F453316

General Info

Members Datasets Scaffolds Average Seq Length
486 276 486 226

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0385802|Ga0466967_0385802_588_1271
Length 214
Sequence MTGSPRIVVVRQNILRHNDEVARALRARFHDAGVFVVSLVSSPGSGKTAFLERTLTLLKRERRPAALVGDLATENDAARLARSGAPVKQITTGTLCHLEAAMVENALTDVGNLVCPASFDVGEDLRLVLLSVTEGEDKPLKYPTIFNSADAAVITKADLADAVEFDCRAAEHSIASVRPGMPVLRVSSKTGAGLDDWLTFLHCRQAQRPSIAHK

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
108 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 2.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.73
Rhizosphere 93
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001152 3300001976 Bacteria 3580
2 JGI24747J21853_1003561 3300001978 Bacteria 1351
3 JGI24743J22301_10003913 3300001991 Bacteria 2387
4 JGI24748J21848_1021423 3300002074 Bacteria 780
5 JGI24034J26672_10003386 3300002239 Bacteria 2222
6 JGI24751J29686_10003121 3300002459 Bacteria 3338
7 Ga0058863_11829770 3300004799 Bacteria 4213
8 Ga0058862_12048676 3300004803 Bacteria 5711
9 Ga0065704_10030224 3300005289 Bacteria 1217
10 Ga0070658_10060388 3300005327 Bacteria 3087
11 Ga0070676_10020143 3300005328 Bacteria 3719
12 Ga0070683_100125751 3300005329 Bacteria 2424
13 Ga0070683_100165163 3300005329 Bacteria 2100
14 Ga0070683_100937459 3300005329 Bacteria 831
15 Ga0070690_100005406 3300005330 Bacteria 7171
16 Ga0068869_100002075 3300005334 Bacteria 12040
17 Ga0068869_100094684 3300005334 Bacteria 2252
18 Ga0070666_10014527 3300005335 Bacteria 5015
19 Ga0070680_100013125 3300005336 Bacteria 6448
20 Ga0070680_100146821 3300005336 Bacteria 1979
21 Ga0070680_100394310 3300005336 Bacteria 1179
22 Ga0070680_100705011 3300005336 Bacteria 868
23 Ga0070682_100194196 3300005337 Bacteria 1427
24 Ga0070682_100384599 3300005337 Bacteria 1057
25 Ga0068868_100034353 3300005338 Bacteria 3914
26 Ga0068868_100142702 3300005338 Bacteria 1967
27 Ga0070660_100002323 3300005339 Bacteria 13073
28 Ga0070689_100010155 3300005340 Bacteria 6704
29 Ga0070687_100026799 3300005343 Bacteria 2778
30 Ga0070692_10095664 3300005345 Bacteria 1621
31 Ga0070668_100026756 3300005347 Bacteria 4379
32 Ga0070669_100007907 3300005353 Bacteria 7598
33 Ga0070675_100027978 3300005354 Bacteria 4534
34 Ga0070674_100141445 3300005356 Bacteria 1806
35 Ga0070673_100087014 3300005364 Bacteria 2546
36 Ga0070688_100003715 3300005365 Bacteria 7893
37 Ga0070659_100021584 3300005366 Bacteria 4906
38 Ga0070667_100027044 3300005367 Bacteria 4772
39 Ga0070709_10003886 3300005434 Bacteria 8052
40 Ga0070709_10009194 3300005434 Bacteria 5439
41 Ga0070709_10022669 3300005434 Bacteria 3677
42 Ga0070709_10047969 3300005434 Bacteria 2663
43 Ga0070709_10320622 3300005434 Bacteria 1137
44 Ga0070714_100000312 3300005435 Bacteria 36817
45 Ga0070714_100087027 3300005435 Bacteria 2732
46 Ga0070714_100209702 3300005435 Unclassified 1785
47 Ga0070713_100000461 3300005436 Bacteria 25984
48 Ga0070713_100000811 3300005436 Bacteria 20055
49 Ga0070713_100004614 3300005436 Bacteria 9291
50 Ga0070713_100005052 3300005436 Bacteria 8972
51 Ga0070713_100016950 3300005436 Bacteria 5493
52 Ga0070710_10043828 3300005437 Bacteria 2480
53 Ga0070710_10333522 3300005437 Bacteria 999
54 Ga0070701_10067483 3300005438 Bacteria 1903
55 Ga0070711_100020276 3300005439 Bacteria 4282
56 Ga0070711_100316189 3300005439 Bacteria 1246
57 Ga0070663_100032360 3300005455 Bacteria 3604
58 Ga0070678_100056302 3300005456 Bacteria 2875
59 Ga0070662_100003918 3300005457 Bacteria 9334
60 Ga0070681_10004280 3300005458 Bacteria 13554
61 Ga0070681_10033476 3300005458 Bacteria 5159
62 Ga0070681_10053259 3300005458 Unclassified 4032
63 Ga0070681_10076227 3300005458 Bacteria 3312
64 Ga0070681_10114708 3300005458 Bacteria 2632
65 Ga0070681_10189200 3300005458 Bacteria 1978
66 Ga0068867_100157216 3300005459 Bacteria 1790
67 Ga0070685_10005907 3300005466 Bacteria 6229
68 Ga0070706_100038376 3300005467 Bacteria 4420
69 Ga0070698_100170272 3300005471 Unclassified 2119
70 Ga0070679_100001261 3300005530 Bacteria 22322
71 Ga0070679_100064046 3300005530 Bacteria 3664
72 Ga0070679_100274184 3300005530 Bacteria 1640
73 Ga0070684_100001340 3300005535 Bacteria 17632
74 Ga0070684_100136180 3300005535 Bacteria 2219
75 Ga0070684_100482515 3300005535 Bacteria 1147
76 Ga0068853_100020779 3300005539 Bacteria 5462
77 Ga0070672_100009518 3300005543 Bacteria 6704
78 Ga0070686_100005016 3300005544 Bacteria 7308
79 Ga0070695_100167310 3300005545 Bacteria 1548
80 Ga0070696_100014118 3300005546 Bacteria 5362
81 Ga0070665_100177625 3300005548 Bacteria 2130
82 Ga0070704_100211167 3300005549 Bacteria 1573
83 Ga0068855_100032862 3300005563 Bacteria 6194
84 Ga0068855_100210920 3300005563 Bacteria 2182
85 Ga0068855_100268608 3300005563 Bacteria 1897
86 Ga0070664_100106939 3300005564 Bacteria 2438
87 Ga0070664_100128474 3300005564 Bacteria 2225
88 Ga0068857_100013148 3300005577 Bacteria 7214
89 Ga0068857_100030940 3300005577 Bacteria 4729
90 Ga0068856_100039461 3300005614 Bacteria 4636
91 Ga0068856_100045456 3300005614 Bacteria 4324
92 Ga0068856_100107317 3300005614 Bacteria 2788
93 Ga0068856_100109303 3300005614 Bacteria 2761
94 Ga0068856_100343267 3300005614 Bacteria 1511
95 Ga0068856_100814014 3300005614 Bacteria 953
96 Ga0070702_100026934 3300005615 Bacteria 3096
97 Ga0068852_100015942 3300005616 Bacteria 5848
98 Ga0068852_100120749 3300005616 Bacteria 2399
99 Ga0068864_100004944 3300005618 Bacteria 10920
100 Ga0068866_10023518 3300005718 Bacteria 2868
101 Ga0068866_10024479 3300005718 Bacteria 2823
102 Ga0068866_10283551 3300005718 Bacteria 1027
103 Ga0068870_10009045 3300005840 Bacteria 4508
104 Ga0068858_100005966 3300005842 Bacteria 11895
105 Ga0068862_100012300 3300005844 Bacteria 7076
106 Ga0070717_10019257 3300006028 Bacteria 5350
107 Ga0070717_10072816 3300006028 Bacteria 2870
108 Ga0070717_10110366 3300006028 Bacteria 2346
109 Ga0070717_10133567 3300006028 Bacteria 2136
110 Ga0070717_10321716 3300006028 Bacteria 1378
111 Ga0070717_10496420 3300006028 Bacteria 1103
112 Ga0070717_10761921 3300006028 Bacteria 880
113 Ga0070716_100002017 3300006173 Bacteria 9272
114 Ga0070716_100008029 3300006173 Bacteria 5225
115 Ga0070716_100158978 3300006173 Bacteria 1462
116 Ga0070712_100000859 3300006175 Bacteria 18112
117 Ga0070712_100031707 3300006175 Bacteria 3563
118 Ga0097621_100002292 3300006237 Bacteria 13107
119 Ga0097621_100187381 3300006237 Bacteria 1790
120 Ga0068871_100037564 3300006358 Bacteria 3863
121 Ga0068871_100072006 3300006358 Bacteria 2845
122 Ga0068871_100116164 3300006358 Bacteria 2256
123 Ga0068871_100525612 3300006358 Bacteria 1069
124 Ga0075428_100042995 3300006844 Bacteria 4968
125 Ga0075431_100138914 3300006847 Bacteria 2505
126 Ga0075433_10950833 3300006852 Bacteria 749
127 Ga0075434_100683074 3300006871 Bacteria 1044
128 Ga0068865_100020424 3300006881 Bacteria 4294
129 Ga0105240_10215288 3300009093 Bacteria 2242
130 Ga0105240_10359704 3300009093 Bacteria 1649
131 Ga0105240_10458253 3300009093 Bacteria 1425
132 Ga0105240_10682801 3300009093 Bacteria 1123
133 Ga0105240_10748393 3300009093 Bacteria 1063
134 Ga0105245_10039878 3300009098 Bacteria 4181
135 Ga0105245_10151167 3300009098 Bacteria 2196
136 Ga0105245_10286366 3300009098 Bacteria 1612
137 Ga0105247_10017015 3300009101 Bacteria 4362
138 Ga0114129_10004476 3300009147 Bacteria 19703
139 Ga0105241_10013112 3300009174 Bacteria 6081
140 Ga0105241_10020850 3300009174 Bacteria 4844
141 Ga0105241_10256605 3300009174 Bacteria 1484
142 Ga0105242_10144231 3300009176 Bacteria 2070
143 Ga0105242_10147246 3300009176 Bacteria 2050
144 Ga0105242_10309115 3300009176 Unclassified 1446
145 Ga0105248_10097193 3300009177 Bacteria 3318
146 Ga0105248_11345999 3300009177 Bacteria 808
147 Ga0105237_10046404 3300009545 Bacteria 4370
148 Ga0105237_10170269 3300009545 Bacteria 2178
149 Ga0105237_10414022 3300009545 Bacteria 1353
150 Ga0105237_10706141 3300009545 Bacteria 1015
151 Ga0105249_10041248 3300009553 Bacteria 4195
152 Ga0105239_10026459 3300010375 Bacteria 6384
153 Ga0105239_10455330 3300010375 Bacteria 1452
154 Ga0105246_10003641 3300011119 Bacteria 9324
155 Ga0105246_10023078 3300011119 Bacteria 4023
156 Ga0157373_10002403 3300013100 Bacteria 14221
157 Ga0157373_10016567 3300013100 Bacteria 5374
158 Ga0157371_10282864 3300013102 Bacteria 1198
159 Ga0157370_10029765 3300013104 Bacteria 5355
160 Ga0157370_10072712 3300013104 Bacteria 3244
161 Ga0157370_10268002 3300013104 Bacteria 1578
162 Ga0157370_10313307 3300013104 Bacteria 1448
163 Ga0157370_10616217 3300013104 Bacteria 993
164 Ga0157369_10035063 3300013105 Bacteria 5503
165 Ga0157369_10052447 3300013105 Bacteria 4413
166 Ga0157369_10104277 3300013105 Bacteria 3020
167 Ga0157369_10139984 3300013105 Bacteria 2561
168 Ga0157369_10392075 3300013105 Bacteria 1441
169 Ga0157374_10004409 3300013296 Bacteria 11838
170 Ga0157374_10125007 3300013296 Bacteria 2486
171 Ga0157374_10195571 3300013296 Bacteria 1979
172 Ga0157378_10001316 3300013297 Bacteria 22353
173 Ga0157378_10368122 3300013297 Bacteria 1408
174 Ga0163162_10047635 3300013306 Bacteria 4295
175 Ga0163162_10810931 3300013306 Bacteria 1053
176 Ga0157372_10028245 3300013307 Bacteria 6122
177 Ga0157372_10057025 3300013307 Bacteria 4366
178 Ga0157372_10204886 3300013307 Bacteria 2286
179 Ga0157372_10327062 3300013307 Bacteria 1785
180 Ga0157375_10022594 3300013308 Bacteria 5791
181 Ga0157375_10409783 3300013308 Bacteria 1522
182 Ga0163163_10017878 3300014325 Bacteria 6620
183 Ga0163163_10086897 3300014325 Bacteria 3137
184 Ga0157380_10063996 3300014326 Bacteria 2951
185 Ga0157380_10200577 3300014326 Bacteria 1770
186 Ga0157377_10000706 3300014745 Bacteria 13764
187 Ga0157379_10004045 3300014968 Bacteria 12505
188 Ga0157379_10004057 3300014968 Bacteria 12492
189 Ga0157376_10183136 3300014969 Bacteria 1916
190 Ga0182005_1063068 3300015265 Bacteria 1013
191 Ga0197907_10250949 3300020069 Bacteria 5784
192 Ga0206349_1461041 3300020075 Bacteria 2437
193 Ga0206353_10388689 3300020082 Bacteria 1167
194 Ga0213872_10001368 3300021361 Bacteria 16070
195 Ga0213872_10003884 3300021361 Bacteria 8112
196 Ga0213872_10004078 3300021361 Bacteria 7865
197 Ga0213872_10104135 3300021361 Unclassified 1263
198 Ga0213875_10000019 3300021388 Bacteria 231333
199 Ga0213875_10000680 3300021388 Bacteria 26657
200 Ga0213875_10004642 3300021388 Bacteria 7487
201 Ga0213875_10013032 3300021388 Bacteria 4092
202 Ga0213871_10041496 3300021441 Bacteria 1237
203 Ga0224572_1024224 3300024225 Bacteria 1166
204 Ga0228598_1027117 3300024227 Bacteria 1126
205 Ga0207697_10016346 3300025315 Bacteria 3056
206 Ga0207710_10026490 3300025900 Bacteria 2506
207 Ga0207688_10097038 3300025901 Bacteria 1698
208 Ga0207680_10086289 3300025903 Bacteria 1984
209 Ga0207647_10012625 3300025904 Bacteria 5872
210 Ga0207685_10019410 3300025905 Bacteria 2240
211 Ga0207699_10002137 3300025906 Bacteria 9353
212 Ga0207699_10186501 3300025906 Bacteria 1397
213 Ga0207699_10330551 3300025906 Bacteria 1071
214 Ga0207699_10402628 3300025906 Bacteria 975
215 Ga0207645_10000309 3300025907 Bacteria 41038
216 Ga0207643_10002124 3300025908 Bacteria 10904
217 Ga0207705_10045538 3300025909 Bacteria 3152
218 Ga0207684_10061425 3300025910 Bacteria 3191
219 Ga0207654_10012653 3300025911 Unclassified 4328
220 Ga0207654_10087656 3300025911 Bacteria 1889
221 Ga0207654_10164752 3300025911 Bacteria 1435
222 Ga0207707_10001970 3300025912 Bacteria 18645
223 Ga0207707_10020867 3300025912 Bacteria 5722
224 Ga0207707_10158884 3300025912 Bacteria 1976
225 Ga0207707_10446859 3300025912 Unclassified 1106
226 Ga0207695_10157317 3300025913 Bacteria 2207
227 Ga0207695_10184551 3300025913 Bacteria 2005
228 Ga0207695_10277150 3300025913 Bacteria 1571
229 Ga0207695_10582851 3300025913 Bacteria 1000
230 Ga0207671_10082111 3300025914 Bacteria 2418
231 Ga0207671_10168656 3300025914 Bacteria 1699
232 Ga0207693_10000065 3300025915 Bacteria 91476
233 Ga0207693_10000482 3300025915 Bacteria 36147
234 Ga0207693_10042390 3300025915 Bacteria 3582
235 Ga0207693_10092755 3300025915 Bacteria 2366
236 Ga0207693_10175691 3300025915 Bacteria 1685
237 Ga0207663_10002408 3300025916 Bacteria 8980
238 Ga0207663_10075021 3300025916 Bacteria 2193
239 Ga0207663_10271725 3300025916 Bacteria 1256
240 Ga0207663_10300519 3300025916 Bacteria 1199
241 Ga0207660_10000595 3300025917 Bacteria 24399
242 Ga0207660_10475612 3300025917 Bacteria 1012
243 Ga0207662_10006490 3300025918 Bacteria 6318
244 Ga0207657_10003047 3300025919 Bacteria 17923
245 Ga0207652_10001847 3300025921 Bacteria 18374
246 Ga0207652_10155018 3300025921 Bacteria 2052
247 Ga0207652_10257335 3300025921 Bacteria 1574
248 Ga0207681_10135518 3300025923 Bacteria 1827
249 Ga0207681_10176076 3300025923 Bacteria 1625
250 Ga0207694_10003225 3300025924 Bacteria 12998
251 Ga0207650_10000051 3300025925 Bacteria 168652
252 Ga0207650_10000252 3300025925 Bacteria 58117
253 Ga0207659_10009683 3300025926 Bacteria 6026
254 Ga0207687_10040232 3300025927 Bacteria 3204
255 Ga0207687_10113584 3300025927 Bacteria 2015
256 Ga0207687_10261906 3300025927 Bacteria 1379
257 Ga0207687_10433965 3300025927 Bacteria 1086
258 Ga0207700_10000709 3300025928 Bacteria 19278
259 Ga0207700_10025560 3300025928 Bacteria 4103
260 Ga0207700_10058047 3300025928 Bacteria 2921
261 Ga0207664_10000031 3300025929 Bacteria 179373
262 Ga0207664_10037185 3300025929 Bacteria 3765
263 Ga0207664_10392029 3300025929 Bacteria 1234
264 Ga0207664_10566147 3300025929 Bacteria 1020
265 Ga0207644_10050270 3300025931 Bacteria 2987
266 Ga0207690_10015755 3300025932 Bacteria 4587
267 Ga0207686_10212487 3300025934 Bacteria 1392
268 Ga0207670_10018942 3300025936 Bacteria 4195
269 Ga0207669_10185292 3300025937 Bacteria 1496
270 Ga0207704_10197473 3300025938 Bacteria 1469
271 Ga0207665_10025914 3300025939 Bacteria 3868
272 Ga0207665_10122414 3300025939 Bacteria 1839
273 Ga0207691_10000160 3300025940 Bacteria 63013
274 Ga0207711_10023707 3300025941 Bacteria 5138
275 Ga0207689_10017984 3300025942 Bacteria 5968
276 Ga0207661_10289683 3300025944 Bacteria 1465
277 Ga0207679_10000039 3300025945 Bacteria 127661
278 Ga0207679_10249708 3300025945 Bacteria 1507
279 Ga0207667_10023920 3300025949 Bacteria 6720
280 Ga0207667_10600569 3300025949 Bacteria 1110
281 Ga0207668_10012738 3300025972 Bacteria 5157
282 Ga0207640_10087030 3300025981 Bacteria 2153
283 Ga0207658_10021343 3300025986 Bacteria 4494
284 Ga0207677_10040673 3300026023 Bacteria 3067
285 Ga0207677_10275174 3300026023 Bacteria 1379
286 Ga0207639_10095819 3300026041 Unclassified 2386
287 Ga0207639_10224491 3300026041 Bacteria 1624
288 Ga0207702_10019199 3300026078 Bacteria 5654
289 Ga0207702_10048089 3300026078 Bacteria 3597
290 Ga0207702_10267942 3300026078 Bacteria 1610
291 Ga0207702_10514438 3300026078 Bacteria 1168
292 Ga0207641_10000025 3300026088 Bacteria 247727
293 Ga0207648_10001401 3300026089 Bacteria 26517
294 Ga0207648_10005996 3300026089 Bacteria 12144
295 Ga0207648_10424551 3300026089 Bacteria 1208
296 Ga0207676_10000104 3300026095 Bacteria 74872
297 Ga0207674_10004790 3300026116 Bacteria 16215
298 Ga0207675_100011876 3300026118 Bacteria 8139
299 Ga0207675_100342266 3300026118 Bacteria 1464
300 Ga0207683_10000385 3300026121 Bacteria 40789
301 Ga0265356_1006537 3300028017 Bacteria 1360
302 Ga0268266_10003476 3300028379 Bacteria 15707
303 Ga0268266_10443567 3300028379 Bacteria 1233
304 Ga0268265_10066483 3300028380 Bacteria 2787
305 Ga0268264_10422940 3300028381 Bacteria 1285
306 Ga0265338_10001262 3300028800 Bacteria 41722
307 Ga0265338_10058309 3300028800 Bacteria 3409
308 Ga0265338_10063326 3300028800 Bacteria 3225
309 Ga0265338_10156657 3300028800 Bacteria 1763
310 Ga0265762_1000827 3300030760 Bacteria 5504
311 Ga0265760_10016875 3300031090 Bacteria 2096
312 Ga0265760_10106378 3300031090 Bacteria 890
313 Ga0265325_10020075 3300031241 Bacteria 3687
314 Ga0265325_10147850 3300031241 Bacteria 1113
315 Ga0265339_10063678 3300031249 Unclassified 1980
316 Ga0265339_10177553 3300031249 Bacteria 1062
317 Ga0265316_10013766 3300031344 Bacteria 7165
318 Ga0265316_10065278 3300031344 Bacteria 2819
319 Ga0307408_100107305 3300031548 Bacteria 2138
320 Ga0265314_10019915 3300031711 Bacteria 5188
321 Ga0265342_10041920 3300031712 Unclassified 2768
322 Ga0307409_100031101 3300031995 Bacteria 3847
323 Ga0307416_100153564 3300032002 Bacteria 2116
324 Ga0373934_0011540 3300035086 Bacteria 3323
325 Ga0373934_0023365 3300035086 Bacteria 2388
326 Ga0373944_0123122 3300035089 Bacteria 895
327 Ga0373923_0000706 3300035111 Bacteria 8557
328 Ga0373932_0000318 3300035112 Bacteria 14684
329 Ga0373936_0011848 3300035113 Unclassified 3308
330 Ga0373936_0029470 3300035113 Bacteria 2161
331 Ga0373953_0028995 3300035117 Unclassified 2139
332 Ga0373954_0017730 3300035118 Bacteria 3200
333 Ga0373956_0007239 3300035119 Bacteria 4468
334 Ga0373957_0055386 3300035120 Bacteria 1525
335 Ga0373943_0000043 3300035170 Bacteria 42190
336 Ga0373943_0066943 3300035170 Bacteria 1810
337 Ga0373943_0244308 3300035170 Bacteria 1007
338 Ga0373946_0026108 3300035171 Bacteria 2301
339 Ga0373946_0036300 3300035171 Bacteria 1998
340 Ga0373955_0062296 3300035172 Unclassified 2062
341 Ga0373955_0217816 3300035172 Bacteria 1139
342 Ga0373931_0029217 3300035691 Unclassified 2828
343 Ga0373935_0001292 3300035692 Bacteria 13821
344 Ga0373935_0044930 3300035692 Bacteria 2786
345 Ga0373935_0073349 3300035692 Unclassified 2211
346 Ga0373927_0000213 3300035695 Bacteria 46171
347 Ga0373927_0064558 3300035695 Bacteria 2368
348 Ga0373933_0005136 3300035724 Bacteria 7139
349 Ga0373933_0426267 3300035724 Bacteria 867
350 Ga0373947_0010168 3300035725 Bacteria 5402
351 Ga0373947_0023425 3300035725 Bacteria 3591
352 Ga0373937_0013467 3300036401 Bacteria 7204
353 Ga0373937_0268230 3300036401 Bacteria 1611
354 Ga0373937_0460345 3300036401 Bacteria 1208
355 Ga0373937_0880781 3300036401 Bacteria 844
356 Ga0373937_1211295 3300036401 Bacteria 703
357 Ga0373925_0004761 3300037068 Bacteria 10221
358 Ga0373925_0012688 3300037068 Bacteria 6103
359 Ga0373925_0049441 3300037068 Bacteria 3134
360 Ga0373925_0201527 3300037068 Bacteria 1583
361 Ga0395899_0569098 3300037312 Bacteria 726
362 Ga0395900_0428186 3300037418 Bacteria 1283
363 Ga0395898_0079576 3300037466 Bacteria 3162
364 Ga0436364_0197022 3300037853 Bacteria 80312
365 Ga0436364_0366372 3300037853 Bacteria 231753
366 Ga0436364_0404518 3300037853 Bacteria 4936
367 Ga0436364_0977964 3300037853 Bacteria 16438
368 Ga0395901_0424409 3300038443 Bacteria 1363
369 Ga0436365_1607589 3300039437 Bacteria 1119
370 Ga0436365_1731945 3300039437 Bacteria 892
371 Ga0436360_0379337 3300039438 Bacteria 3119
372 Ga0436361_0100788 3300039447 Bacteria 889
373 Ga0436361_0410285 3300039447 Bacteria 24350
374 Ga0436361_0448029 3300039447 Bacteria 31964
375 Ga0436361_0467807 3300039447 Bacteria 1202
376 Ga0436361_0609953 3300039447 Bacteria 952
377 Ga0436361_0659868 3300039447 Bacteria 2196
378 Ga0436361_0772461 3300039447 Bacteria 1649
379 Ga0436361_0819333 3300039447 Bacteria 6760
380 Ga0436361_0868431 3300039447 Bacteria 8018
381 Ga0436361_0965656 3300039447 Bacteria 1070
382 Ga0436363_1403898 3300039450 Bacteria 2715
383 Ga0451577_0544485 3300042876 Bacteria 1054
384 Ga0466963_0004026 3300044694 Bacteria 8498
385 Ga0466964_0113232 3300044706 Bacteria 1213
386 Ga0453684_0531900 3300044712 Bacteria 1297
387 Ga0466967_0005621 3300045976 Bacteria 8720
388 Ga0466967_0157004 3300045976 Bacteria 2132
389 Ga0466967_0385802 3300045976 Bacteria 1361
390 Ga0495590_0101208 3300046457 Bacteria 1024
391 Ga0495629_0027893 3300046459 Bacteria 4011
392 Ga0495651_0141628 3300046462 Bacteria 1743
393 Ga0495653_0522366 3300046463 Bacteria 738
394 Ga0495653_0523262 3300046463 Bacteria 737
395 Ga0495580_0000098 3300046472 Bacteria 57956
396 Ga0495580_0000588 3300046472 Bacteria 30715
397 Ga0495580_0007186 3300046472 Bacteria 8962
398 Ga0495580_0143158 3300046472 Unclassified 1657
399 Ga0495580_0600068 3300046472 Bacteria 728
400 Ga0495582_0004950 3300046473 Bacteria 7465
401 Ga0495582_0140409 3300046473 Bacteria 1369
402 Ga0495582_0341817 3300046473 Unclassified 862
403 Ga0495664_0036711 3300046477 Unclassified 2889
404 Ga0495630_0052623 3300046517 Bacteria 3049
405 Ga0495630_0496063 3300046517 Bacteria 936
406 Ga0495630_0606334 3300046517 Bacteria 839
407 Ga0495665_0019228 3300046531 Bacteria 3672
408 Ga0495665_0032356 3300046531 Bacteria 2798
409 Ga0495665_0194002 3300046531 Bacteria 1054
410 Ga0495586_0125304 3300046535 Bacteria 1437
411 Ga0495667_0398432 3300046559 Bacteria 867
412 Ga0495634_0410196 3300046642 Bacteria 803
413 Ga0495599_0298581 3300046678 Bacteria 973
414 Ga0495623_0222061 3300046679 Bacteria 1076
415 Ga0495623_0225085 3300046679 Bacteria 1067
416 Ga0495646_0210954 3300046680 Bacteria 1054
417 Ga0495658_0006758 3300046683 Bacteria 5644
418 Ga0495658_0049713 3300046683 Unclassified 2369
419 Ga0495669_0248754 3300046684 Bacteria 854
420 Ga0495613_0024513 3300046689 Bacteria 4495
421 Ga0495624_0185047 3300046690 Bacteria 1268
422 Ga0495581_0041461 3300047315 Bacteria 2664
423 Ga0495581_0110950 3300047315 Bacteria 1595
424 Ga0495581_0200979 3300047315 Bacteria 1166
425 Ga0495604_0278710 3300047317 Bacteria 1130
426 Ga0495674_0028855 3300047319 Bacteria 5055
427 Ga0495674_0064013 3300047319 Bacteria 3198
428 Ga0495674_0329659 3300047319 Bacteria 1242
429 Ga0495676_0185838 3300047321 Bacteria 1453
430 Ga0495676_0395882 3300047321 Bacteria 917
431 Ga0495684_0193677 3300047471 Unclassified 1502
432 Ga0495602_0077822 3300048088 Unclassified 2804
433 Ga0495602_0513923 3300048088 Bacteria 835
434 Ga0496100_0342602 3300048903 Bacteria 1127
435 Ga0496100_0478304 3300048903 Bacteria 958
436 Ga0496101_0033289 3300048904 Bacteria 3634
437 Ga0496102_0000641 3300048905 Bacteria 35434
438 Ga0496102_1165527 3300048905 Bacteria 690
439 Ga0496103_0000987 3300048906 Bacteria 20071
440 Ga0496103_0223906 3300048906 Bacteria 1210
441 Ga0496104_0013455 3300048907 Bacteria 7372
442 Ga0496105_0617756 3300048908 Bacteria 840
443 Ga0496106_0255614 3300048909 Bacteria 1401
444 Ga0496108_0153299 3300048911 Bacteria 1989
445 Ga0496109_0000072 3300048912 Bacteria 107549
446 Ga0496109_0300393 3300048912 Bacteria 1514
447 Ga0496110_0002647 3300048913 Bacteria 13498
448 Ga0496112_0000043 3300048915 Bacteria 87684
449 Ga0496112_0186909 3300048915 Bacteria 2035
450 Ga0496112_0217290 3300048915 Bacteria 1868
451 Ga0496112_0680202 3300048915 Bacteria 957
452 Ga0496112_0753693 3300048915 Bacteria 900
453 Ga0496113_0000698 3300048916 Bacteria 17144
454 Ga0496115_0013084 3300048918 Bacteria 6265
455 Ga0496115_0063695 3300048918 Bacteria 2975
456 Ga0496115_0155880 3300048918 Bacteria 1887
457 Ga0501031_0109166 3300049568 Bacteria 1807
458 Ga0501036_0033207 3300049572 Bacteria 4364
459 Ga0501039_0178506 3300049575 Bacteria 1670
460 Ga0501040_0070743 3300049576 Bacteria 2408
461 Ga0501042_0055114 3300049578 Bacteria 2836
462 Ga0501043_0376565 3300049579 Bacteria 1075
463 Ga0501048_0501405 3300049582 Bacteria 870
464 Ga0501068_0154228 3300049584 Bacteria 1445
465 Ga0501071_0000584 3300049587 Bacteria 18891
466 Ga0501072_0228570 3300049588 Bacteria 1482
467 Ga0501075_0042834 3300049591 Bacteria 3395
468 Ga0501076_0005793 3300049592 Bacteria 8914
469 Ga0501076_0422170 3300049592 Bacteria 1097
470 Ga0501077_0005097 3300049593 Bacteria 7975
471 Ga0501079_0037207 3300049741 Bacteria 3750
472 Ga0501080_0125306 3300049742 Bacteria 2379
473 nmdc:mga05p37_5417_c1 3300050507 Bacteria 14996
474 nmdc:mga09592_82694_c1 3300050508 Bacteria 2736
475 nmdc:mga0n895_28278_c1 3300050512 Bacteria 5333
476 nmdc:mga08x19_666442_c1 3300050514 Bacteria 738
477 nmdc:mga0a205_655287_c1 3300050515 Bacteria 901
478 Ga0495601_0467627 3300053077 Bacteria 815
479 Ga0495612_0145962 3300053078 Bacteria 1028
480 Ga0495619_0560785 3300053085 Bacteria 783
481 Ga0501084_0304547 3300054114 Bacteria 1346
482 Ga0587073_0000141 3300059492 Bacteria 4991
483 Ga0587077_003310 3300059493 Bacteria 2014
484 Ga0587083_0002504 3300059505 Bacteria 2303
485 Ga0587076_005858 3300059645 Bacteria 1611
486 Ga0530510_0079883 3300061734 Bacteria 2379

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0036711 Ga0495664_0036711_25_609 194
2 3300036401 Ga0373937_1211295 Ga0373937_1211295_43_687 201
3 3300044712 Ga0453684_0531900 Ga0453684_0531900_17_622 201
4 3300005434 Ga0070709_10009194 Ga0070709_100091946 203
5 3300005436 Ga0070713_100004614 Ga0070713_10000461411 203
6 3300025906 Ga0207699_10186501 Ga0207699_101865011 203
7 3300037312 Ga0395899_0569098 Ga0395899_0569098_29_649 203
8 3300048905 Ga0496102_1165527 Ga0496102_1165527_68_679 203
9 3300047315 Ga0495581_0041461 Ga0495581_0041461_1072_1761 205
10 3300028800 Ga0265338_10058309 Ga0265338_100583092 209
11 3300031090 Ga0265760_10106378 Ga0265760_101063782 210
12 3300059492 Ga0587073_0000141 Ga0587073_0000141_1375_2064 210
13 3300059493 Ga0587077_003310 Ga0587077_003310_878_1567 210
14 3300059505 Ga0587083_0002504 Ga0587083_0002504_1123_1812 210
15 3300059645 Ga0587076_005858 Ga0587076_005858_673_1362 210
16 3300045976 Ga0466967_0385802 Ga0466967_0385802_588_1271 213
17 3300046463 Ga0495653_0522366 Ga0495653_0522366_78_722 214
18 3300046517 Ga0495630_0606334 Ga0495630_0606334_24_710 214
19 3300047471 Ga0495684_0193677 Ga0495684_0193677_17_661 214
20 3300053077 Ga0495601_0467627 Ga0495601_0467627_17_661 214
21 3300014326 Ga0157380_10200577 Ga0157380_102005772 215
22 3300048918 Ga0496115_0155880 Ga0496115_0155880_430_1173 215
23 3300005615 Ga0070702_100026934 Ga0070702_1000269343 216
24 3300021388 Ga0213875_10000680 Ga0213875_1000068017 216
25 3300037853 Ga0436364_0197022 Ga0436364_0197022_61852_62511 216
26 3300009176 Ga0105242_10309115 Ga0105242_103091153 218
27 3300021361 Ga0213872_10001368 Ga0213872_100013688 218
28 3300025949 Ga0207667_10600569 Ga0207667_106005691 218
29 3300035170 Ga0373943_0066943 Ga0373943_0066943_530_1201 218
30 3300035171 Ga0373946_0036300 Ga0373946_0036300_594_1265 218
31 3300035692 Ga0373935_0044930 Ga0373935_0044930_251_922 218
32 3300035725 Ga0373947_0023425 Ga0373947_0023425_552_1223 218
33 3300036401 Ga0373937_0880781 Ga0373937_0880781_107_778 218
34 3300039447 Ga0436361_0448029 Ga0436361_0448029_22187_22846 218
35 3300046472 Ga0495580_0143158 Ga0495580_0143158_735_1406 218
36 3300046559 Ga0495667_0398432 Ga0495667_0398432_174_845 218
37 3300046683 Ga0495658_0049713 Ga0495658_0049713_1427_2098 218
38 3300047315 Ga0495581_0200979 Ga0495581_0200979_344_1015 218
39 3300049572 Ga0501036_0033207 Ga0501036_0033207_1890_2552 218
40 3300049576 Ga0501040_0070743 Ga0501040_0070743_19_681 218
41 3300053078 Ga0495612_0145962 Ga0495612_0145962_339_1010 218
42 3300021388 Ga0213875_10013032 Ga0213875_100130323 219
43 3300037853 Ga0436364_0404518 Ga0436364_0404518_2574_3236 219
44 3300005329 Ga0070683_100165163 Ga0070683_1001651633 220
45 3300005338 Ga0068868_100142702 Ga0068868_1001427021 220
46 3300005535 Ga0070684_100136180 Ga0070684_1001361802 220
47 3300005548 Ga0070665_100177625 Ga0070665_1001776253 220
48 3300005564 Ga0070664_100128474 Ga0070664_1001284743 220
49 3300005577 Ga0068857_100013148 Ga0068857_1000131484 220
50 3300005718 Ga0068866_10024479 Ga0068866_100244793 220
51 3300006358 Ga0068871_100116164 Ga0068871_1001161642 220
52 3300009093 Ga0105240_10748393 Ga0105240_107483932 220
53 3300009098 Ga0105245_10151167 Ga0105245_101511673 220
54 3300009174 Ga0105241_10256605 Ga0105241_102566053 220
55 3300009176 Ga0105242_10144231 Ga0105242_101442313 220
56 3300009176 Ga0105242_10147246 Ga0105242_101472463 220
57 3300009177 Ga0105248_10097193 Ga0105248_100971931 220
58 3300010375 Ga0105239_10455330 Ga0105239_104553302 220
59 3300011119 Ga0105246_10023078 Ga0105246_100230783 220
60 3300013104 Ga0157370_10616217 Ga0157370_106162171 220
61 3300013296 Ga0157374_10195571 Ga0157374_101955712 220
62 3300013306 Ga0163162_10810931 Ga0163162_108109311 220
63 3300013308 Ga0157375_10409783 Ga0157375_104097832 220
64 3300014325 Ga0163163_10086897 Ga0163163_100868972 220
65 3300014969 Ga0157376_10183136 Ga0157376_101831362 220
66 3300021388 Ga0213875_10000019 Ga0213875_1000001940 220
67 3300025911 Ga0207654_10164752 Ga0207654_101647522 220
68 3300025912 Ga0207707_10020867 Ga0207707_100208676 220
69 3300025914 Ga0207671_10082111 Ga0207671_100821113 220
70 3300025924 Ga0207694_10003225 Ga0207694_100032252 220
71 3300025927 Ga0207687_10261906 Ga0207687_102619063 220
72 3300025934 Ga0207686_10212487 Ga0207686_102124872 220
73 3300025938 Ga0207704_10197473 Ga0207704_101974732 220
74 3300025945 Ga0207679_10249708 Ga0207679_102497082 220
75 3300026023 Ga0207677_10040673 Ga0207677_100406733 220
76 3300026041 Ga0207639_10224491 Ga0207639_102244912 220
77 3300026089 Ga0207648_10005996 Ga0207648_100059966 220
78 3300028379 Ga0268266_10443567 Ga0268266_104435672 220
79 3300037853 Ga0436364_0366372 Ga0436364_0366372_187476_188147 220
80 3300039447 Ga0436361_0609953 Ga0436361_0609953_65_730 220
81 3300039450 Ga0436363_1403898 Ga0436363_1403898_1596_2264 220
82 3300005563 Ga0068855_100268608 Ga0068855_1002686082 221
83 3300005614 Ga0068856_100343267 Ga0068856_1003432671 221
84 3300005718 Ga0068866_10283551 Ga0068866_102835512 221
85 3300009093 Ga0105240_10215288 Ga0105240_102152883 221
86 3300009147 Ga0114129_10004476 Ga0114129_1000447621 221
87 3300009545 Ga0105237_10414022 Ga0105237_104140223 221
88 3300013104 Ga0157370_10268002 Ga0157370_102680022 221
89 3300013105 Ga0157369_10139984 Ga0157369_101399843 221
90 3300025913 Ga0207695_10157317 Ga0207695_101573173 221
91 3300026089 Ga0207648_10424551 Ga0207648_104245513 221
92 3300039437 Ga0436365_1607589 Ga0436365_1607589_20_688 221
93 3300046679 Ga0495623_0225085 Ga0495623_0225085_102_776 221
94 3300050507 nmdc:mga05p37_5417_c1 nmdc:mga05p37_5417_c1_5783_6448 221
95 3300050508 nmdc:mga09592_82694_c1 nmdc:mga09592_82694_c1_1338_2003 221
96 3300050512 nmdc:mga0n895_28278_c1 nmdc:mga0n895_28278_c1_3953_4618 221
97 3300050514 nmdc:mga08x19_666442_c1 nmdc:mga08x19_666442_c1_60_725 221
98 3300050515 nmdc:mga0a205_655287_c1 nmdc:mga0a205_655287_c1_35_700 221
99 3300005614 Ga0068856_100107317 Ga0068856_1001073174 222
100 3300006028 Ga0070717_10133567 Ga0070717_101335672 222
101 3300026078 Ga0207702_10267942 Ga0207702_102679422 222
102 3300021361 Ga0213872_10004078 Ga0213872_100040786 223
103 3300039447 Ga0436361_0410285 Ga0436361_0410285_10973_11647 223
104 3300005329 Ga0070683_100125751 Ga0070683_1001257511 224
105 3300005336 Ga0070680_100394310 Ga0070680_1003943102 224
106 3300005437 Ga0070710_10043828 Ga0070710_100438284 224
107 3300005439 Ga0070711_100020276 Ga0070711_1000202765 224
108 3300005458 Ga0070681_10076227 Ga0070681_100762273 224
109 3300005535 Ga0070684_100482515 Ga0070684_1004825152 224
110 3300009093 Ga0105240_10682801 Ga0105240_106828012 224
111 3300009177 Ga0105248_11345999 Ga0105248_113459992 224
112 3300013102 Ga0157371_10282864 Ga0157371_102828641 224
113 3300013105 Ga0157369_10104277 Ga0157369_101042772 224
114 3300020069 Ga0197907_10250949 Ga0197907_102509495 224
115 3300025921 Ga0207652_10155018 Ga0207652_101550183 224
116 3300025929 Ga0207664_10566147 Ga0207664_105661472 224
117 3300025944 Ga0207661_10289683 Ga0207661_102896832 224
118 3300036401 Ga0373937_0460345 Ga0373937_0460345_304_993 224
119 3300037418 Ga0395900_0428186 Ga0395900_0428186_246_923 224
120 3300039447 Ga0436361_0100788 Ga0436361_0100788_59_736 224
121 3300039447 Ga0436361_0467807 Ga0436361_0467807_328_1005 224
122 3300039447 Ga0436361_0659868 Ga0436361_0659868_26_703 224
123 3300039447 Ga0436361_0965656 Ga0436361_0965656_59_736 224
124 3300048911 Ga0496108_0153299 Ga0496108_0153299_549_1226 224
125 3300048912 Ga0496109_0300393 Ga0496109_0300393_613_1326 224
126 3300053085 Ga0495619_0560785 Ga0495619_0560785_39_749 224
127 3300004799 Ga0058863_11829770 Ga0058863_118297705 225
128 3300004803 Ga0058862_12048676 Ga0058862_120486765 225
129 3300005336 Ga0070680_100013125 Ga0070680_1000131255 225
130 3300005336 Ga0070680_100705011 Ga0070680_1007050111 225
131 3300005337 Ga0070682_100194196 Ga0070682_1001941962 225
132 3300005434 Ga0070709_10003886 Ga0070709_100038861 225
133 3300005434 Ga0070709_10022669 Ga0070709_100226692 225
134 3300005434 Ga0070709_10047969 Ga0070709_100479693 225
135 3300005434 Ga0070709_10320622 Ga0070709_103206222 225
136 3300005435 Ga0070714_100000312 Ga0070714_10000031223 225
137 3300005435 Ga0070714_100087027 Ga0070714_1000870272 225
138 3300005435 Ga0070714_100209702 Ga0070714_1002097022 225
139 3300005436 Ga0070713_100000461 Ga0070713_1000004616 225
140 3300005436 Ga0070713_100000811 Ga0070713_10000081114 225
141 3300005436 Ga0070713_100005052 Ga0070713_1000050524 225
142 3300005436 Ga0070713_100016950 Ga0070713_1000169504 225
143 3300005437 Ga0070710_10333522 Ga0070710_103335222 225
144 3300005439 Ga0070711_100316189 Ga0070711_1003161892 225
145 3300005458 Ga0070681_10004280 Ga0070681_100042805 225
146 3300005458 Ga0070681_10053259 Ga0070681_100532595 225
147 3300005458 Ga0070681_10189200 Ga0070681_101892003 225
148 3300005467 Ga0070706_100038376 Ga0070706_1000383761 225
149 3300005471 Ga0070698_100170272 Ga0070698_1001702723 225
150 3300005530 Ga0070679_100001261 Ga0070679_10000126113 225
151 3300005530 Ga0070679_100064046 Ga0070679_1000640463 225
152 3300005530 Ga0070679_100274184 Ga0070679_1002741842 225
153 3300005545 Ga0070695_100167310 Ga0070695_1001673103 225
154 3300005614 Ga0068856_100045456 Ga0068856_1000454564 225
155 3300005614 Ga0068856_100109303 Ga0068856_1001093032 225
156 3300005614 Ga0068856_100814014 Ga0068856_1008140142 225
157 3300005616 Ga0068852_100120749 Ga0068852_1001207493 225
158 3300006028 Ga0070717_10019257 Ga0070717_100192573 225
159 3300006028 Ga0070717_10072816 Ga0070717_100728162 225
160 3300006028 Ga0070717_10110366 Ga0070717_101103662 225
161 3300006028 Ga0070717_10321716 Ga0070717_103217162 225
162 3300006028 Ga0070717_10496420 Ga0070717_104964202 225
163 3300006173 Ga0070716_100002017 Ga0070716_1000020172 225
164 3300006173 Ga0070716_100008029 Ga0070716_1000080294 225
165 3300006173 Ga0070716_100158978 Ga0070716_1001589782 225
166 3300006175 Ga0070712_100000859 Ga0070712_10000085910 225
167 3300006175 Ga0070712_100031707 Ga0070712_1000317073 225
168 3300006237 Ga0097621_100187381 Ga0097621_1001873812 225
169 3300006358 Ga0068871_100072006 Ga0068871_1000720063 225
170 3300009545 Ga0105237_10706141 Ga0105237_107061412 225
171 3300013100 Ga0157373_10016567 Ga0157373_100165673 225
172 3300013104 Ga0157370_10029765 Ga0157370_100297653 225
173 3300013104 Ga0157370_10072712 Ga0157370_100727123 225
174 3300013104 Ga0157370_10313307 Ga0157370_103133072 225
175 3300013105 Ga0157369_10035063 Ga0157369_100350636 225
176 3300013105 Ga0157369_10392075 Ga0157369_103920751 225
177 3300013296 Ga0157374_10125007 Ga0157374_101250072 225
178 3300013307 Ga0157372_10028245 Ga0157372_100282453 225
179 3300013307 Ga0157372_10204886 Ga0157372_102048863 225
180 3300013307 Ga0157372_10327062 Ga0157372_103270623 225
181 3300015265 Ga0182005_1063068 Ga0182005_10630682 225
182 3300020075 Ga0206349_1461041 Ga0206349_14610413 225
183 3300020082 Ga0206353_10388689 Ga0206353_103886893 225
184 3300025905 Ga0207685_10019410 Ga0207685_100194103 225
185 3300025906 Ga0207699_10002137 Ga0207699_100021374 225
186 3300025906 Ga0207699_10330551 Ga0207699_103305512 225
187 3300025906 Ga0207699_10402628 Ga0207699_104026282 225
188 3300025910 Ga0207684_10061425 Ga0207684_100614251 225
189 3300025911 Ga0207654_10012653 Ga0207654_100126532 225
190 3300025912 Ga0207707_10001970 Ga0207707_100019707 225
191 3300025912 Ga0207707_10158884 Ga0207707_101588843 225
192 3300025915 Ga0207693_10000065 Ga0207693_1000006570 225
193 3300025915 Ga0207693_10000482 Ga0207693_1000048218 225
194 3300025915 Ga0207693_10042390 Ga0207693_100423903 225
195 3300025915 Ga0207693_10175691 Ga0207693_101756913 225
196 3300025916 Ga0207663_10002408 Ga0207663_100024083 225
197 3300025916 Ga0207663_10075021 Ga0207663_100750212 225
198 3300025916 Ga0207663_10271725 Ga0207663_102717252 225
199 3300025916 Ga0207663_10300519 Ga0207663_103005192 225
200 3300025917 Ga0207660_10000595 Ga0207660_1000059512 225
201 3300025921 Ga0207652_10001847 Ga0207652_1000184713 225
202 3300025928 Ga0207700_10000709 Ga0207700_100007098 225
203 3300025928 Ga0207700_10025560 Ga0207700_100255603 225
204 3300025928 Ga0207700_10058047 Ga0207700_100580473 225
205 3300025929 Ga0207664_10000031 Ga0207664_1000003118 225
206 3300025929 Ga0207664_10037185 Ga0207664_100371853 225
207 3300025929 Ga0207664_10392029 Ga0207664_103920293 225
208 3300025939 Ga0207665_10025914 Ga0207665_100259143 225
209 3300025981 Ga0207640_10087030 Ga0207640_100870304 225
210 3300026041 Ga0207639_10095819 Ga0207639_100958193 225
211 3300026078 Ga0207702_10019199 Ga0207702_100191993 225
212 3300026078 Ga0207702_10514438 Ga0207702_105144382 225
213 3300028800 Ga0265338_10001262 Ga0265338_1000126218 225
214 3300028800 Ga0265338_10063326 Ga0265338_100633262 225
215 3300028800 Ga0265338_10156657 Ga0265338_101566572 225
216 3300031241 Ga0265325_10020075 Ga0265325_100200754 225
217 3300031241 Ga0265325_10147850 Ga0265325_101478502 225
218 3300031249 Ga0265339_10063678 Ga0265339_100636783 225
219 3300031249 Ga0265339_10177553 Ga0265339_101775532 225
220 3300031344 Ga0265316_10013766 Ga0265316_100137662 225
221 3300031344 Ga0265316_10065278 Ga0265316_100652783 225
222 3300031711 Ga0265314_10019915 Ga0265314_100199154 225
223 3300031712 Ga0265342_10041920 Ga0265342_100419202 225
224 3300035086 Ga0373934_0011540 Ga0373934_0011540_2237_2917 225
225 3300035086 Ga0373934_0023365 Ga0373934_0023365_556_1236 225
226 3300035089 Ga0373944_0123122 Ga0373944_0123122_159_839 225
227 3300035111 Ga0373923_0000706 Ga0373923_0000706_5809_6489 225
228 3300035113 Ga0373936_0011848 Ga0373936_0011848_1503_2183 225
229 3300035113 Ga0373936_0029470 Ga0373936_0029470_1028_1708 225
230 3300035117 Ga0373953_0028995 Ga0373953_0028995_78_758 225
231 3300035118 Ga0373954_0017730 Ga0373954_0017730_2145_2825 225
232 3300035119 Ga0373956_0007239 Ga0373956_0007239_3378_4058 225
233 3300035120 Ga0373957_0055386 Ga0373957_0055386_319_999 225
234 3300035170 Ga0373943_0000043 Ga0373943_0000043_19230_19910 225
235 3300035170 Ga0373943_0244308 Ga0373943_0244308_181_861 225
236 3300035171 Ga0373946_0026108 Ga0373946_0026108_87_767 225
237 3300035172 Ga0373955_0062296 Ga0373955_0062296_1187_1867 225
238 3300035172 Ga0373955_0217816 Ga0373955_0217816_68_748 225
239 3300035692 Ga0373935_0001292 Ga0373935_0001292_157_837 225
240 3300035692 Ga0373935_0073349 Ga0373935_0073349_348_1028 225
241 3300035695 Ga0373927_0000213 Ga0373927_0000213_13224_13904 225
242 3300035724 Ga0373933_0005136 Ga0373933_0005136_5290_5970 225
243 3300035724 Ga0373933_0426267 Ga0373933_0426267_165_845 225
244 3300035725 Ga0373947_0010168 Ga0373947_0010168_1693_2373 225
245 3300036401 Ga0373937_0013467 Ga0373937_0013467_6284_6964 225
246 3300037068 Ga0373925_0004761 Ga0373925_0004761_3039_3719 225
247 3300037068 Ga0373925_0012688 Ga0373925_0012688_282_962 225
248 3300037068 Ga0373925_0201527 Ga0373925_0201527_792_1472 225
249 3300037466 Ga0395898_0079576 Ga0395898_0079576_741_1430 225
250 3300037853 Ga0436364_0977964 Ga0436364_0977964_12711_13400 225
251 3300038443 Ga0395901_0424409 Ga0395901_0424409_57_746 225
252 3300039437 Ga0436365_1731945 Ga0436365_1731945_172_867 225
253 3300044694 Ga0466963_0004026 Ga0466963_0004026_870_1559 225
254 3300044706 Ga0466964_0113232 Ga0466964_0113232_338_1018 225
255 3300045976 Ga0466967_0005621 Ga0466967_0005621_7168_7857 225
256 3300046457 Ga0495590_0101208 Ga0495590_0101208_119_799 225
257 3300046459 Ga0495629_0027893 Ga0495629_0027893_1464_2144 225
258 3300046462 Ga0495651_0141628 Ga0495651_0141628_473_1153 225
259 3300046463 Ga0495653_0523262 Ga0495653_0523262_22_702 225
260 3300046472 Ga0495580_0000098 Ga0495580_0000098_25646_26326 225
261 3300046472 Ga0495580_0007186 Ga0495580_0007186_6794_7474 225
262 3300046472 Ga0495580_0600068 Ga0495580_0600068_22_702 225
263 3300046473 Ga0495582_0004950 Ga0495582_0004950_3544_4224 225
264 3300046473 Ga0495582_0341817 Ga0495582_0341817_88_768 225
265 3300046517 Ga0495630_0052623 Ga0495630_0052623_1735_2415 225
266 3300046517 Ga0495630_0496063 Ga0495630_0496063_58_738 225
267 3300046531 Ga0495665_0032356 Ga0495665_0032356_1957_2637 225
268 3300046531 Ga0495665_0194002 Ga0495665_0194002_308_988 225
269 3300046535 Ga0495586_0125304 Ga0495586_0125304_361_1041 225
270 3300046642 Ga0495634_0410196 Ga0495634_0410196_81_761 225
271 3300046678 Ga0495599_0298581 Ga0495599_0298581_207_887 225
272 3300046679 Ga0495623_0222061 Ga0495623_0222061_146_826 225
273 3300046683 Ga0495658_0006758 Ga0495658_0006758_2671_3351 225
274 3300046689 Ga0495613_0024513 Ga0495613_0024513_2126_2806 225
275 3300046690 Ga0495624_0185047 Ga0495624_0185047_132_812 225
276 3300047315 Ga0495581_0110950 Ga0495581_0110950_466_1146 225
277 3300047317 Ga0495604_0278710 Ga0495604_0278710_329_1009 225
278 3300047319 Ga0495674_0028855 Ga0495674_0028855_3744_4424 225
279 3300047319 Ga0495674_0064013 Ga0495674_0064013_898_1578 225
280 3300047319 Ga0495674_0329659 Ga0495674_0329659_171_851 225
281 3300047321 Ga0495676_0185838 Ga0495676_0185838_592_1272 225
282 3300047321 Ga0495676_0395882 Ga0495676_0395882_40_720 225
283 3300048088 Ga0495602_0077822 Ga0495602_0077822_1080_1760 225
284 3300048088 Ga0495602_0513923 Ga0495602_0513923_100_780 225
285 3300048903 Ga0496100_0478304 Ga0496100_0478304_13_693 225
286 3300048908 Ga0496105_0617756 Ga0496105_0617756_104_802 225
287 3300048915 Ga0496112_0186909 Ga0496112_0186909_92_790 225
288 3300048915 Ga0496112_0753693 Ga0496112_0753693_144_824 225
289 3300048918 Ga0496115_0013084 Ga0496115_0013084_5203_5883 225
290 3300001976 JGI24752J21851_1001152 JGI24752J21851_10011525 226
291 3300001978 JGI24747J21853_1003561 JGI24747J21853_10035613 226
292 3300001991 JGI24743J22301_10003913 JGI24743J22301_100039133 226
293 3300002074 JGI24748J21848_1021423 JGI24748J21848_10214231 226
294 3300002239 JGI24034J26672_10003386 JGI24034J26672_100033863 226
295 3300002459 JGI24751J29686_10003121 JGI24751J29686_100031213 226
296 3300005289 Ga0065704_10030224 Ga0065704_100302241 226
297 3300005327 Ga0070658_10060388 Ga0070658_100603885 226
298 3300005328 Ga0070676_10020143 Ga0070676_100201431 226
299 3300005329 Ga0070683_100937459 Ga0070683_1009374591 226
300 3300005330 Ga0070690_100005406 Ga0070690_1000054064 226
301 3300005334 Ga0068869_100002075 Ga0068869_10000207510 226
302 3300005334 Ga0068869_100094684 Ga0068869_1000946842 226
303 3300005335 Ga0070666_10014527 Ga0070666_100145273 226
304 3300005336 Ga0070680_100146821 Ga0070680_1001468212 226
305 3300005337 Ga0070682_100384599 Ga0070682_1003845991 226
306 3300005338 Ga0068868_100034353 Ga0068868_1000343531 226
307 3300005339 Ga0070660_100002323 Ga0070660_10000232315 226
308 3300005340 Ga0070689_100010155 Ga0070689_1000101556 226
309 3300005343 Ga0070687_100026799 Ga0070687_1000267995 226
310 3300005345 Ga0070692_10095664 Ga0070692_100956641 226
311 3300005347 Ga0070668_100026756 Ga0070668_1000267566 226
312 3300005353 Ga0070669_100007907 Ga0070669_1000079073 226
313 3300005354 Ga0070675_100027978 Ga0070675_1000279786 226
314 3300005356 Ga0070674_100141445 Ga0070674_1001414452 226
315 3300005364 Ga0070673_100087014 Ga0070673_1000870144 226
316 3300005365 Ga0070688_100003715 Ga0070688_1000037156 226
317 3300005366 Ga0070659_100021584 Ga0070659_1000215842 226
318 3300005367 Ga0070667_100027044 Ga0070667_1000270443 226
319 3300005438 Ga0070701_10067483 Ga0070701_100674834 226
320 3300005455 Ga0070663_100032360 Ga0070663_1000323604 226
321 3300005456 Ga0070678_100056302 Ga0070678_1000563022 226
322 3300005457 Ga0070662_100003918 Ga0070662_1000039183 226
323 3300005458 Ga0070681_10033476 Ga0070681_100334763 226
324 3300005458 Ga0070681_10114708 Ga0070681_101147082 226
325 3300005459 Ga0068867_100157216 Ga0068867_1001572164 226
326 3300005466 Ga0070685_10005907 Ga0070685_100059073 226
327 3300005535 Ga0070684_100001340 Ga0070684_1000013406 226
328 3300005539 Ga0068853_100020779 Ga0068853_1000207795 226
329 3300005543 Ga0070672_100009518 Ga0070672_1000095186 226
330 3300005544 Ga0070686_100005016 Ga0070686_1000050163 226
331 3300005546 Ga0070696_100014118 Ga0070696_1000141186 226
332 3300005549 Ga0070704_100211167 Ga0070704_1002111673 226
333 3300005563 Ga0068855_100032862 Ga0068855_1000328625 226
334 3300005563 Ga0068855_100210920 Ga0068855_1002109203 226
335 3300005564 Ga0070664_100106939 Ga0070664_1001069391 226
336 3300005577 Ga0068857_100030940 Ga0068857_1000309406 226
337 3300005614 Ga0068856_100039461 Ga0068856_1000394611 226
338 3300005616 Ga0068852_100015942 Ga0068852_1000159427 226
339 3300005618 Ga0068864_100004944 Ga0068864_1000049444 226
340 3300005718 Ga0068866_10023518 Ga0068866_100235185 226
341 3300005840 Ga0068870_10009045 Ga0068870_100090455 226
342 3300005842 Ga0068858_100005966 Ga0068858_1000059664 226
343 3300005844 Ga0068862_100012300 Ga0068862_1000123005 226
344 3300006028 Ga0070717_10761921 Ga0070717_107619211 226
345 3300006237 Ga0097621_100002292 Ga0097621_1000022929 226
346 3300006358 Ga0068871_100037564 Ga0068871_1000375645 226
347 3300006358 Ga0068871_100525612 Ga0068871_1005256122 226
348 3300006844 Ga0075428_100042995 Ga0075428_1000429954 226
349 3300006847 Ga0075431_100138914 Ga0075431_1001389143 226
350 3300006852 Ga0075433_10950833 Ga0075433_109508331 226
351 3300006871 Ga0075434_100683074 Ga0075434_1006830742 226
352 3300006881 Ga0068865_100020424 Ga0068865_1000204242 226
353 3300009093 Ga0105240_10359704 Ga0105240_103597041 226
354 3300009093 Ga0105240_10458253 Ga0105240_104582531 226
355 3300009098 Ga0105245_10039878 Ga0105245_100398784 226
356 3300009098 Ga0105245_10286366 Ga0105245_102863662 226
357 3300009101 Ga0105247_10017015 Ga0105247_100170151 226
358 3300009174 Ga0105241_10013112 Ga0105241_100131126 226
359 3300009174 Ga0105241_10020850 Ga0105241_100208503 226
360 3300009545 Ga0105237_10046404 Ga0105237_100464046 226
361 3300009545 Ga0105237_10170269 Ga0105237_101702692 226
362 3300009553 Ga0105249_10041248 Ga0105249_100412484 226
363 3300010375 Ga0105239_10026459 Ga0105239_100264595 226
364 3300011119 Ga0105246_10003641 Ga0105246_100036415 226
365 3300013100 Ga0157373_10002403 Ga0157373_1000240315 226
366 3300013105 Ga0157369_10052447 Ga0157369_100524476 226
367 3300013296 Ga0157374_10004409 Ga0157374_1000440912 226
368 3300013297 Ga0157378_10001316 Ga0157378_1000131619 226
369 3300013297 Ga0157378_10368122 Ga0157378_103681221 226
370 3300013306 Ga0163162_10047635 Ga0163162_100476356 226
371 3300013307 Ga0157372_10057025 Ga0157372_100570254 226
372 3300013308 Ga0157375_10022594 Ga0157375_100225945 226
373 3300014325 Ga0163163_10017878 Ga0163163_100178786 226
374 3300014326 Ga0157380_10063996 Ga0157380_100639961 226
375 3300014745 Ga0157377_10000706 Ga0157377_100007066 226
376 3300014968 Ga0157379_10004045 Ga0157379_1000404510 226
377 3300014968 Ga0157379_10004057 Ga0157379_100040575 226
378 3300021361 Ga0213872_10003884 Ga0213872_100038847 226
379 3300021361 Ga0213872_10104135 Ga0213872_101041352 226
380 3300021388 Ga0213875_10004642 Ga0213875_100046426 226
381 3300021441 Ga0213871_10041496 Ga0213871_100414962 226
382 3300024225 Ga0224572_1024224 Ga0224572_10242242 226
383 3300024227 Ga0228598_1027117 Ga0228598_10271172 226
384 3300025315 Ga0207697_10016346 Ga0207697_100163462 226
385 3300025900 Ga0207710_10026490 Ga0207710_100264902 226
386 3300025901 Ga0207688_10097038 Ga0207688_100970384 226
387 3300025903 Ga0207680_10086289 Ga0207680_100862891 226
388 3300025904 Ga0207647_10012625 Ga0207647_100126256 226
389 3300025907 Ga0207645_10000309 Ga0207645_1000030940 226
390 3300025908 Ga0207643_10002124 Ga0207643_100021243 226
391 3300025909 Ga0207705_10045538 Ga0207705_100455385 226
392 3300025911 Ga0207654_10087656 Ga0207654_100876562 226
393 3300025912 Ga0207707_10446859 Ga0207707_104468592 226
394 3300025913 Ga0207695_10184551 Ga0207695_101845512 226
395 3300025913 Ga0207695_10277150 Ga0207695_102771502 226
396 3300025913 Ga0207695_10582851 Ga0207695_105828512 226
397 3300025914 Ga0207671_10168656 Ga0207671_101686561 226
398 3300025915 Ga0207693_10092755 Ga0207693_100927552 226
399 3300025917 Ga0207660_10475612 Ga0207660_104756121 226
400 3300025918 Ga0207662_10006490 Ga0207662_100064904 226
401 3300025919 Ga0207657_10003047 Ga0207657_1000304721 226
402 3300025921 Ga0207652_10257335 Ga0207652_102573352 226
403 3300025923 Ga0207681_10135518 Ga0207681_101355183 226
404 3300025923 Ga0207681_10176076 Ga0207681_101760761 226
405 3300025925 Ga0207650_10000051 Ga0207650_1000005174 226
406 3300025925 Ga0207650_10000252 Ga0207650_1000025216 226
407 3300025926 Ga0207659_10009683 Ga0207659_100096834 226
408 3300025927 Ga0207687_10040232 Ga0207687_100402325 226
409 3300025927 Ga0207687_10113584 Ga0207687_101135842 226
410 3300025927 Ga0207687_10433965 Ga0207687_104339652 226
411 3300025931 Ga0207644_10050270 Ga0207644_100502705 226
412 3300025932 Ga0207690_10015755 Ga0207690_100157555 226
413 3300025936 Ga0207670_10018942 Ga0207670_100189422 226
414 3300025937 Ga0207669_10185292 Ga0207669_101852922 226
415 3300025939 Ga0207665_10122414 Ga0207665_101224142 226
416 3300025940 Ga0207691_10000160 Ga0207691_1000016039 226
417 3300025941 Ga0207711_10023707 Ga0207711_100237076 226
418 3300025942 Ga0207689_10017984 Ga0207689_100179843 226
419 3300025945 Ga0207679_10000039 Ga0207679_1000003988 226
420 3300025949 Ga0207667_10023920 Ga0207667_100239205 226
421 3300025972 Ga0207668_10012738 Ga0207668_100127386 226
422 3300025986 Ga0207658_10021343 Ga0207658_100213436 226
423 3300026023 Ga0207677_10275174 Ga0207677_102751742 226
424 3300026078 Ga0207702_10048089 Ga0207702_100480891 226
425 3300026088 Ga0207641_10000025 Ga0207641_10000025147 226
426 3300026089 Ga0207648_10001401 Ga0207648_100014011 226
427 3300026095 Ga0207676_10000104 Ga0207676_1000010456 226
428 3300026116 Ga0207674_10004790 Ga0207674_100047908 226
429 3300026118 Ga0207675_100011876 Ga0207675_1000118763 226
430 3300026118 Ga0207675_100342266 Ga0207675_1003422662 226
431 3300026121 Ga0207683_10000385 Ga0207683_1000038531 226
432 3300028017 Ga0265356_1006537 Ga0265356_10065372 226
433 3300028379 Ga0268266_10003476 Ga0268266_1000347611 226
434 3300028380 Ga0268265_10066483 Ga0268265_100664833 226
435 3300028381 Ga0268264_10422940 Ga0268264_104229401 226
436 3300030760 Ga0265762_1000827 Ga0265762_10008276 226
437 3300031090 Ga0265760_10016875 Ga0265760_100168751 226
438 3300031548 Ga0307408_100107305 Ga0307408_1001073053 226
439 3300031995 Ga0307409_100031101 Ga0307409_1000311013 226
440 3300032002 Ga0307416_100153564 Ga0307416_1001535643 226
441 3300035112 Ga0373932_0000318 Ga0373932_0000318_9945_10649 226
442 3300035691 Ga0373931_0029217 Ga0373931_0029217_1847_2530 226
443 3300035695 Ga0373927_0064558 Ga0373927_0064558_135_818 226
444 3300036401 Ga0373937_0268230 Ga0373937_0268230_388_1083 226
445 3300037068 Ga0373925_0049441 Ga0373925_0049441_1635_2330 226
446 3300039438 Ga0436360_0379337 Ga0436360_0379337_584_1273 226
447 3300039447 Ga0436361_0772461 Ga0436361_0772461_889_1572 226
448 3300039447 Ga0436361_0819333 Ga0436361_0819333_452_1141 226
449 3300039447 Ga0436361_0868431 Ga0436361_0868431_5228_5920 226
450 3300042876 Ga0451577_0544485 Ga0451577_0544485_135_818 226
451 3300045976 Ga0466967_0157004 Ga0466967_0157004_21_704 226
452 3300046472 Ga0495580_0000588 Ga0495580_0000588_7536_8219 226
453 3300046473 Ga0495582_0140409 Ga0495582_0140409_656_1339 226
454 3300046531 Ga0495665_0019228 Ga0495665_0019228_260_943 226
455 3300046680 Ga0495646_0210954 Ga0495646_0210954_137_823 226
456 3300046684 Ga0495669_0248754 Ga0495669_0248754_66_746 226
457 3300048903 Ga0496100_0342602 Ga0496100_0342602_150_833 226
458 3300048904 Ga0496101_0033289 Ga0496101_0033289_2768_3448 226
459 3300048905 Ga0496102_0000641 Ga0496102_0000641_28286_28969 226
460 3300048906 Ga0496103_0000987 Ga0496103_0000987_6675_7358 226
461 3300048906 Ga0496103_0223906 Ga0496103_0223906_427_1107 226
462 3300048907 Ga0496104_0013455 Ga0496104_0013455_4646_5329 226
463 3300048909 Ga0496106_0255614 Ga0496106_0255614_452_1135 226
464 3300048912 Ga0496109_0000072 Ga0496109_0000072_72514_73194 226
465 3300048913 Ga0496110_0002647 Ga0496110_0002647_12174_12854 226
466 3300048915 Ga0496112_0000043 Ga0496112_0000043_86589_87269 226
467 3300048915 Ga0496112_0217290 Ga0496112_0217290_783_1469 226
468 3300048915 Ga0496112_0680202 Ga0496112_0680202_47_736 226
469 3300048916 Ga0496113_0000698 Ga0496113_0000698_2288_2968 226
470 3300048918 Ga0496115_0063695 Ga0496115_0063695_128_808 226
471 3300049568 Ga0501031_0109166 Ga0501031_0109166_863_1552 226
472 3300049575 Ga0501039_0178506 Ga0501039_0178506_731_1420 226
473 3300049578 Ga0501042_0055114 Ga0501042_0055114_372_1061 226
474 3300049579 Ga0501043_0376565 Ga0501043_0376565_85_774 226
475 3300049582 Ga0501048_0501405 Ga0501048_0501405_148_837 226
476 3300049584 Ga0501068_0154228 Ga0501068_0154228_119_808 226
477 3300049587 Ga0501071_0000584 Ga0501071_0000584_630_1319 226
478 3300049588 Ga0501072_0228570 Ga0501072_0228570_727_1416 226
479 3300049591 Ga0501075_0042834 Ga0501075_0042834_2424_3113 226
480 3300049592 Ga0501076_0005793 Ga0501076_0005793_3145_3834 226
481 3300049592 Ga0501076_0422170 Ga0501076_0422170_14_700 226
482 3300049593 Ga0501077_0005097 Ga0501077_0005097_7042_7731 226
483 3300049741 Ga0501079_0037207 Ga0501079_0037207_1585_2274 226
484 3300049742 Ga0501080_0125306 Ga0501080_0125306_1483_2172 226
485 3300054114 Ga0501084_0304547 Ga0501084_0304547_372_1061 226
486 3300061734 Ga0530510_0079883 Ga0530510_0079883_1675_2364 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

35

121

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wsm-assembly1.cif.gz_A crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus 0.9395 14 217
2hf9-assembly1.cif.gz_A crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form 0.9393 12 219
2wsm-assembly1.cif.gz_B crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus 0.9356 13 215
2wsm-assembly1.cif.gz_A crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus 0.9307 14 217
2wsm-assembly1.cif.gz_B crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus 0.9259 13 215
ID Description Score Start End Superfamily
2wsmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9395 14 217 3.40.50.300
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9365 1 217 3.40.50.300
2wsmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9307 14 217 3.40.50.300
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9122 1 217 3.40.50.300
4lpsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8996 16 226 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A178TS71-F1-model_v4 deleted 0.9757 15 221
AF-I0I808-F1-model_v4 Hydrogenase nickel incorporation protein HypB 0.9715 17 221 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604
AF-A0A2V9ZYH2-F1-model_v4 Uncharacterized protein 0.9709 139 219 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604
AF-A0A7W1KY14-F1-model_v4 Hydrogenase nickel incorporation protein HypB 0.9701 1 223 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604
AF-A0A7C5E1T3-F1-model_v4 Hydrogenase accessory protein HypB 0.9691 2 220 GO:0003924
GO:0005525
GO:0008270
GO:0016151
GO:0051604

Feature Viewer

pLDDT pTM Quality
90.19 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map