660_100119503
530 Ga0070660_100189549
531 Ga0070660_100249638
532 Ga0070660_100282742
533 Ga0070660_100484750
534 Ga0070660_100643718
535 Ga0070660_101769222
536 Ga0070691_10509166
537 Ga0070687_100945514
538 Ga0070661_100025737
539 Ga0070661_100040851
540 Ga0070661_100073683
541 Ga0070661_100131087
542 Ga0070661_100211830
543 Ga0070661_100316462
544 Ga0070661_100337734
545 Ga0070661_100388498
546 Ga0070661_101155198
547 Ga0070661_101601060
548 Ga0070692_10049607
549 Ga0070692_10084159
550 Ga0070692_10414223
551 Ga0070668_100558524
552 Ga0070671_100069046
553 Ga0070671_100077853
554 Ga0070671_100130181
555 Ga0070671_100155246
556 Ga0070671_100654620
557 Ga0070671_101075532
558 Ga0070674_100045171
559 Ga0070673_100112309
560 Ga0070673_100363513
561 Ga0070673_100556369
562 Ga0070659_100056788
563 Ga0070659_100321548
564 Ga0070659_100479122
565 Ga0070659_100656047
566 Ga0070659_100707079
567 Ga0070659_100742897
568 Ga0070659_100841398
569 Ga0070659_100974505
570 Ga0070659_101203613
571 Ga0070659_102118854
572 Ga0070667_100002994
573 Ga0070667_100077300
574 Ga0070667_100085939
575 Ga0070667_100321690
576 Ga0070667_100386037
577 Ga0070663_100003596
578 Ga0070663_100040829
579 Ga0070663_100047634
580 Ga0070663_100053532
581 Ga0070663_100102352
582 Ga0070663_100995260
583 Ga0070663_101832700
584 Ga0070662_100046174
585 Ga0070662_100050593
586 Ga0070662_100103337
587 Ga0070662_100394615
588 Ga0070662_100651468
589 Ga0070662_101632898
590 Ga0070681_10248157
591 Ga0070681_11026336
592 Ga0068867_100003335
593 Ga0068867_100074564
594 Ga0070679_100090769
595 Ga0070679_100121162
596 Ga0070679_100231988
597 Ga0070679_100334435
598 Ga0070679_100667304
599 Ga0070679_101145506
600 Ga0070679_101895329
601 Ga0070684_100101583
602 Ga0070684_100354084
603 Ga0070684_101021750
604 Ga0068853_100026634
605 Ga0068853_100632680
606 Ga0068853_100692779
607 Ga0068853_100900122
608 Ga0068853_101095442
609 Ga0068853_102016709
610 Ga0068853_102298013
611 Ga0070672_100024498
612 Ga0070672_100857579
613 Ga0070686_100062147
614 Ga0070665_100003304
615 Ga0070665_100107006
616 Ga0070665_101185442
617 Ga0068855_100065754
618 Ga0068855_100154261
619 Ga0068855_102522662
620 Ga0070664_100247418
621 Ga0070664_100324054
622 Ga0070664_100388729
623 Ga0068857_100167299
624 Ga0068854_100028580
625 Ga0068854_100044520
626 Ga0068854_100172964
627 Ga0068854_100360397
628 Ga0068854_100434106
629 Ga0068854_101890397
630 Ga0068856_100115951
631 Ga0068856_100992927
632 Ga0068856_102184001
633 Ga0068852_100013647
634 Ga0068852_100048423
635 Ga0068852_100381679
636 Ga0068852_100604968
637 Ga0068852_100648859
638 Ga0068852_100978517
639 Ga0068859_100059511
640 Ga0068864_100007569
641 Ga0068864_100063614
642 Ga0068866_10899199
643 Ga0068861_102668026
644 Ga0068851_10000614
645 Ga0068851_10006809
646 Ga0068851_10023104
647 Ga0068851_10213965
648 Ga0068863_100038339
649 Ga0068863_101404696
650 Ga0068858_100026684
651 Ga0068858_100278310
652 Ga0068860_100086471
653 Ga0068860_100614693
654 Ga0068860_100671262
655 Ga0070712_100005615
656 Ga0097621_100034531
657 Ga0068871_100124595
658 Ga0068871_100316611
659 Ga0068871_100512679
660 Ga0068871_100686582
661 Ga0068865_100014117
662 Ga0068865_101043016
663 Ga0097620_100059510
664 Ga0105240_12402335
665 Ga0105247_11205079
666 Ga0105248_10232121
667 Ga0105248_12064951
668 Ga0105238_10554249
669 Ga0105249_11461672
670 Ga0105249_11957666
671 Ga0157373_10132017
672 Ga0157373_10239387
673 Ga0157373_10474468
674 Ga0157373_10531156
675 Ga0157371_10046657
676 Ga0157371_10048819
677 Ga0157371_10780457
678 Ga0157371_11054360
679 Ga0157371_11585374
680 Ga0157370_10066476
681 Ga0157370_10200817
682 Ga0157370_10573619
683 Ga0157369_10253999
684 Ga0157369_10264039
685 Ga0157369_11778262
686 Ga0157369_12386891
687 Ga0157374_10026332
688 Ga0157374_10353644
689 Ga0157378_10247236
690 Ga0157378_11976735
691 Ga0157372_10162225
692 Ga0157372_11655012
693 Ga0157372_12197097
694 Ga0157372_12684479
695 Ga0157375_10613912
696 Ga0163163_11209036
697 Ga0182008_10270907
698 Ga0182008_10726835
699 Ga0182008_10789417
700 Ga0163161_10672772
701 Ga0197907_11077738
702 Ga0206353_11436948
703 Ga0206353_11977083
704 Ga0213875_10004626
705 Ga0207656_10013621
706 Ga0207656_10033991
707 Ga0207656_10043489
708 Ga0207656_10165585
709 Ga0207688_10239673
710 Ga0207688_10873686
711 Ga0207680_10032424
712 Ga0207680_10744394
713 Ga0207647_10009704
714 Ga0207647_10066223
715 Ga0207647_10073545
716 Ga0207645_10096509
717 Ga0207645_10304959
718 Ga0207645_10419760
719 Ga0207705_10006976
720 Ga0207705_10010955
721 Ga0207705_10015490
722 Ga0207705_10024351
723 Ga0207705_10032035
724 Ga0207705_10070029
725 Ga0207705_10100335
726 Ga0207705_10578449
727 Ga0207705_10898453
728 Ga0207705_11163016
729 Ga0207705_11344610
730 Ga0207705_11479750
731 Ga0207654_10500630
732 Ga0207707_10433970
733 Ga0207707_10998200
734 Ga0207707_11346426
735 Ga0207707_11513238
736 Ga0207693_10062090
737 Ga0207660_10006226
738 Ga0207660_10748996
739 Ga0207657_10007286
740 Ga0207657_10014645
741 Ga0207657_10018456
742 Ga0207657_10023090
743 Ga0207657_10040471
744 Ga0207657_10094491
745 Ga0207657_10118540
746 Ga0207657_10152277
747 Ga0207657_10560746
748 Ga0207649_10007324
749 Ga0207649_10012659
750 Ga0207649_10074585
751 Ga0207649_10090821
752 Ga0207649_10206137
753 Ga0207649_10511762
754 Ga0207649_10536039
755 Ga0207649_10851735
756 Ga0207649_11441324
757 Ga0207652_10055683
758 Ga0207652_10063115
759 Ga0207652_10199268
760 Ga0207652_10386628
761 Ga0207652_10775171
762 Ga0207652_10842964
763 Ga0207694_10076107
764 Ga0207694_10882675
765 Ga0207650_10305557
766 Ga0207650_11737671
767 Ga0207644_10001216
768 Ga0207644_10006405
769 Ga0207644_10149922
770 Ga0207644_10430808
771 Ga0207644_10632011
772 Ga0207644_11795316
773 Ga0207690_10021881
774 Ga0207690_10022553
775 Ga0207690_10102090
776 Ga0207690_10251620
777 Ga0207690_10552335
778 Ga0207706_10019154
779 Ga0207706_10027412
780 Ga0207706_10036352
781 Ga0207706_10090707
782 Ga0207686_10047965
783 Ga0207686_10439301
784 Ga0207670_10370486
785 Ga0207669_10083432
786 Ga0207704_10166227
787 Ga0207704_10712619
788 Ga0207691_10003697
789 Ga0207691_10415915
790 Ga0207711_10011158
791 Ga0207711_10019716
792 Ga0207711_10036896
793 Ga0207711_10080893
794 Ga0207711_10183586
795 Ga0207711_10631268
796 Ga0207711_11341953
797 Ga0207661_10103025
798 Ga0207661_10454089
799 Ga0207661_11929417
800 Ga0207679_10058105
801 Ga0207679_10119546
802 Ga0207679_10209548
803 Ga0207679_10214710
804 Ga0207679_10594385
805 Ga0207667_10041106
806 Ga0207667_10377103
807 Ga0207667_11901054
808 Ga0207651_10010199
809 Ga0207651_11461714
810 Ga0207712_10818711
811 Ga0207668_10222436
812 Ga0207668_10974895
813 Ga0207640_10139123
814 Ga0207640_10276365
815 Ga0207640_10680509
816 Ga0207640_10821999
817 Ga0207640_11953893
818 Ga0207658_10018323
819 Ga0207658_10616222
820 Ga0207658_10653033
821 Ga0207658_10696393
822 Ga0207658_12110918
823 Ga0207677_10023956
824 Ga0207703_10034315
825 Ga0207703_10124282
826 Ga0207639_10075060
827 Ga0207639_10165632
828 Ga0207639_10652338
829 Ga0207678_10001579
830 Ga0207678_10002108
831 Ga0207678_10002370
832 Ga0207678_10013886
833 Ga0207678_10139444
834 Ga0207678_11981482
835 Ga0207702_10108742
836 Ga0207702_10557412
837 Ga0207702_10626666
838 Ga0207702_10775818
839 Ga0207702_10789221
840 Ga0207702_11093741
841 Ga0207702_11396466
842 Ga0207641_10019019
843 Ga0207641_10090412
844 Ga0207648_10001378
845 Ga0207676_10089238
846 Ga0207676_10559626
847 Ga0207676_10600073
848 Ga0207674_10020188
849 Ga0207674_10042457
850 Ga0207683_10003456
851 Ga0207683_10382417
852 Ga0207698_10076726
853 Ga0207698_10109760
854 Ga0207698_10216108
855 Ga0207698_10578862
856 Ga0268266_10011030
857 Ga0268266_10181339
858 Ga0268265_11138959
859 Ga0268264_10046990
860 Ga0268264_10056052
861 Ga0268264_10640657
862 Ga0373930_0010780
863 Ga0373959_0050600
864 Ga0373949_0163988
865 Ga0373952_0286945
866 Ga0373960_0040176
867 Ga0373942_0047508
868 Ga0373962_0024499
869 Ga0373931_0133131
870 Ga0373931_0320317
871 Ga0395899_0000211
872 Ga0395899_0162816
873 Ga0395899_0189938
874 Ga0395899_0230991
875 Ga0395899_0336143
876 Ga0395899_0436068
877 Ga0395899_0810791
878 Ga0395900_0000578
879 Ga0395900_0010418
880 Ga0395900_0125572
881 Ga0395900_0378712
882 Ga0395900_0399018
883 Ga0395900_0411061
884 Ga0395900_0623821
885 Ga0395900_1373826
886 Ga0395900_1622840
887 Ga0395898_0000087
888 Ga0395898_0017845
889 Ga0395898_0101067
890 Ga0395898_0373616
891 Ga0395898_1070725
892 Ga0395898_1434074
893 Ga0395905_0000005
894 Ga0395905_0001106
895 Ga0395905_0001847
896 Ga0395905_0003773
897 Ga0395905_0029534
898 Ga0395905_0099608
899 Ga0395905_0107716
900 Ga0395905_0119468
901 Ga0395905_0134824
902 Ga0395905_0216439
903 Ga0395905_0489673
904 Ga0395905_0574124
905 Ga0395905_1368880
906 Ga0436364_0593521
907 Ga0395901_0000746
908 Ga0395901_0009313
909 Ga0395901_0096256
910 Ga0395901_0148612
911 Ga0395901_0165435
912 Ga0395901_0166750
913 Ga0395901_0237085
914 Ga0395901_0843264
915 Ga0395901_1697563
916 Ga0451837_0746989
917 Ga0466969_0036008
918 Ga0466972_0025646
919 Ga0466961_0022821
920 Ga0466961_0040942
921 Ga0466963_0464919
922 Ga0466964_0226386
923 Ga0466971_0427659
924 Ga0466971_0599297
925 Ga0466968_0015274
926 Ga0466970_0291314
927 Ga0466957_0324240
928 Ga0466957_1323300
929 Ga0466960_0444624
930 Ga0466959_0018193
931 Ga0466959_0023048
932 Ga0466958_0022063
933 Ga0466967_0038497
934 Ga0466967_0087028
935 Ga0466967_0363808
936 Ga0466967_0556844
937 Ga0466967_0579635
938 Ga0466967_1254727
939 Ga0495621_0023029
940 Ga0495621_0034731
941 Ga0495669_0019818
942 Ga0495669_0090086
943 Ga0495669_0098208
944 Ga0495669_0105482
945 Ga0495672_0375456
946 Ga0496100_0019877
947 Ga0496101_0450734
948 Ga0496103_0093876
949 Ga0496105_0034054
950 Ga0496106_0059069
951 Ga0496107_0104531
952 Ga0496107_0530176
953 Ga0496107_0861998
954 Ga0496108_0008683
955 Ga0496108_0082549
956 Ga0496108_0096017
957 Ga0496109_0013691
958 Ga0496109_1082930
959 Ga0496109_1085563
960 Ga0496110_0002297
961 Ga0496110_0027918
962 Ga0496110_0188801
963 Ga0496110_1170652
964 Ga0496111_0002692
965 Ga0496111_0010894
966 Ga0496111_1123158
967 Ga0496112_0079120
968 Ga0496112_0087887
969 Ga0496113_0012734
970 Ga0496113_0031217
971 Ga0496113_0394852
972 Ga0496114_0239309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map