F453316
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 486 | 276 | 486 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0385802|Ga0466967_0385802_588_1271 |
| Length | 214 |
| Sequence | MTGSPRIVVVRQNILRHNDEVARALRARFHDAGVFVVSLVSSPGSGKTAFLERTLTLLKRERRPAALVGDLATENDAARLARSGAPVKQITTGTLCHLEAAMVENALTDVGNLVCPASFDVGEDLRLVLLSVTEGEDKPLKYPTIFNSADAAVITKADLADAVEFDCRAAEHSIASVRPGMPVLRVSSKTGAGLDDWLTFLHCRQAQRPSIAHK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 105 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 106 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 107 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 108 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 202 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 203 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 204 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.53 |
| Metatranscriptomes | 2.47 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.73 |
| Rhizosphere | 93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1001152 | 3300001976 | Bacteria | 3580 |
| 2 | JGI24747J21853_1003561 | 3300001978 | Bacteria | 1351 |
| 3 | JGI24743J22301_10003913 | 3300001991 | Bacteria | 2387 |
| 4 | JGI24748J21848_1021423 | 3300002074 | Bacteria | 780 |
| 5 | JGI24034J26672_10003386 | 3300002239 | Bacteria | 2222 |
| 6 | JGI24751J29686_10003121 | 3300002459 | Bacteria | 3338 |
| 7 | Ga0058863_11829770 | 3300004799 | Bacteria | 4213 |
| 8 | Ga0058862_12048676 | 3300004803 | Bacteria | 5711 |
| 9 | Ga0065704_10030224 | 3300005289 | Bacteria | 1217 |
| 10 | Ga0070658_10060388 | 3300005327 | Bacteria | 3087 |
| 11 | Ga0070676_10020143 | 3300005328 | Bacteria | 3719 |
| 12 | Ga0070683_100125751 | 3300005329 | Bacteria | 2424 |
| 13 | Ga0070683_100165163 | 3300005329 | Bacteria | 2100 |
| 14 | Ga0070683_100937459 | 3300005329 | Bacteria | 831 |
| 15 | Ga0070690_100005406 | 3300005330 | Bacteria | 7171 |
| 16 | Ga0068869_100002075 | 3300005334 | Bacteria | 12040 |
| 17 | Ga0068869_100094684 | 3300005334 | Bacteria | 2252 |
| 18 | Ga0070666_10014527 | 3300005335 | Bacteria | 5015 |
| 19 | Ga0070680_100013125 | 3300005336 | Bacteria | 6448 |
| 20 | Ga0070680_100146821 | 3300005336 | Bacteria | 1979 |
| 21 | Ga0070680_100394310 | 3300005336 | Bacteria | 1179 |
| 22 | Ga0070680_100705011 | 3300005336 | Bacteria | 868 |
| 23 | Ga0070682_100194196 | 3300005337 | Bacteria | 1427 |
| 24 | Ga0070682_100384599 | 3300005337 | Bacteria | 1057 |
| 25 | Ga0068868_100034353 | 3300005338 | Bacteria | 3914 |
| 26 | Ga0068868_100142702 | 3300005338 | Bacteria | 1967 |
| 27 | Ga0070660_100002323 | 3300005339 | Bacteria | 13073 |
| 28 | Ga0070689_100010155 | 3300005340 | Bacteria | 6704 |
| 29 | Ga0070687_100026799 | 3300005343 | Bacteria | 2778 |
| 30 | Ga0070692_10095664 | 3300005345 | Bacteria | 1621 |
| 31 | Ga0070668_100026756 | 3300005347 | Bacteria | 4379 |
| 32 | Ga0070669_100007907 | 3300005353 | Bacteria | 7598 |
| 33 | Ga0070675_100027978 | 3300005354 | Bacteria | 4534 |
| 34 | Ga0070674_100141445 | 3300005356 | Bacteria | 1806 |
| 35 | Ga0070673_100087014 | 3300005364 | Bacteria | 2546 |
| 36 | Ga0070688_100003715 | 3300005365 | Bacteria | 7893 |
| 37 | Ga0070659_100021584 | 3300005366 | Bacteria | 4906 |
| 38 | Ga0070667_100027044 | 3300005367 | Bacteria | 4772 |
| 39 | Ga0070709_10003886 | 3300005434 | Bacteria | 8052 |
| 40 | Ga0070709_10009194 | 3300005434 | Bacteria | 5439 |
| 41 | Ga0070709_10022669 | 3300005434 | Bacteria | 3677 |
| 42 | Ga0070709_10047969 | 3300005434 | Bacteria | 2663 |
| 43 | Ga0070709_10320622 | 3300005434 | Bacteria | 1137 |
| 44 | Ga0070714_100000312 | 3300005435 | Bacteria | 36817 |
| 45 | Ga0070714_100087027 | 3300005435 | Bacteria | 2732 |
| 46 | Ga0070714_100209702 | 3300005435 | Unclassified | 1785 |
| 47 | Ga0070713_100000461 | 3300005436 | Bacteria | 25984 |
| 48 | Ga0070713_100000811 | 3300005436 | Bacteria | 20055 |
| 49 | Ga0070713_100004614 | 3300005436 | Bacteria | 9291 |
| 50 | Ga0070713_100005052 | 3300005436 | Bacteria | 8972 |
| 51 | Ga0070713_100016950 | 3300005436 | Bacteria | 5493 |
| 52 | Ga0070710_10043828 | 3300005437 | Bacteria | 2480 |
| 53 | Ga0070710_10333522 | 3300005437 | Bacteria | 999 |
| 54 | Ga0070701_10067483 | 3300005438 | Bacteria | 1903 |
| 55 | Ga0070711_100020276 | 3300005439 | Bacteria | 4282 |
| 56 | Ga0070711_100316189 | 3300005439 | Bacteria | 1246 |
| 57 | Ga0070663_100032360 | 3300005455 | Bacteria | 3604 |
| 58 | Ga0070678_100056302 | 3300005456 | Bacteria | 2875 |
| 59 | Ga0070662_100003918 | 3300005457 | Bacteria | 9334 |
| 60 | Ga0070681_10004280 | 3300005458 | Bacteria | 13554 |
| 61 | Ga0070681_10033476 | 3300005458 | Bacteria | 5159 |
| 62 | Ga0070681_10053259 | 3300005458 | Unclassified | 4032 |
| 63 | Ga0070681_10076227 | 3300005458 | Bacteria | 3312 |
| 64 | Ga0070681_10114708 | 3300005458 | Bacteria | 2632 |
| 65 | Ga0070681_10189200 | 3300005458 | Bacteria | 1978 |
| 66 | Ga0068867_100157216 | 3300005459 | Bacteria | 1790 |
| 67 | Ga0070685_10005907 | 3300005466 | Bacteria | 6229 |
| 68 | Ga0070706_100038376 | 3300005467 | Bacteria | 4420 |
| 69 | Ga0070698_100170272 | 3300005471 | Unclassified | 2119 |
| 70 | Ga0070679_100001261 | 3300005530 | Bacteria | 22322 |
| 71 | Ga0070679_100064046 | 3300005530 | Bacteria | 3664 |
| 72 | Ga0070679_100274184 | 3300005530 | Bacteria | 1640 |
| 73 | Ga0070684_100001340 | 3300005535 | Bacteria | 17632 |
| 74 | Ga0070684_100136180 | 3300005535 | Bacteria | 2219 |
| 75 | Ga0070684_100482515 | 3300005535 | Bacteria | 1147 |
| 76 | Ga0068853_100020779 | 3300005539 | Bacteria | 5462 |
| 77 | Ga0070672_100009518 | 3300005543 | Bacteria | 6704 |
| 78 | Ga0070686_100005016 | 3300005544 | Bacteria | 7308 |
| 79 | Ga0070695_100167310 | 3300005545 | Bacteria | 1548 |
| 80 | Ga0070696_100014118 | 3300005546 | Bacteria | 5362 |
| 81 | Ga0070665_100177625 | 3300005548 | Bacteria | 2130 |
| 82 | Ga0070704_100211167 | 3300005549 | Bacteria | 1573 |
| 83 | Ga0068855_100032862 | 3300005563 | Bacteria | 6194 |
| 84 | Ga0068855_100210920 | 3300005563 | Bacteria | 2182 |
| 85 | Ga0068855_100268608 | 3300005563 | Bacteria | 1897 |
| 86 | Ga0070664_100106939 | 3300005564 | Bacteria | 2438 |
| 87 | Ga0070664_100128474 | 3300005564 | Bacteria | 2225 |
| 88 | Ga0068857_100013148 | 3300005577 | Bacteria | 7214 |
| 89 | Ga0068857_100030940 | 3300005577 | Bacteria | 4729 |
| 90 | Ga0068856_100039461 | 3300005614 | Bacteria | 4636 |
| 91 | Ga0068856_100045456 | 3300005614 | Bacteria | 4324 |
| 92 | Ga0068856_100107317 | 3300005614 | Bacteria | 2788 |
| 93 | Ga0068856_100109303 | 3300005614 | Bacteria | 2761 |
| 94 | Ga0068856_100343267 | 3300005614 | Bacteria | 1511 |
| 95 | Ga0068856_100814014 | 3300005614 | Bacteria | 953 |
| 96 | Ga0070702_100026934 | 3300005615 | Bacteria | 3096 |
| 97 | Ga0068852_100015942 | 3300005616 | Bacteria | 5848 |
| 98 | Ga0068852_100120749 | 3300005616 | Bacteria | 2399 |
| 99 | Ga0068864_100004944 | 3300005618 | Bacteria | 10920 |
| 100 | Ga0068866_10023518 | 3300005718 | Bacteria | 2868 |
| 101 | Ga0068866_10024479 | 3300005718 | Bacteria | 2823 |
| 102 | Ga0068866_10283551 | 3300005718 | Bacteria | 1027 |
| 103 | Ga0068870_10009045 | 3300005840 | Bacteria | 4508 |
| 104 | Ga0068858_100005966 | 3300005842 | Bacteria | 11895 |
| 105 | Ga0068862_100012300 | 3300005844 | Bacteria | 7076 |
| 106 | Ga0070717_10019257 | 3300006028 | Bacteria | 5350 |
| 107 | Ga0070717_10072816 | 3300006028 | Bacteria | 2870 |
| 108 | Ga0070717_10110366 | 3300006028 | Bacteria | 2346 |
| 109 | Ga0070717_10133567 | 3300006028 | Bacteria | 2136 |
| 110 | Ga0070717_10321716 | 3300006028 | Bacteria | 1378 |
| 111 | Ga0070717_10496420 | 3300006028 | Bacteria | 1103 |
| 112 | Ga0070717_10761921 | 3300006028 | Bacteria | 880 |
| 113 | Ga0070716_100002017 | 3300006173 | Bacteria | 9272 |
| 114 | Ga0070716_100008029 | 3300006173 | Bacteria | 5225 |
| 115 | Ga0070716_100158978 | 3300006173 | Bacteria | 1462 |
| 116 | Ga0070712_100000859 | 3300006175 | Bacteria | 18112 |
| 117 | Ga0070712_100031707 | 3300006175 | Bacteria | 3563 |
| 118 | Ga0097621_100002292 | 3300006237 | Bacteria | 13107 |
| 119 | Ga0097621_100187381 | 3300006237 | Bacteria | 1790 |
| 120 | Ga0068871_100037564 | 3300006358 | Bacteria | 3863 |
| 121 | Ga0068871_100072006 | 3300006358 | Bacteria | 2845 |
| 122 | Ga0068871_100116164 | 3300006358 | Bacteria | 2256 |
| 123 | Ga0068871_100525612 | 3300006358 | Bacteria | 1069 |
| 124 | Ga0075428_100042995 | 3300006844 | Bacteria | 4968 |
| 125 | Ga0075431_100138914 | 3300006847 | Bacteria | 2505 |
| 126 | Ga0075433_10950833 | 3300006852 | Bacteria | 749 |
| 127 | Ga0075434_100683074 | 3300006871 | Bacteria | 1044 |
| 128 | Ga0068865_100020424 | 3300006881 | Bacteria | 4294 |
| 129 | Ga0105240_10215288 | 3300009093 | Bacteria | 2242 |
| 130 | Ga0105240_10359704 | 3300009093 | Bacteria | 1649 |
| 131 | Ga0105240_10458253 | 3300009093 | Bacteria | 1425 |
| 132 | Ga0105240_10682801 | 3300009093 | Bacteria | 1123 |
| 133 | Ga0105240_10748393 | 3300009093 | Bacteria | 1063 |
| 134 | Ga0105245_10039878 | 3300009098 | Bacteria | 4181 |
| 135 | Ga0105245_10151167 | 3300009098 | Bacteria | 2196 |
| 136 | Ga0105245_10286366 | 3300009098 | Bacteria | 1612 |
| 137 | Ga0105247_10017015 | 3300009101 | Bacteria | 4362 |
| 138 | Ga0114129_10004476 | 3300009147 | Bacteria | 19703 |
| 139 | Ga0105241_10013112 | 3300009174 | Bacteria | 6081 |
| 140 | Ga0105241_10020850 | 3300009174 | Bacteria | 4844 |
| 141 | Ga0105241_10256605 | 3300009174 | Bacteria | 1484 |
| 142 | Ga0105242_10144231 | 3300009176 | Bacteria | 2070 |
| 143 | Ga0105242_10147246 | 3300009176 | Bacteria | 2050 |
| 144 | Ga0105242_10309115 | 3300009176 | Unclassified | 1446 |
| 145 | Ga0105248_10097193 | 3300009177 | Bacteria | 3318 |
| 146 | Ga0105248_11345999 | 3300009177 | Bacteria | 808 |
| 147 | Ga0105237_10046404 | 3300009545 | Bacteria | 4370 |
| 148 | Ga0105237_10170269 | 3300009545 | Bacteria | 2178 |
| 149 | Ga0105237_10414022 | 3300009545 | Bacteria | 1353 |
| 150 | Ga0105237_10706141 | 3300009545 | Bacteria | 1015 |
| 151 | Ga0105249_10041248 | 3300009553 | Bacteria | 4195 |
| 152 | Ga0105239_10026459 | 3300010375 | Bacteria | 6384 |
| 153 | Ga0105239_10455330 | 3300010375 | Bacteria | 1452 |
| 154 | Ga0105246_10003641 | 3300011119 | Bacteria | 9324 |
| 155 | Ga0105246_10023078 | 3300011119 | Bacteria | 4023 |
| 156 | Ga0157373_10002403 | 3300013100 | Bacteria | 14221 |
| 157 | Ga0157373_10016567 | 3300013100 | Bacteria | 5374 |
| 158 | Ga0157371_10282864 | 3300013102 | Bacteria | 1198 |
| 159 | Ga0157370_10029765 | 3300013104 | Bacteria | 5355 |
| 160 | Ga0157370_10072712 | 3300013104 | Bacteria | 3244 |
| 161 | Ga0157370_10268002 | 3300013104 | Bacteria | 1578 |
| 162 | Ga0157370_10313307 | 3300013104 | Bacteria | 1448 |
| 163 | Ga0157370_10616217 | 3300013104 | Bacteria | 993 |
| 164 | Ga0157369_10035063 | 3300013105 | Bacteria | 5503 |
| 165 | Ga0157369_10052447 | 3300013105 | Bacteria | 4413 |
| 166 | Ga0157369_10104277 | 3300013105 | Bacteria | 3020 |
| 167 | Ga0157369_10139984 | 3300013105 | Bacteria | 2561 |
| 168 | Ga0157369_10392075 | 3300013105 | Bacteria | 1441 |
| 169 | Ga0157374_10004409 | 3300013296 | Bacteria | 11838 |
| 170 | Ga0157374_10125007 | 3300013296 | Bacteria | 2486 |
| 171 | Ga0157374_10195571 | 3300013296 | Bacteria | 1979 |
| 172 | Ga0157378_10001316 | 3300013297 | Bacteria | 22353 |
| 173 | Ga0157378_10368122 | 3300013297 | Bacteria | 1408 |
| 174 | Ga0163162_10047635 | 3300013306 | Bacteria | 4295 |
| 175 | Ga0163162_10810931 | 3300013306 | Bacteria | 1053 |
| 176 | Ga0157372_10028245 | 3300013307 | Bacteria | 6122 |
| 177 | Ga0157372_10057025 | 3300013307 | Bacteria | 4366 |
| 178 | Ga0157372_10204886 | 3300013307 | Bacteria | 2286 |
| 179 | Ga0157372_10327062 | 3300013307 | Bacteria | 1785 |
| 180 | Ga0157375_10022594 | 3300013308 | Bacteria | 5791 |
| 181 | Ga0157375_10409783 | 3300013308 | Bacteria | 1522 |
| 182 | Ga0163163_10017878 | 3300014325 | Bacteria | 6620 |
| 183 | Ga0163163_10086897 | 3300014325 | Bacteria | 3137 |
| 184 | Ga0157380_10063996 | 3300014326 | Bacteria | 2951 |
| 185 | Ga0157380_10200577 | 3300014326 | Bacteria | 1770 |
| 186 | Ga0157377_10000706 | 3300014745 | Bacteria | 13764 |
| 187 | Ga0157379_10004045 | 3300014968 | Bacteria | 12505 |
| 188 | Ga0157379_10004057 | 3300014968 | Bacteria | 12492 |
| 189 | Ga0157376_10183136 | 3300014969 | Bacteria | 1916 |
| 190 | Ga0182005_1063068 | 3300015265 | Bacteria | 1013 |
| 191 | Ga0197907_10250949 | 3300020069 | Bacteria | 5784 |
| 192 | Ga0206349_1461041 | 3300020075 | Bacteria | 2437 |
| 193 | Ga0206353_10388689 | 3300020082 | Bacteria | 1167 |
| 194 | Ga0213872_10001368 | 3300021361 | Bacteria | 16070 |
| 195 | Ga0213872_10003884 | 3300021361 | Bacteria | 8112 |
| 196 | Ga0213872_10004078 | 3300021361 | Bacteria | 7865 |
| 197 | Ga0213872_10104135 | 3300021361 | Unclassified | 1263 |
| 198 | Ga0213875_10000019 | 3300021388 | Bacteria | 231333 |
| 199 | Ga0213875_10000680 | 3300021388 | Bacteria | 26657 |
| 200 | Ga0213875_10004642 | 3300021388 | Bacteria | 7487 |
| 201 | Ga0213875_10013032 | 3300021388 | Bacteria | 4092 |
| 202 | Ga0213871_10041496 | 3300021441 | Bacteria | 1237 |
| 203 | Ga0224572_1024224 | 3300024225 | Bacteria | 1166 |
| 204 | Ga0228598_1027117 | 3300024227 | Bacteria | 1126 |
| 205 | Ga0207697_10016346 | 3300025315 | Bacteria | 3056 |
| 206 | Ga0207710_10026490 | 3300025900 | Bacteria | 2506 |
| 207 | Ga0207688_10097038 | 3300025901 | Bacteria | 1698 |
| 208 | Ga0207680_10086289 | 3300025903 | Bacteria | 1984 |
| 209 | Ga0207647_10012625 | 3300025904 | Bacteria | 5872 |
| 210 | Ga0207685_10019410 | 3300025905 | Bacteria | 2240 |
| 211 | Ga0207699_10002137 | 3300025906 | Bacteria | 9353 |
| 212 | Ga0207699_10186501 | 3300025906 | Bacteria | 1397 |
| 213 | Ga0207699_10330551 | 3300025906 | Bacteria | 1071 |
| 214 | Ga0207699_10402628 | 3300025906 | Bacteria | 975 |
| 215 | Ga0207645_10000309 | 3300025907 | Bacteria | 41038 |
| 216 | Ga0207643_10002124 | 3300025908 | Bacteria | 10904 |
| 217 | Ga0207705_10045538 | 3300025909 | Bacteria | 3152 |
| 218 | Ga0207684_10061425 | 3300025910 | Bacteria | 3191 |
| 219 | Ga0207654_10012653 | 3300025911 | Unclassified | 4328 |
| 220 | Ga0207654_10087656 | 3300025911 | Bacteria | 1889 |
| 221 | Ga0207654_10164752 | 3300025911 | Bacteria | 1435 |
| 222 | Ga0207707_10001970 | 3300025912 | Bacteria | 18645 |
| 223 | Ga0207707_10020867 | 3300025912 | Bacteria | 5722 |
| 224 | Ga0207707_10158884 | 3300025912 | Bacteria | 1976 |
| 225 | Ga0207707_10446859 | 3300025912 | Unclassified | 1106 |
| 226 | Ga0207695_10157317 | 3300025913 | Bacteria | 2207 |
| 227 | Ga0207695_10184551 | 3300025913 | Bacteria | 2005 |
| 228 | Ga0207695_10277150 | 3300025913 | Bacteria | 1571 |
| 229 | Ga0207695_10582851 | 3300025913 | Bacteria | 1000 |
| 230 | Ga0207671_10082111 | 3300025914 | Bacteria | 2418 |
| 231 | Ga0207671_10168656 | 3300025914 | Bacteria | 1699 |
| 232 | Ga0207693_10000065 | 3300025915 | Bacteria | 91476 |
| 233 | Ga0207693_10000482 | 3300025915 | Bacteria | 36147 |
| 234 | Ga0207693_10042390 | 3300025915 | Bacteria | 3582 |
| 235 | Ga0207693_10092755 | 3300025915 | Bacteria | 2366 |
| 236 | Ga0207693_10175691 | 3300025915 | Bacteria | 1685 |
| 237 | Ga0207663_10002408 | 3300025916 | Bacteria | 8980 |
| 238 | Ga0207663_10075021 | 3300025916 | Bacteria | 2193 |
| 239 | Ga0207663_10271725 | 3300025916 | Bacteria | 1256 |
| 240 | Ga0207663_10300519 | 3300025916 | Bacteria | 1199 |
| 241 | Ga0207660_10000595 | 3300025917 | Bacteria | 24399 |
| 242 | Ga0207660_10475612 | 3300025917 | Bacteria | 1012 |
| 243 | Ga0207662_10006490 | 3300025918 | Bacteria | 6318 |
| 244 | Ga0207657_10003047 | 3300025919 | Bacteria | 17923 |
| 245 | Ga0207652_10001847 | 3300025921 | Bacteria | 18374 |
| 246 | Ga0207652_10155018 | 3300025921 | Bacteria | 2052 |
| 247 | Ga0207652_10257335 | 3300025921 | Bacteria | 1574 |
| 248 | Ga0207681_10135518 | 3300025923 | Bacteria | 1827 |
| 249 | Ga0207681_10176076 | 3300025923 | Bacteria | 1625 |
| 250 | Ga0207694_10003225 | 3300025924 | Bacteria | 12998 |
| 251 | Ga0207650_10000051 | 3300025925 | Bacteria | 168652 |
| 252 | Ga0207650_10000252 | 3300025925 | Bacteria | 58117 |
| 253 | Ga0207659_10009683 | 3300025926 | Bacteria | 6026 |
| 254 | Ga0207687_10040232 | 3300025927 | Bacteria | 3204 |
| 255 | Ga0207687_10113584 | 3300025927 | Bacteria | 2015 |
| 256 | Ga0207687_10261906 | 3300025927 | Bacteria | 1379 |
| 257 | Ga0207687_10433965 | 3300025927 | Bacteria | 1086 |
| 258 | Ga0207700_10000709 | 3300025928 | Bacteria | 19278 |
| 259 | Ga0207700_10025560 | 3300025928 | Bacteria | 4103 |
| 260 | Ga0207700_10058047 | 3300025928 | Bacteria | 2921 |
| 261 | Ga0207664_10000031 | 3300025929 | Bacteria | 179373 |
| 262 | Ga0207664_10037185 | 3300025929 | Bacteria | 3765 |
| 263 | Ga0207664_10392029 | 3300025929 | Bacteria | 1234 |
| 264 | Ga0207664_10566147 | 3300025929 | Bacteria | 1020 |
| 265 | Ga0207644_10050270 | 3300025931 | Bacteria | 2987 |
| 266 | Ga0207690_10015755 | 3300025932 | Bacteria | 4587 |
| 267 | Ga0207686_10212487 | 3300025934 | Bacteria | 1392 |
| 268 | Ga0207670_10018942 | 3300025936 | Bacteria | 4195 |
| 269 | Ga0207669_10185292 | 3300025937 | Bacteria | 1496 |
| 270 | Ga0207704_10197473 | 3300025938 | Bacteria | 1469 |
| 271 | Ga0207665_10025914 | 3300025939 | Bacteria | 3868 |
| 272 | Ga0207665_10122414 | 3300025939 | Bacteria | 1839 |
| 273 | Ga0207691_10000160 | 3300025940 | Bacteria | 63013 |
| 274 | Ga0207711_10023707 | 3300025941 | Bacteria | 5138 |
| 275 | Ga0207689_10017984 | 3300025942 | Bacteria | 5968 |
| 276 | Ga0207661_10289683 | 3300025944 | Bacteria | 1465 |
| 277 | Ga0207679_10000039 | 3300025945 | Bacteria | 127661 |
| 278 | Ga0207679_10249708 | 3300025945 | Bacteria | 1507 |
| 279 | Ga0207667_10023920 | 3300025949 | Bacteria | 6720 |
| 280 | Ga0207667_10600569 | 3300025949 | Bacteria | 1110 |
| 281 | Ga0207668_10012738 | 3300025972 | Bacteria | 5157 |
| 282 | Ga0207640_10087030 | 3300025981 | Bacteria | 2153 |
| 283 | Ga0207658_10021343 | 3300025986 | Bacteria | 4494 |
| 284 | Ga0207677_10040673 | 3300026023 | Bacteria | 3067 |
| 285 | Ga0207677_10275174 | 3300026023 | Bacteria | 1379 |
| 286 | Ga0207639_10095819 | 3300026041 | Unclassified | 2386 |
| 287 | Ga0207639_10224491 | 3300026041 | Bacteria | 1624 |
| 288 | Ga0207702_10019199 | 3300026078 | Bacteria | 5654 |
| 289 | Ga0207702_10048089 | 3300026078 | Bacteria | 3597 |
| 290 | Ga0207702_10267942 | 3300026078 | Bacteria | 1610 |
| 291 | Ga0207702_10514438 | 3300026078 | Bacteria | 1168 |
| 292 | Ga0207641_10000025 | 3300026088 | Bacteria | 247727 |
| 293 | Ga0207648_10001401 | 3300026089 | Bacteria | 26517 |
| 294 | Ga0207648_10005996 | 3300026089 | Bacteria | 12144 |
| 295 | Ga0207648_10424551 | 3300026089 | Bacteria | 1208 |
| 296 | Ga0207676_10000104 | 3300026095 | Bacteria | 74872 |
| 297 | Ga0207674_10004790 | 3300026116 | Bacteria | 16215 |
| 298 | Ga0207675_100011876 | 3300026118 | Bacteria | 8139 |
| 299 | Ga0207675_100342266 | 3300026118 | Bacteria | 1464 |
| 300 | Ga0207683_10000385 | 3300026121 | Bacteria | 40789 |
| 301 | Ga0265356_1006537 | 3300028017 | Bacteria | 1360 |
| 302 | Ga0268266_10003476 | 3300028379 | Bacteria | 15707 |
| 303 | Ga0268266_10443567 | 3300028379 | Bacteria | 1233 |
| 304 | Ga0268265_10066483 | 3300028380 | Bacteria | 2787 |
| 305 | Ga0268264_10422940 | 3300028381 | Bacteria | 1285 |
| 306 | Ga0265338_10001262 | 3300028800 | Bacteria | 41722 |
| 307 | Ga0265338_10058309 | 3300028800 | Bacteria | 3409 |
| 308 | Ga0265338_10063326 | 3300028800 | Bacteria | 3225 |
| 309 | Ga0265338_10156657 | 3300028800 | Bacteria | 1763 |
| 310 | Ga0265762_1000827 | 3300030760 | Bacteria | 5504 |
| 311 | Ga0265760_10016875 | 3300031090 | Bacteria | 2096 |
| 312 | Ga0265760_10106378 | 3300031090 | Bacteria | 890 |
| 313 | Ga0265325_10020075 | 3300031241 | Bacteria | 3687 |
| 314 | Ga0265325_10147850 | 3300031241 | Bacteria | 1113 |
| 315 | Ga0265339_10063678 | 3300031249 | Unclassified | 1980 |
| 316 | Ga0265339_10177553 | 3300031249 | Bacteria | 1062 |
| 317 | Ga0265316_10013766 | 3300031344 | Bacteria | 7165 |
| 318 | Ga0265316_10065278 | 3300031344 | Bacteria | 2819 |
| 319 | Ga0307408_100107305 | 3300031548 | Bacteria | 2138 |
| 320 | Ga0265314_10019915 | 3300031711 | Bacteria | 5188 |
| 321 | Ga0265342_10041920 | 3300031712 | Unclassified | 2768 |
| 322 | Ga0307409_100031101 | 3300031995 | Bacteria | 3847 |
| 323 | Ga0307416_100153564 | 3300032002 | Bacteria | 2116 |
| 324 | Ga0373934_0011540 | 3300035086 | Bacteria | 3323 |
| 325 | Ga0373934_0023365 | 3300035086 | Bacteria | 2388 |
| 326 | Ga0373944_0123122 | 3300035089 | Bacteria | 895 |
| 327 | Ga0373923_0000706 | 3300035111 | Bacteria | 8557 |
| 328 | Ga0373932_0000318 | 3300035112 | Bacteria | 14684 |
| 329 | Ga0373936_0011848 | 3300035113 | Unclassified | 3308 |
| 330 | Ga0373936_0029470 | 3300035113 | Bacteria | 2161 |
| 331 | Ga0373953_0028995 | 3300035117 | Unclassified | 2139 |
| 332 | Ga0373954_0017730 | 3300035118 | Bacteria | 3200 |
| 333 | Ga0373956_0007239 | 3300035119 | Bacteria | 4468 |
| 334 | Ga0373957_0055386 | 3300035120 | Bacteria | 1525 |
| 335 | Ga0373943_0000043 | 3300035170 | Bacteria | 42190 |
| 336 | Ga0373943_0066943 | 3300035170 | Bacteria | 1810 |
| 337 | Ga0373943_0244308 | 3300035170 | Bacteria | 1007 |
| 338 | Ga0373946_0026108 | 3300035171 | Bacteria | 2301 |
| 339 | Ga0373946_0036300 | 3300035171 | Bacteria | 1998 |
| 340 | Ga0373955_0062296 | 3300035172 | Unclassified | 2062 |
| 341 | Ga0373955_0217816 | 3300035172 | Bacteria | 1139 |
| 342 | Ga0373931_0029217 | 3300035691 | Unclassified | 2828 |
| 343 | Ga0373935_0001292 | 3300035692 | Bacteria | 13821 |
| 344 | Ga0373935_0044930 | 3300035692 | Bacteria | 2786 |
| 345 | Ga0373935_0073349 | 3300035692 | Unclassified | 2211 |
| 346 | Ga0373927_0000213 | 3300035695 | Bacteria | 46171 |
| 347 | Ga0373927_0064558 | 3300035695 | Bacteria | 2368 |
| 348 | Ga0373933_0005136 | 3300035724 | Bacteria | 7139 |
| 349 | Ga0373933_0426267 | 3300035724 | Bacteria | 867 |
| 350 | Ga0373947_0010168 | 3300035725 | Bacteria | 5402 |
| 351 | Ga0373947_0023425 | 3300035725 | Bacteria | 3591 |
| 352 | Ga0373937_0013467 | 3300036401 | Bacteria | 7204 |
| 353 | Ga0373937_0268230 | 3300036401 | Bacteria | 1611 |
| 354 | Ga0373937_0460345 | 3300036401 | Bacteria | 1208 |
| 355 | Ga0373937_0880781 | 3300036401 | Bacteria | 844 |
| 356 | Ga0373937_1211295 | 3300036401 | Bacteria | 703 |
| 357 | Ga0373925_0004761 | 3300037068 | Bacteria | 10221 |
| 358 | Ga0373925_0012688 | 3300037068 | Bacteria | 6103 |
| 359 | Ga0373925_0049441 | 3300037068 | Bacteria | 3134 |
| 360 | Ga0373925_0201527 | 3300037068 | Bacteria | 1583 |
| 361 | Ga0395899_0569098 | 3300037312 | Bacteria | 726 |
| 362 | Ga0395900_0428186 | 3300037418 | Bacteria | 1283 |
| 363 | Ga0395898_0079576 | 3300037466 | Bacteria | 3162 |
| 364 | Ga0436364_0197022 | 3300037853 | Bacteria | 80312 |
| 365 | Ga0436364_0366372 | 3300037853 | Bacteria | 231753 |
| 366 | Ga0436364_0404518 | 3300037853 | Bacteria | 4936 |
| 367 | Ga0436364_0977964 | 3300037853 | Bacteria | 16438 |
| 368 | Ga0395901_0424409 | 3300038443 | Bacteria | 1363 |
| 369 | Ga0436365_1607589 | 3300039437 | Bacteria | 1119 |
| 370 | Ga0436365_1731945 | 3300039437 | Bacteria | 892 |
| 371 | Ga0436360_0379337 | 3300039438 | Bacteria | 3119 |
| 372 | Ga0436361_0100788 | 3300039447 | Bacteria | 889 |
| 373 | Ga0436361_0410285 | 3300039447 | Bacteria | 24350 |
| 374 | Ga0436361_0448029 | 3300039447 | Bacteria | 31964 |
| 375 | Ga0436361_0467807 | 3300039447 | Bacteria | 1202 |
| 376 | Ga0436361_0609953 | 3300039447 | Bacteria | 952 |
| 377 | Ga0436361_0659868 | 3300039447 | Bacteria | 2196 |
| 378 | Ga0436361_0772461 | 3300039447 | Bacteria | 1649 |
| 379 | Ga0436361_0819333 | 3300039447 | Bacteria | 6760 |
| 380 | Ga0436361_0868431 | 3300039447 | Bacteria | 8018 |
| 381 | Ga0436361_0965656 | 3300039447 | Bacteria | 1070 |
| 382 | Ga0436363_1403898 | 3300039450 | Bacteria | 2715 |
| 383 | Ga0451577_0544485 | 3300042876 | Bacteria | 1054 |
| 384 | Ga0466963_0004026 | 3300044694 | Bacteria | 8498 |
| 385 | Ga0466964_0113232 | 3300044706 | Bacteria | 1213 |
| 386 | Ga0453684_0531900 | 3300044712 | Bacteria | 1297 |
| 387 | Ga0466967_0005621 | 3300045976 | Bacteria | 8720 |
| 388 | Ga0466967_0157004 | 3300045976 | Bacteria | 2132 |
| 389 | Ga0466967_0385802 | 3300045976 | Bacteria | 1361 |
| 390 | Ga0495590_0101208 | 3300046457 | Bacteria | 1024 |
| 391 | Ga0495629_0027893 | 3300046459 | Bacteria | 4011 |
| 392 | Ga0495651_0141628 | 3300046462 | Bacteria | 1743 |
| 393 | Ga0495653_0522366 | 3300046463 | Bacteria | 738 |
| 394 | Ga0495653_0523262 | 3300046463 | Bacteria | 737 |
| 395 | Ga0495580_0000098 | 3300046472 | Bacteria | 57956 |
| 396 | Ga0495580_0000588 | 3300046472 | Bacteria | 30715 |
| 397 | Ga0495580_0007186 | 3300046472 | Bacteria | 8962 |
| 398 | Ga0495580_0143158 | 3300046472 | Unclassified | 1657 |
| 399 | Ga0495580_0600068 | 3300046472 | Bacteria | 728 |
| 400 | Ga0495582_0004950 | 3300046473 | Bacteria | 7465 |
| 401 | Ga0495582_0140409 | 3300046473 | Bacteria | 1369 |
| 402 | Ga0495582_0341817 | 3300046473 | Unclassified | 862 |
| 403 | Ga0495664_0036711 | 3300046477 | Unclassified | 2889 |
| 404 | Ga0495630_0052623 | 3300046517 | Bacteria | 3049 |
| 405 | Ga0495630_0496063 | 3300046517 | Bacteria | 936 |
| 406 | Ga0495630_0606334 | 3300046517 | Bacteria | 839 |
| 407 | Ga0495665_0019228 | 3300046531 | Bacteria | 3672 |
| 408 | Ga0495665_0032356 | 3300046531 | Bacteria | 2798 |
| 409 | Ga0495665_0194002 | 3300046531 | Bacteria | 1054 |
| 410 | Ga0495586_0125304 | 3300046535 | Bacteria | 1437 |
| 411 | Ga0495667_0398432 | 3300046559 | Bacteria | 867 |
| 412 | Ga0495634_0410196 | 3300046642 | Bacteria | 803 |
| 413 | Ga0495599_0298581 | 3300046678 | Bacteria | 973 |
| 414 | Ga0495623_0222061 | 3300046679 | Bacteria | 1076 |
| 415 | Ga0495623_0225085 | 3300046679 | Bacteria | 1067 |
| 416 | Ga0495646_0210954 | 3300046680 | Bacteria | 1054 |
| 417 | Ga0495658_0006758 | 3300046683 | Bacteria | 5644 |
| 418 | Ga0495658_0049713 | 3300046683 | Unclassified | 2369 |
| 419 | Ga0495669_0248754 | 3300046684 | Bacteria | 854 |
| 420 | Ga0495613_0024513 | 3300046689 | Bacteria | 4495 |
| 421 | Ga0495624_0185047 | 3300046690 | Bacteria | 1268 |
| 422 | Ga0495581_0041461 | 3300047315 | Bacteria | 2664 |
| 423 | Ga0495581_0110950 | 3300047315 | Bacteria | 1595 |
| 424 | Ga0495581_0200979 | 3300047315 | Bacteria | 1166 |
| 425 | Ga0495604_0278710 | 3300047317 | Bacteria | 1130 |
| 426 | Ga0495674_0028855 | 3300047319 | Bacteria | 5055 |
| 427 | Ga0495674_0064013 | 3300047319 | Bacteria | 3198 |
| 428 | Ga0495674_0329659 | 3300047319 | Bacteria | 1242 |
| 429 | Ga0495676_0185838 | 3300047321 | Bacteria | 1453 |
| 430 | Ga0495676_0395882 | 3300047321 | Bacteria | 917 |
| 431 | Ga0495684_0193677 | 3300047471 | Unclassified | 1502 |
| 432 | Ga0495602_0077822 | 3300048088 | Unclassified | 2804 |
| 433 | Ga0495602_0513923 | 3300048088 | Bacteria | 835 |
| 434 | Ga0496100_0342602 | 3300048903 | Bacteria | 1127 |
| 435 | Ga0496100_0478304 | 3300048903 | Bacteria | 958 |
| 436 | Ga0496101_0033289 | 3300048904 | Bacteria | 3634 |
| 437 | Ga0496102_0000641 | 3300048905 | Bacteria | 35434 |
| 438 | Ga0496102_1165527 | 3300048905 | Bacteria | 690 |
| 439 | Ga0496103_0000987 | 3300048906 | Bacteria | 20071 |
| 440 | Ga0496103_0223906 | 3300048906 | Bacteria | 1210 |
| 441 | Ga0496104_0013455 | 3300048907 | Bacteria | 7372 |
| 442 | Ga0496105_0617756 | 3300048908 | Bacteria | 840 |
| 443 | Ga0496106_0255614 | 3300048909 | Bacteria | 1401 |
| 444 | Ga0496108_0153299 | 3300048911 | Bacteria | 1989 |
| 445 | Ga0496109_0000072 | 3300048912 | Bacteria | 107549 |
| 446 | Ga0496109_0300393 | 3300048912 | Bacteria | 1514 |
| 447 | Ga0496110_0002647 | 3300048913 | Bacteria | 13498 |
| 448 | Ga0496112_0000043 | 3300048915 | Bacteria | 87684 |
| 449 | Ga0496112_0186909 | 3300048915 | Bacteria | 2035 |
| 450 | Ga0496112_0217290 | 3300048915 | Bacteria | 1868 |
| 451 | Ga0496112_0680202 | 3300048915 | Bacteria | 957 |
| 452 | Ga0496112_0753693 | 3300048915 | Bacteria | 900 |
| 453 | Ga0496113_0000698 | 3300048916 | Bacteria | 17144 |
| 454 | Ga0496115_0013084 | 3300048918 | Bacteria | 6265 |
| 455 | Ga0496115_0063695 | 3300048918 | Bacteria | 2975 |
| 456 | Ga0496115_0155880 | 3300048918 | Bacteria | 1887 |
| 457 | Ga0501031_0109166 | 3300049568 | Bacteria | 1807 |
| 458 | Ga0501036_0033207 | 3300049572 | Bacteria | 4364 |
| 459 | Ga0501039_0178506 | 3300049575 | Bacteria | 1670 |
| 460 | Ga0501040_0070743 | 3300049576 | Bacteria | 2408 |
| 461 | Ga0501042_0055114 | 3300049578 | Bacteria | 2836 |
| 462 | Ga0501043_0376565 | 3300049579 | Bacteria | 1075 |
| 463 | Ga0501048_0501405 | 3300049582 | Bacteria | 870 |
| 464 | Ga0501068_0154228 | 3300049584 | Bacteria | 1445 |
| 465 | Ga0501071_0000584 | 3300049587 | Bacteria | 18891 |
| 466 | Ga0501072_0228570 | 3300049588 | Bacteria | 1482 |
| 467 | Ga0501075_0042834 | 3300049591 | Bacteria | 3395 |
| 468 | Ga0501076_0005793 | 3300049592 | Bacteria | 8914 |
| 469 | Ga0501076_0422170 | 3300049592 | Bacteria | 1097 |
| 470 | Ga0501077_0005097 | 3300049593 | Bacteria | 7975 |
| 471 | Ga0501079_0037207 | 3300049741 | Bacteria | 3750 |
| 472 | Ga0501080_0125306 | 3300049742 | Bacteria | 2379 |
| 473 | nmdc:mga05p37_5417_c1 | 3300050507 | Bacteria | 14996 |
| 474 | nmdc:mga09592_82694_c1 | 3300050508 | Bacteria | 2736 |
| 475 | nmdc:mga0n895_28278_c1 | 3300050512 | Bacteria | 5333 |
| 476 | nmdc:mga08x19_666442_c1 | 3300050514 | Bacteria | 738 |
| 477 | nmdc:mga0a205_655287_c1 | 3300050515 | Bacteria | 901 |
| 478 | Ga0495601_0467627 | 3300053077 | Bacteria | 815 |
| 479 | Ga0495612_0145962 | 3300053078 | Bacteria | 1028 |
| 480 | Ga0495619_0560785 | 3300053085 | Bacteria | 783 |
| 481 | Ga0501084_0304547 | 3300054114 | Bacteria | 1346 |
| 482 | Ga0587073_0000141 | 3300059492 | Bacteria | 4991 |
| 483 | Ga0587077_003310 | 3300059493 | Bacteria | 2014 |
| 484 | Ga0587083_0002504 | 3300059505 | Bacteria | 2303 |
| 485 | Ga0587076_005858 | 3300059645 | Bacteria | 1611 |
| 486 | Ga0530510_0079883 | 3300061734 | Bacteria | 2379 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046477 | Ga0495664_0036711 | Ga0495664_0036711_25_609 | 194 |
| 2 | 3300036401 | Ga0373937_1211295 | Ga0373937_1211295_43_687 | 201 |
| 3 | 3300044712 | Ga0453684_0531900 | Ga0453684_0531900_17_622 | 201 |
| 4 | 3300005434 | Ga0070709_10009194 | Ga0070709_100091946 | 203 |
| 5 | 3300005436 | Ga0070713_100004614 | Ga0070713_10000461411 | 203 |
| 6 | 3300025906 | Ga0207699_10186501 | Ga0207699_101865011 | 203 |
| 7 | 3300037312 | Ga0395899_0569098 | Ga0395899_0569098_29_649 | 203 |
| 8 | 3300048905 | Ga0496102_1165527 | Ga0496102_1165527_68_679 | 203 |
| 9 | 3300047315 | Ga0495581_0041461 | Ga0495581_0041461_1072_1761 | 205 |
| 10 | 3300028800 | Ga0265338_10058309 | Ga0265338_100583092 | 209 |
| 11 | 3300031090 | Ga0265760_10106378 | Ga0265760_101063782 | 210 |
| 12 | 3300059492 | Ga0587073_0000141 | Ga0587073_0000141_1375_2064 | 210 |
| 13 | 3300059493 | Ga0587077_003310 | Ga0587077_003310_878_1567 | 210 |
| 14 | 3300059505 | Ga0587083_0002504 | Ga0587083_0002504_1123_1812 | 210 |
| 15 | 3300059645 | Ga0587076_005858 | Ga0587076_005858_673_1362 | 210 |
| 16 | 3300045976 | Ga0466967_0385802 | Ga0466967_0385802_588_1271 | 213 |
| 17 | 3300046463 | Ga0495653_0522366 | Ga0495653_0522366_78_722 | 214 |
| 18 | 3300046517 | Ga0495630_0606334 | Ga0495630_0606334_24_710 | 214 |
| 19 | 3300047471 | Ga0495684_0193677 | Ga0495684_0193677_17_661 | 214 |
| 20 | 3300053077 | Ga0495601_0467627 | Ga0495601_0467627_17_661 | 214 |
| 21 | 3300014326 | Ga0157380_10200577 | Ga0157380_102005772 | 215 |
| 22 | 3300048918 | Ga0496115_0155880 | Ga0496115_0155880_430_1173 | 215 |
| 23 | 3300005615 | Ga0070702_100026934 | Ga0070702_1000269343 | 216 |
| 24 | 3300021388 | Ga0213875_10000680 | Ga0213875_1000068017 | 216 |
| 25 | 3300037853 | Ga0436364_0197022 | Ga0436364_0197022_61852_62511 | 216 |
| 26 | 3300009176 | Ga0105242_10309115 | Ga0105242_103091153 | 218 |
| 27 | 3300021361 | Ga0213872_10001368 | Ga0213872_100013688 | 218 |
| 28 | 3300025949 | Ga0207667_10600569 | Ga0207667_106005691 | 218 |
| 29 | 3300035170 | Ga0373943_0066943 | Ga0373943_0066943_530_1201 | 218 |
| 30 | 3300035171 | Ga0373946_0036300 | Ga0373946_0036300_594_1265 | 218 |
| 31 | 3300035692 | Ga0373935_0044930 | Ga0373935_0044930_251_922 | 218 |
| 32 | 3300035725 | Ga0373947_0023425 | Ga0373947_0023425_552_1223 | 218 |
| 33 | 3300036401 | Ga0373937_0880781 | Ga0373937_0880781_107_778 | 218 |
| 34 | 3300039447 | Ga0436361_0448029 | Ga0436361_0448029_22187_22846 | 218 |
| 35 | 3300046472 | Ga0495580_0143158 | Ga0495580_0143158_735_1406 | 218 |
| 36 | 3300046559 | Ga0495667_0398432 | Ga0495667_0398432_174_845 | 218 |
| 37 | 3300046683 | Ga0495658_0049713 | Ga0495658_0049713_1427_2098 | 218 |
| 38 | 3300047315 | Ga0495581_0200979 | Ga0495581_0200979_344_1015 | 218 |
| 39 | 3300049572 | Ga0501036_0033207 | Ga0501036_0033207_1890_2552 | 218 |
| 40 | 3300049576 | Ga0501040_0070743 | Ga0501040_0070743_19_681 | 218 |
| 41 | 3300053078 | Ga0495612_0145962 | Ga0495612_0145962_339_1010 | 218 |
| 42 | 3300021388 | Ga0213875_10013032 | Ga0213875_100130323 | 219 |
| 43 | 3300037853 | Ga0436364_0404518 | Ga0436364_0404518_2574_3236 | 219 |
| 44 | 3300005329 | Ga0070683_100165163 | Ga0070683_1001651633 | 220 |
| 45 | 3300005338 | Ga0068868_100142702 | Ga0068868_1001427021 | 220 |
| 46 | 3300005535 | Ga0070684_100136180 | Ga0070684_1001361802 | 220 |
| 47 | 3300005548 | Ga0070665_100177625 | Ga0070665_1001776253 | 220 |
| 48 | 3300005564 | Ga0070664_100128474 | Ga0070664_1001284743 | 220 |
| 49 | 3300005577 | Ga0068857_100013148 | Ga0068857_1000131484 | 220 |
| 50 | 3300005718 | Ga0068866_10024479 | Ga0068866_100244793 | 220 |
| 51 | 3300006358 | Ga0068871_100116164 | Ga0068871_1001161642 | 220 |
| 52 | 3300009093 | Ga0105240_10748393 | Ga0105240_107483932 | 220 |
| 53 | 3300009098 | Ga0105245_10151167 | Ga0105245_101511673 | 220 |
| 54 | 3300009174 | Ga0105241_10256605 | Ga0105241_102566053 | 220 |
| 55 | 3300009176 | Ga0105242_10144231 | Ga0105242_101442313 | 220 |
| 56 | 3300009176 | Ga0105242_10147246 | Ga0105242_101472463 | 220 |
| 57 | 3300009177 | Ga0105248_10097193 | Ga0105248_100971931 | 220 |
| 58 | 3300010375 | Ga0105239_10455330 | Ga0105239_104553302 | 220 |
| 59 | 3300011119 | Ga0105246_10023078 | Ga0105246_100230783 | 220 |
| 60 | 3300013104 | Ga0157370_10616217 | Ga0157370_106162171 | 220 |
| 61 | 3300013296 | Ga0157374_10195571 | Ga0157374_101955712 | 220 |
| 62 | 3300013306 | Ga0163162_10810931 | Ga0163162_108109311 | 220 |
| 63 | 3300013308 | Ga0157375_10409783 | Ga0157375_104097832 | 220 |
| 64 | 3300014325 | Ga0163163_10086897 | Ga0163163_100868972 | 220 |
| 65 | 3300014969 | Ga0157376_10183136 | Ga0157376_101831362 | 220 |
| 66 | 3300021388 | Ga0213875_10000019 | Ga0213875_1000001940 | 220 |
| 67 | 3300025911 | Ga0207654_10164752 | Ga0207654_101647522 | 220 |
| 68 | 3300025912 | Ga0207707_10020867 | Ga0207707_100208676 | 220 |
| 69 | 3300025914 | Ga0207671_10082111 | Ga0207671_100821113 | 220 |
| 70 | 3300025924 | Ga0207694_10003225 | Ga0207694_100032252 | 220 |
| 71 | 3300025927 | Ga0207687_10261906 | Ga0207687_102619063 | 220 |
| 72 | 3300025934 | Ga0207686_10212487 | Ga0207686_102124872 | 220 |
| 73 | 3300025938 | Ga0207704_10197473 | Ga0207704_101974732 | 220 |
| 74 | 3300025945 | Ga0207679_10249708 | Ga0207679_102497082 | 220 |
| 75 | 3300026023 | Ga0207677_10040673 | Ga0207677_100406733 | 220 |
| 76 | 3300026041 | Ga0207639_10224491 | Ga0207639_102244912 | 220 |
| 77 | 3300026089 | Ga0207648_10005996 | Ga0207648_100059966 | 220 |
| 78 | 3300028379 | Ga0268266_10443567 | Ga0268266_104435672 | 220 |
| 79 | 3300037853 | Ga0436364_0366372 | Ga0436364_0366372_187476_188147 | 220 |
| 80 | 3300039447 | Ga0436361_0609953 | Ga0436361_0609953_65_730 | 220 |
| 81 | 3300039450 | Ga0436363_1403898 | Ga0436363_1403898_1596_2264 | 220 |
| 82 | 3300005563 | Ga0068855_100268608 | Ga0068855_1002686082 | 221 |
| 83 | 3300005614 | Ga0068856_100343267 | Ga0068856_1003432671 | 221 |
| 84 | 3300005718 | Ga0068866_10283551 | Ga0068866_102835512 | 221 |
| 85 | 3300009093 | Ga0105240_10215288 | Ga0105240_102152883 | 221 |
| 86 | 3300009147 | Ga0114129_10004476 | Ga0114129_1000447621 | 221 |
| 87 | 3300009545 | Ga0105237_10414022 | Ga0105237_104140223 | 221 |
| 88 | 3300013104 | Ga0157370_10268002 | Ga0157370_102680022 | 221 |
| 89 | 3300013105 | Ga0157369_10139984 | Ga0157369_101399843 | 221 |
| 90 | 3300025913 | Ga0207695_10157317 | Ga0207695_101573173 | 221 |
| 91 | 3300026089 | Ga0207648_10424551 | Ga0207648_104245513 | 221 |
| 92 | 3300039437 | Ga0436365_1607589 | Ga0436365_1607589_20_688 | 221 |
| 93 | 3300046679 | Ga0495623_0225085 | Ga0495623_0225085_102_776 | 221 |
| 94 | 3300050507 | nmdc:mga05p37_5417_c1 | nmdc:mga05p37_5417_c1_5783_6448 | 221 |
| 95 | 3300050508 | nmdc:mga09592_82694_c1 | nmdc:mga09592_82694_c1_1338_2003 | 221 |
| 96 | 3300050512 | nmdc:mga0n895_28278_c1 | nmdc:mga0n895_28278_c1_3953_4618 | 221 |
| 97 | 3300050514 | nmdc:mga08x19_666442_c1 | nmdc:mga08x19_666442_c1_60_725 | 221 |
| 98 | 3300050515 | nmdc:mga0a205_655287_c1 | nmdc:mga0a205_655287_c1_35_700 | 221 |
| 99 | 3300005614 | Ga0068856_100107317 | Ga0068856_1001073174 | 222 |
| 100 | 3300006028 | Ga0070717_10133567 | Ga0070717_101335672 | 222 |
| 101 | 3300026078 | Ga0207702_10267942 | Ga0207702_102679422 | 222 |
| 102 | 3300021361 | Ga0213872_10004078 | Ga0213872_100040786 | 223 |
| 103 | 3300039447 | Ga0436361_0410285 | Ga0436361_0410285_10973_11647 | 223 |
| 104 | 3300005329 | Ga0070683_100125751 | Ga0070683_1001257511 | 224 |
| 105 | 3300005336 | Ga0070680_100394310 | Ga0070680_1003943102 | 224 |
| 106 | 3300005437 | Ga0070710_10043828 | Ga0070710_100438284 | 224 |
| 107 | 3300005439 | Ga0070711_100020276 | Ga0070711_1000202765 | 224 |
| 108 | 3300005458 | Ga0070681_10076227 | Ga0070681_100762273 | 224 |
| 109 | 3300005535 | Ga0070684_100482515 | Ga0070684_1004825152 | 224 |
| 110 | 3300009093 | Ga0105240_10682801 | Ga0105240_106828012 | 224 |
| 111 | 3300009177 | Ga0105248_11345999 | Ga0105248_113459992 | 224 |
| 112 | 3300013102 | Ga0157371_10282864 | Ga0157371_102828641 | 224 |
| 113 | 3300013105 | Ga0157369_10104277 | Ga0157369_101042772 | 224 |
| 114 | 3300020069 | Ga0197907_10250949 | Ga0197907_102509495 | 224 |
| 115 | 3300025921 | Ga0207652_10155018 | Ga0207652_101550183 | 224 |
| 116 | 3300025929 | Ga0207664_10566147 | Ga0207664_105661472 | 224 |
| 117 | 3300025944 | Ga0207661_10289683 | Ga0207661_102896832 | 224 |
| 118 | 3300036401 | Ga0373937_0460345 | Ga0373937_0460345_304_993 | 224 |
| 119 | 3300037418 | Ga0395900_0428186 | Ga0395900_0428186_246_923 | 224 |
| 120 | 3300039447 | Ga0436361_0100788 | Ga0436361_0100788_59_736 | 224 |
| 121 | 3300039447 | Ga0436361_0467807 | Ga0436361_0467807_328_1005 | 224 |
| 122 | 3300039447 | Ga0436361_0659868 | Ga0436361_0659868_26_703 | 224 |
| 123 | 3300039447 | Ga0436361_0965656 | Ga0436361_0965656_59_736 | 224 |
| 124 | 3300048911 | Ga0496108_0153299 | Ga0496108_0153299_549_1226 | 224 |
| 125 | 3300048912 | Ga0496109_0300393 | Ga0496109_0300393_613_1326 | 224 |
| 126 | 3300053085 | Ga0495619_0560785 | Ga0495619_0560785_39_749 | 224 |
| 127 | 3300004799 | Ga0058863_11829770 | Ga0058863_118297705 | 225 |
| 128 | 3300004803 | Ga0058862_12048676 | Ga0058862_120486765 | 225 |
| 129 | 3300005336 | Ga0070680_100013125 | Ga0070680_1000131255 | 225 |
| 130 | 3300005336 | Ga0070680_100705011 | Ga0070680_1007050111 | 225 |
| 131 | 3300005337 | Ga0070682_100194196 | Ga0070682_1001941962 | 225 |
| 132 | 3300005434 | Ga0070709_10003886 | Ga0070709_100038861 | 225 |
| 133 | 3300005434 | Ga0070709_10022669 | Ga0070709_100226692 | 225 |
| 134 | 3300005434 | Ga0070709_10047969 | Ga0070709_100479693 | 225 |
| 135 | 3300005434 | Ga0070709_10320622 | Ga0070709_103206222 | 225 |
| 136 | 3300005435 | Ga0070714_100000312 | Ga0070714_10000031223 | 225 |
| 137 | 3300005435 | Ga0070714_100087027 | Ga0070714_1000870272 | 225 |
| 138 | 3300005435 | Ga0070714_100209702 | Ga0070714_1002097022 | 225 |
| 139 | 3300005436 | Ga0070713_100000461 | Ga0070713_1000004616 | 225 |
| 140 | 3300005436 | Ga0070713_100000811 | Ga0070713_10000081114 | 225 |
| 141 | 3300005436 | Ga0070713_100005052 | Ga0070713_1000050524 | 225 |
| 142 | 3300005436 | Ga0070713_100016950 | Ga0070713_1000169504 | 225 |
| 143 | 3300005437 | Ga0070710_10333522 | Ga0070710_103335222 | 225 |
| 144 | 3300005439 | Ga0070711_100316189 | Ga0070711_1003161892 | 225 |
| 145 | 3300005458 | Ga0070681_10004280 | Ga0070681_100042805 | 225 |
| 146 | 3300005458 | Ga0070681_10053259 | Ga0070681_100532595 | 225 |
| 147 | 3300005458 | Ga0070681_10189200 | Ga0070681_101892003 | 225 |
| 148 | 3300005467 | Ga0070706_100038376 | Ga0070706_1000383761 | 225 |
| 149 | 3300005471 | Ga0070698_100170272 | Ga0070698_1001702723 | 225 |
| 150 | 3300005530 | Ga0070679_100001261 | Ga0070679_10000126113 | 225 |
| 151 | 3300005530 | Ga0070679_100064046 | Ga0070679_1000640463 | 225 |
| 152 | 3300005530 | Ga0070679_100274184 | Ga0070679_1002741842 | 225 |
| 153 | 3300005545 | Ga0070695_100167310 | Ga0070695_1001673103 | 225 |
| 154 | 3300005614 | Ga0068856_100045456 | Ga0068856_1000454564 | 225 |
| 155 | 3300005614 | Ga0068856_100109303 | Ga0068856_1001093032 | 225 |
| 156 | 3300005614 | Ga0068856_100814014 | Ga0068856_1008140142 | 225 |
| 157 | 3300005616 | Ga0068852_100120749 | Ga0068852_1001207493 | 225 |
| 158 | 3300006028 | Ga0070717_10019257 | Ga0070717_100192573 | 225 |
| 159 | 3300006028 | Ga0070717_10072816 | Ga0070717_100728162 | 225 |
| 160 | 3300006028 | Ga0070717_10110366 | Ga0070717_101103662 | 225 |
| 161 | 3300006028 | Ga0070717_10321716 | Ga0070717_103217162 | 225 |
| 162 | 3300006028 | Ga0070717_10496420 | Ga0070717_104964202 | 225 |
| 163 | 3300006173 | Ga0070716_100002017 | Ga0070716_1000020172 | 225 |
| 164 | 3300006173 | Ga0070716_100008029 | Ga0070716_1000080294 | 225 |
| 165 | 3300006173 | Ga0070716_100158978 | Ga0070716_1001589782 | 225 |
| 166 | 3300006175 | Ga0070712_100000859 | Ga0070712_10000085910 | 225 |
| 167 | 3300006175 | Ga0070712_100031707 | Ga0070712_1000317073 | 225 |
| 168 | 3300006237 | Ga0097621_100187381 | Ga0097621_1001873812 | 225 |
| 169 | 3300006358 | Ga0068871_100072006 | Ga0068871_1000720063 | 225 |
| 170 | 3300009545 | Ga0105237_10706141 | Ga0105237_107061412 | 225 |
| 171 | 3300013100 | Ga0157373_10016567 | Ga0157373_100165673 | 225 |
| 172 | 3300013104 | Ga0157370_10029765 | Ga0157370_100297653 | 225 |
| 173 | 3300013104 | Ga0157370_10072712 | Ga0157370_100727123 | 225 |
| 174 | 3300013104 | Ga0157370_10313307 | Ga0157370_103133072 | 225 |
| 175 | 3300013105 | Ga0157369_10035063 | Ga0157369_100350636 | 225 |
| 176 | 3300013105 | Ga0157369_10392075 | Ga0157369_103920751 | 225 |
| 177 | 3300013296 | Ga0157374_10125007 | Ga0157374_101250072 | 225 |
| 178 | 3300013307 | Ga0157372_10028245 | Ga0157372_100282453 | 225 |
| 179 | 3300013307 | Ga0157372_10204886 | Ga0157372_102048863 | 225 |
| 180 | 3300013307 | Ga0157372_10327062 | Ga0157372_103270623 | 225 |
| 181 | 3300015265 | Ga0182005_1063068 | Ga0182005_10630682 | 225 |
| 182 | 3300020075 | Ga0206349_1461041 | Ga0206349_14610413 | 225 |
| 183 | 3300020082 | Ga0206353_10388689 | Ga0206353_103886893 | 225 |
| 184 | 3300025905 | Ga0207685_10019410 | Ga0207685_100194103 | 225 |
| 185 | 3300025906 | Ga0207699_10002137 | Ga0207699_100021374 | 225 |
| 186 | 3300025906 | Ga0207699_10330551 | Ga0207699_103305512 | 225 |
| 187 | 3300025906 | Ga0207699_10402628 | Ga0207699_104026282 | 225 |
| 188 | 3300025910 | Ga0207684_10061425 | Ga0207684_100614251 | 225 |
| 189 | 3300025911 | Ga0207654_10012653 | Ga0207654_100126532 | 225 |
| 190 | 3300025912 | Ga0207707_10001970 | Ga0207707_100019707 | 225 |
| 191 | 3300025912 | Ga0207707_10158884 | Ga0207707_101588843 | 225 |
| 192 | 3300025915 | Ga0207693_10000065 | Ga0207693_1000006570 | 225 |
| 193 | 3300025915 | Ga0207693_10000482 | Ga0207693_1000048218 | 225 |
| 194 | 3300025915 | Ga0207693_10042390 | Ga0207693_100423903 | 225 |
| 195 | 3300025915 | Ga0207693_10175691 | Ga0207693_101756913 | 225 |
| 196 | 3300025916 | Ga0207663_10002408 | Ga0207663_100024083 | 225 |
| 197 | 3300025916 | Ga0207663_10075021 | Ga0207663_100750212 | 225 |
| 198 | 3300025916 | Ga0207663_10271725 | Ga0207663_102717252 | 225 |
| 199 | 3300025916 | Ga0207663_10300519 | Ga0207663_103005192 | 225 |
| 200 | 3300025917 | Ga0207660_10000595 | Ga0207660_1000059512 | 225 |
| 201 | 3300025921 | Ga0207652_10001847 | Ga0207652_1000184713 | 225 |
| 202 | 3300025928 | Ga0207700_10000709 | Ga0207700_100007098 | 225 |
| 203 | 3300025928 | Ga0207700_10025560 | Ga0207700_100255603 | 225 |
| 204 | 3300025928 | Ga0207700_10058047 | Ga0207700_100580473 | 225 |
| 205 | 3300025929 | Ga0207664_10000031 | Ga0207664_1000003118 | 225 |
| 206 | 3300025929 | Ga0207664_10037185 | Ga0207664_100371853 | 225 |
| 207 | 3300025929 | Ga0207664_10392029 | Ga0207664_103920293 | 225 |
| 208 | 3300025939 | Ga0207665_10025914 | Ga0207665_100259143 | 225 |
| 209 | 3300025981 | Ga0207640_10087030 | Ga0207640_100870304 | 225 |
| 210 | 3300026041 | Ga0207639_10095819 | Ga0207639_100958193 | 225 |
| 211 | 3300026078 | Ga0207702_10019199 | Ga0207702_100191993 | 225 |
| 212 | 3300026078 | Ga0207702_10514438 | Ga0207702_105144382 | 225 |
| 213 | 3300028800 | Ga0265338_10001262 | Ga0265338_1000126218 | 225 |
| 214 | 3300028800 | Ga0265338_10063326 | Ga0265338_100633262 | 225 |
| 215 | 3300028800 | Ga0265338_10156657 | Ga0265338_101566572 | 225 |
| 216 | 3300031241 | Ga0265325_10020075 | Ga0265325_100200754 | 225 |
| 217 | 3300031241 | Ga0265325_10147850 | Ga0265325_101478502 | 225 |
| 218 | 3300031249 | Ga0265339_10063678 | Ga0265339_100636783 | 225 |
| 219 | 3300031249 | Ga0265339_10177553 | Ga0265339_101775532 | 225 |
| 220 | 3300031344 | Ga0265316_10013766 | Ga0265316_100137662 | 225 |
| 221 | 3300031344 | Ga0265316_10065278 | Ga0265316_100652783 | 225 |
| 222 | 3300031711 | Ga0265314_10019915 | Ga0265314_100199154 | 225 |
| 223 | 3300031712 | Ga0265342_10041920 | Ga0265342_100419202 | 225 |
| 224 | 3300035086 | Ga0373934_0011540 | Ga0373934_0011540_2237_2917 | 225 |
| 225 | 3300035086 | Ga0373934_0023365 | Ga0373934_0023365_556_1236 | 225 |
| 226 | 3300035089 | Ga0373944_0123122 | Ga0373944_0123122_159_839 | 225 |
| 227 | 3300035111 | Ga0373923_0000706 | Ga0373923_0000706_5809_6489 | 225 |
| 228 | 3300035113 | Ga0373936_0011848 | Ga0373936_0011848_1503_2183 | 225 |
| 229 | 3300035113 | Ga0373936_0029470 | Ga0373936_0029470_1028_1708 | 225 |
| 230 | 3300035117 | Ga0373953_0028995 | Ga0373953_0028995_78_758 | 225 |
| 231 | 3300035118 | Ga0373954_0017730 | Ga0373954_0017730_2145_2825 | 225 |
| 232 | 3300035119 | Ga0373956_0007239 | Ga0373956_0007239_3378_4058 | 225 |
| 233 | 3300035120 | Ga0373957_0055386 | Ga0373957_0055386_319_999 | 225 |
| 234 | 3300035170 | Ga0373943_0000043 | Ga0373943_0000043_19230_19910 | 225 |
| 235 | 3300035170 | Ga0373943_0244308 | Ga0373943_0244308_181_861 | 225 |
| 236 | 3300035171 | Ga0373946_0026108 | Ga0373946_0026108_87_767 | 225 |
| 237 | 3300035172 | Ga0373955_0062296 | Ga0373955_0062296_1187_1867 | 225 |
| 238 | 3300035172 | Ga0373955_0217816 | Ga0373955_0217816_68_748 | 225 |
| 239 | 3300035692 | Ga0373935_0001292 | Ga0373935_0001292_157_837 | 225 |
| 240 | 3300035692 | Ga0373935_0073349 | Ga0373935_0073349_348_1028 | 225 |
| 241 | 3300035695 | Ga0373927_0000213 | Ga0373927_0000213_13224_13904 | 225 |
| 242 | 3300035724 | Ga0373933_0005136 | Ga0373933_0005136_5290_5970 | 225 |
| 243 | 3300035724 | Ga0373933_0426267 | Ga0373933_0426267_165_845 | 225 |
| 244 | 3300035725 | Ga0373947_0010168 | Ga0373947_0010168_1693_2373 | 225 |
| 245 | 3300036401 | Ga0373937_0013467 | Ga0373937_0013467_6284_6964 | 225 |
| 246 | 3300037068 | Ga0373925_0004761 | Ga0373925_0004761_3039_3719 | 225 |
| 247 | 3300037068 | Ga0373925_0012688 | Ga0373925_0012688_282_962 | 225 |
| 248 | 3300037068 | Ga0373925_0201527 | Ga0373925_0201527_792_1472 | 225 |
| 249 | 3300037466 | Ga0395898_0079576 | Ga0395898_0079576_741_1430 | 225 |
| 250 | 3300037853 | Ga0436364_0977964 | Ga0436364_0977964_12711_13400 | 225 |
| 251 | 3300038443 | Ga0395901_0424409 | Ga0395901_0424409_57_746 | 225 |
| 252 | 3300039437 | Ga0436365_1731945 | Ga0436365_1731945_172_867 | 225 |
| 253 | 3300044694 | Ga0466963_0004026 | Ga0466963_0004026_870_1559 | 225 |
| 254 | 3300044706 | Ga0466964_0113232 | Ga0466964_0113232_338_1018 | 225 |
| 255 | 3300045976 | Ga0466967_0005621 | Ga0466967_0005621_7168_7857 | 225 |
| 256 | 3300046457 | Ga0495590_0101208 | Ga0495590_0101208_119_799 | 225 |
| 257 | 3300046459 | Ga0495629_0027893 | Ga0495629_0027893_1464_2144 | 225 |
| 258 | 3300046462 | Ga0495651_0141628 | Ga0495651_0141628_473_1153 | 225 |
| 259 | 3300046463 | Ga0495653_0523262 | Ga0495653_0523262_22_702 | 225 |
| 260 | 3300046472 | Ga0495580_0000098 | Ga0495580_0000098_25646_26326 | 225 |
| 261 | 3300046472 | Ga0495580_0007186 | Ga0495580_0007186_6794_7474 | 225 |
| 262 | 3300046472 | Ga0495580_0600068 | Ga0495580_0600068_22_702 | 225 |
| 263 | 3300046473 | Ga0495582_0004950 | Ga0495582_0004950_3544_4224 | 225 |
| 264 | 3300046473 | Ga0495582_0341817 | Ga0495582_0341817_88_768 | 225 |
| 265 | 3300046517 | Ga0495630_0052623 | Ga0495630_0052623_1735_2415 | 225 |
| 266 | 3300046517 | Ga0495630_0496063 | Ga0495630_0496063_58_738 | 225 |
| 267 | 3300046531 | Ga0495665_0032356 | Ga0495665_0032356_1957_2637 | 225 |
| 268 | 3300046531 | Ga0495665_0194002 | Ga0495665_0194002_308_988 | 225 |
| 269 | 3300046535 | Ga0495586_0125304 | Ga0495586_0125304_361_1041 | 225 |
| 270 | 3300046642 | Ga0495634_0410196 | Ga0495634_0410196_81_761 | 225 |
| 271 | 3300046678 | Ga0495599_0298581 | Ga0495599_0298581_207_887 | 225 |
| 272 | 3300046679 | Ga0495623_0222061 | Ga0495623_0222061_146_826 | 225 |
| 273 | 3300046683 | Ga0495658_0006758 | Ga0495658_0006758_2671_3351 | 225 |
| 274 | 3300046689 | Ga0495613_0024513 | Ga0495613_0024513_2126_2806 | 225 |
| 275 | 3300046690 | Ga0495624_0185047 | Ga0495624_0185047_132_812 | 225 |
| 276 | 3300047315 | Ga0495581_0110950 | Ga0495581_0110950_466_1146 | 225 |
| 277 | 3300047317 | Ga0495604_0278710 | Ga0495604_0278710_329_1009 | 225 |
| 278 | 3300047319 | Ga0495674_0028855 | Ga0495674_0028855_3744_4424 | 225 |
| 279 | 3300047319 | Ga0495674_0064013 | Ga0495674_0064013_898_1578 | 225 |
| 280 | 3300047319 | Ga0495674_0329659 | Ga0495674_0329659_171_851 | 225 |
| 281 | 3300047321 | Ga0495676_0185838 | Ga0495676_0185838_592_1272 | 225 |
| 282 | 3300047321 | Ga0495676_0395882 | Ga0495676_0395882_40_720 | 225 |
| 283 | 3300048088 | Ga0495602_0077822 | Ga0495602_0077822_1080_1760 | 225 |
| 284 | 3300048088 | Ga0495602_0513923 | Ga0495602_0513923_100_780 | 225 |
| 285 | 3300048903 | Ga0496100_0478304 | Ga0496100_0478304_13_693 | 225 |
| 286 | 3300048908 | Ga0496105_0617756 | Ga0496105_0617756_104_802 | 225 |
| 287 | 3300048915 | Ga0496112_0186909 | Ga0496112_0186909_92_790 | 225 |
| 288 | 3300048915 | Ga0496112_0753693 | Ga0496112_0753693_144_824 | 225 |
| 289 | 3300048918 | Ga0496115_0013084 | Ga0496115_0013084_5203_5883 | 225 |
| 290 | 3300001976 | JGI24752J21851_1001152 | JGI24752J21851_10011525 | 226 |
| 291 | 3300001978 | JGI24747J21853_1003561 | JGI24747J21853_10035613 | 226 |
| 292 | 3300001991 | JGI24743J22301_10003913 | JGI24743J22301_100039133 | 226 |
| 293 | 3300002074 | JGI24748J21848_1021423 | JGI24748J21848_10214231 | 226 |
| 294 | 3300002239 | JGI24034J26672_10003386 | JGI24034J26672_100033863 | 226 |
| 295 | 3300002459 | JGI24751J29686_10003121 | JGI24751J29686_100031213 | 226 |
| 296 | 3300005289 | Ga0065704_10030224 | Ga0065704_100302241 | 226 |
| 297 | 3300005327 | Ga0070658_10060388 | Ga0070658_100603885 | 226 |
| 298 | 3300005328 | Ga0070676_10020143 | Ga0070676_100201431 | 226 |
| 299 | 3300005329 | Ga0070683_100937459 | Ga0070683_1009374591 | 226 |
| 300 | 3300005330 | Ga0070690_100005406 | Ga0070690_1000054064 | 226 |
| 301 | 3300005334 | Ga0068869_100002075 | Ga0068869_10000207510 | 226 |
| 302 | 3300005334 | Ga0068869_100094684 | Ga0068869_1000946842 | 226 |
| 303 | 3300005335 | Ga0070666_10014527 | Ga0070666_100145273 | 226 |
| 304 | 3300005336 | Ga0070680_100146821 | Ga0070680_1001468212 | 226 |
| 305 | 3300005337 | Ga0070682_100384599 | Ga0070682_1003845991 | 226 |
| 306 | 3300005338 | Ga0068868_100034353 | Ga0068868_1000343531 | 226 |
| 307 | 3300005339 | Ga0070660_100002323 | Ga0070660_10000232315 | 226 |
| 308 | 3300005340 | Ga0070689_100010155 | Ga0070689_1000101556 | 226 |
| 309 | 3300005343 | Ga0070687_100026799 | Ga0070687_1000267995 | 226 |
| 310 | 3300005345 | Ga0070692_10095664 | Ga0070692_100956641 | 226 |
| 311 | 3300005347 | Ga0070668_100026756 | Ga0070668_1000267566 | 226 |
| 312 | 3300005353 | Ga0070669_100007907 | Ga0070669_1000079073 | 226 |
| 313 | 3300005354 | Ga0070675_100027978 | Ga0070675_1000279786 | 226 |
| 314 | 3300005356 | Ga0070674_100141445 | Ga0070674_1001414452 | 226 |
| 315 | 3300005364 | Ga0070673_100087014 | Ga0070673_1000870144 | 226 |
| 316 | 3300005365 | Ga0070688_100003715 | Ga0070688_1000037156 | 226 |
| 317 | 3300005366 | Ga0070659_100021584 | Ga0070659_1000215842 | 226 |
| 318 | 3300005367 | Ga0070667_100027044 | Ga0070667_1000270443 | 226 |
| 319 | 3300005438 | Ga0070701_10067483 | Ga0070701_100674834 | 226 |
| 320 | 3300005455 | Ga0070663_100032360 | Ga0070663_1000323604 | 226 |
| 321 | 3300005456 | Ga0070678_100056302 | Ga0070678_1000563022 | 226 |
| 322 | 3300005457 | Ga0070662_100003918 | Ga0070662_1000039183 | 226 |
| 323 | 3300005458 | Ga0070681_10033476 | Ga0070681_100334763 | 226 |
| 324 | 3300005458 | Ga0070681_10114708 | Ga0070681_101147082 | 226 |
| 325 | 3300005459 | Ga0068867_100157216 | Ga0068867_1001572164 | 226 |
| 326 | 3300005466 | Ga0070685_10005907 | Ga0070685_100059073 | 226 |
| 327 | 3300005535 | Ga0070684_100001340 | Ga0070684_1000013406 | 226 |
| 328 | 3300005539 | Ga0068853_100020779 | Ga0068853_1000207795 | 226 |
| 329 | 3300005543 | Ga0070672_100009518 | Ga0070672_1000095186 | 226 |
| 330 | 3300005544 | Ga0070686_100005016 | Ga0070686_1000050163 | 226 |
| 331 | 3300005546 | Ga0070696_100014118 | Ga0070696_1000141186 | 226 |
| 332 | 3300005549 | Ga0070704_100211167 | Ga0070704_1002111673 | 226 |
| 333 | 3300005563 | Ga0068855_100032862 | Ga0068855_1000328625 | 226 |
| 334 | 3300005563 | Ga0068855_100210920 | Ga0068855_1002109203 | 226 |
| 335 | 3300005564 | Ga0070664_100106939 | Ga0070664_1001069391 | 226 |
| 336 | 3300005577 | Ga0068857_100030940 | Ga0068857_1000309406 | 226 |
| 337 | 3300005614 | Ga0068856_100039461 | Ga0068856_1000394611 | 226 |
| 338 | 3300005616 | Ga0068852_100015942 | Ga0068852_1000159427 | 226 |
| 339 | 3300005618 | Ga0068864_100004944 | Ga0068864_1000049444 | 226 |
| 340 | 3300005718 | Ga0068866_10023518 | Ga0068866_100235185 | 226 |
| 341 | 3300005840 | Ga0068870_10009045 | Ga0068870_100090455 | 226 |
| 342 | 3300005842 | Ga0068858_100005966 | Ga0068858_1000059664 | 226 |
| 343 | 3300005844 | Ga0068862_100012300 | Ga0068862_1000123005 | 226 |
| 344 | 3300006028 | Ga0070717_10761921 | Ga0070717_107619211 | 226 |
| 345 | 3300006237 | Ga0097621_100002292 | Ga0097621_1000022929 | 226 |
| 346 | 3300006358 | Ga0068871_100037564 | Ga0068871_1000375645 | 226 |
| 347 | 3300006358 | Ga0068871_100525612 | Ga0068871_1005256122 | 226 |
| 348 | 3300006844 | Ga0075428_100042995 | Ga0075428_1000429954 | 226 |
| 349 | 3300006847 | Ga0075431_100138914 | Ga0075431_1001389143 | 226 |
| 350 | 3300006852 | Ga0075433_10950833 | Ga0075433_109508331 | 226 |
| 351 | 3300006871 | Ga0075434_100683074 | Ga0075434_1006830742 | 226 |
| 352 | 3300006881 | Ga0068865_100020424 | Ga0068865_1000204242 | 226 |
| 353 | 3300009093 | Ga0105240_10359704 | Ga0105240_103597041 | 226 |
| 354 | 3300009093 | Ga0105240_10458253 | Ga0105240_104582531 | 226 |
| 355 | 3300009098 | Ga0105245_10039878 | Ga0105245_100398784 | 226 |
| 356 | 3300009098 | Ga0105245_10286366 | Ga0105245_102863662 | 226 |
| 357 | 3300009101 | Ga0105247_10017015 | Ga0105247_100170151 | 226 |
| 358 | 3300009174 | Ga0105241_10013112 | Ga0105241_100131126 | 226 |
| 359 | 3300009174 | Ga0105241_10020850 | Ga0105241_100208503 | 226 |
| 360 | 3300009545 | Ga0105237_10046404 | Ga0105237_100464046 | 226 |
| 361 | 3300009545 | Ga0105237_10170269 | Ga0105237_101702692 | 226 |
| 362 | 3300009553 | Ga0105249_10041248 | Ga0105249_100412484 | 226 |
| 363 | 3300010375 | Ga0105239_10026459 | Ga0105239_100264595 | 226 |
| 364 | 3300011119 | Ga0105246_10003641 | Ga0105246_100036415 | 226 |
| 365 | 3300013100 | Ga0157373_10002403 | Ga0157373_1000240315 | 226 |
| 366 | 3300013105 | Ga0157369_10052447 | Ga0157369_100524476 | 226 |
| 367 | 3300013296 | Ga0157374_10004409 | Ga0157374_1000440912 | 226 |
| 368 | 3300013297 | Ga0157378_10001316 | Ga0157378_1000131619 | 226 |
| 369 | 3300013297 | Ga0157378_10368122 | Ga0157378_103681221 | 226 |
| 370 | 3300013306 | Ga0163162_10047635 | Ga0163162_100476356 | 226 |
| 371 | 3300013307 | Ga0157372_10057025 | Ga0157372_100570254 | 226 |
| 372 | 3300013308 | Ga0157375_10022594 | Ga0157375_100225945 | 226 |
| 373 | 3300014325 | Ga0163163_10017878 | Ga0163163_100178786 | 226 |
| 374 | 3300014326 | Ga0157380_10063996 | Ga0157380_100639961 | 226 |
| 375 | 3300014745 | Ga0157377_10000706 | Ga0157377_100007066 | 226 |
| 376 | 3300014968 | Ga0157379_10004045 | Ga0157379_1000404510 | 226 |
| 377 | 3300014968 | Ga0157379_10004057 | Ga0157379_100040575 | 226 |
| 378 | 3300021361 | Ga0213872_10003884 | Ga0213872_100038847 | 226 |
| 379 | 3300021361 | Ga0213872_10104135 | Ga0213872_101041352 | 226 |
| 380 | 3300021388 | Ga0213875_10004642 | Ga0213875_100046426 | 226 |
| 381 | 3300021441 | Ga0213871_10041496 | Ga0213871_100414962 | 226 |
| 382 | 3300024225 | Ga0224572_1024224 | Ga0224572_10242242 | 226 |
| 383 | 3300024227 | Ga0228598_1027117 | Ga0228598_10271172 | 226 |
| 384 | 3300025315 | Ga0207697_10016346 | Ga0207697_100163462 | 226 |
| 385 | 3300025900 | Ga0207710_10026490 | Ga0207710_100264902 | 226 |
| 386 | 3300025901 | Ga0207688_10097038 | Ga0207688_100970384 | 226 |
| 387 | 3300025903 | Ga0207680_10086289 | Ga0207680_100862891 | 226 |
| 388 | 3300025904 | Ga0207647_10012625 | Ga0207647_100126256 | 226 |
| 389 | 3300025907 | Ga0207645_10000309 | Ga0207645_1000030940 | 226 |
| 390 | 3300025908 | Ga0207643_10002124 | Ga0207643_100021243 | 226 |
| 391 | 3300025909 | Ga0207705_10045538 | Ga0207705_100455385 | 226 |
| 392 | 3300025911 | Ga0207654_10087656 | Ga0207654_100876562 | 226 |
| 393 | 3300025912 | Ga0207707_10446859 | Ga0207707_104468592 | 226 |
| 394 | 3300025913 | Ga0207695_10184551 | Ga0207695_101845512 | 226 |
| 395 | 3300025913 | Ga0207695_10277150 | Ga0207695_102771502 | 226 |
| 396 | 3300025913 | Ga0207695_10582851 | Ga0207695_105828512 | 226 |
| 397 | 3300025914 | Ga0207671_10168656 | Ga0207671_101686561 | 226 |
| 398 | 3300025915 | Ga0207693_10092755 | Ga0207693_100927552 | 226 |
| 399 | 3300025917 | Ga0207660_10475612 | Ga0207660_104756121 | 226 |
| 400 | 3300025918 | Ga0207662_10006490 | Ga0207662_100064904 | 226 |
| 401 | 3300025919 | Ga0207657_10003047 | Ga0207657_1000304721 | 226 |
| 402 | 3300025921 | Ga0207652_10257335 | Ga0207652_102573352 | 226 |
| 403 | 3300025923 | Ga0207681_10135518 | Ga0207681_101355183 | 226 |
| 404 | 3300025923 | Ga0207681_10176076 | Ga0207681_101760761 | 226 |
| 405 | 3300025925 | Ga0207650_10000051 | Ga0207650_1000005174 | 226 |
| 406 | 3300025925 | Ga0207650_10000252 | Ga0207650_1000025216 | 226 |
| 407 | 3300025926 | Ga0207659_10009683 | Ga0207659_100096834 | 226 |
| 408 | 3300025927 | Ga0207687_10040232 | Ga0207687_100402325 | 226 |
| 409 | 3300025927 | Ga0207687_10113584 | Ga0207687_101135842 | 226 |
| 410 | 3300025927 | Ga0207687_10433965 | Ga0207687_104339652 | 226 |
| 411 | 3300025931 | Ga0207644_10050270 | Ga0207644_100502705 | 226 |
| 412 | 3300025932 | Ga0207690_10015755 | Ga0207690_100157555 | 226 |
| 413 | 3300025936 | Ga0207670_10018942 | Ga0207670_100189422 | 226 |
| 414 | 3300025937 | Ga0207669_10185292 | Ga0207669_101852922 | 226 |
| 415 | 3300025939 | Ga0207665_10122414 | Ga0207665_101224142 | 226 |
| 416 | 3300025940 | Ga0207691_10000160 | Ga0207691_1000016039 | 226 |
| 417 | 3300025941 | Ga0207711_10023707 | Ga0207711_100237076 | 226 |
| 418 | 3300025942 | Ga0207689_10017984 | Ga0207689_100179843 | 226 |
| 419 | 3300025945 | Ga0207679_10000039 | Ga0207679_1000003988 | 226 |
| 420 | 3300025949 | Ga0207667_10023920 | Ga0207667_100239205 | 226 |
| 421 | 3300025972 | Ga0207668_10012738 | Ga0207668_100127386 | 226 |
| 422 | 3300025986 | Ga0207658_10021343 | Ga0207658_100213436 | 226 |
| 423 | 3300026023 | Ga0207677_10275174 | Ga0207677_102751742 | 226 |
| 424 | 3300026078 | Ga0207702_10048089 | Ga0207702_100480891 | 226 |
| 425 | 3300026088 | Ga0207641_10000025 | Ga0207641_10000025147 | 226 |
| 426 | 3300026089 | Ga0207648_10001401 | Ga0207648_100014011 | 226 |
| 427 | 3300026095 | Ga0207676_10000104 | Ga0207676_1000010456 | 226 |
| 428 | 3300026116 | Ga0207674_10004790 | Ga0207674_100047908 | 226 |
| 429 | 3300026118 | Ga0207675_100011876 | Ga0207675_1000118763 | 226 |
| 430 | 3300026118 | Ga0207675_100342266 | Ga0207675_1003422662 | 226 |
| 431 | 3300026121 | Ga0207683_10000385 | Ga0207683_1000038531 | 226 |
| 432 | 3300028017 | Ga0265356_1006537 | Ga0265356_10065372 | 226 |
| 433 | 3300028379 | Ga0268266_10003476 | Ga0268266_1000347611 | 226 |
| 434 | 3300028380 | Ga0268265_10066483 | Ga0268265_100664833 | 226 |
| 435 | 3300028381 | Ga0268264_10422940 | Ga0268264_104229401 | 226 |
| 436 | 3300030760 | Ga0265762_1000827 | Ga0265762_10008276 | 226 |
| 437 | 3300031090 | Ga0265760_10016875 | Ga0265760_100168751 | 226 |
| 438 | 3300031548 | Ga0307408_100107305 | Ga0307408_1001073053 | 226 |
| 439 | 3300031995 | Ga0307409_100031101 | Ga0307409_1000311013 | 226 |
| 440 | 3300032002 | Ga0307416_100153564 | Ga0307416_1001535643 | 226 |
| 441 | 3300035112 | Ga0373932_0000318 | Ga0373932_0000318_9945_10649 | 226 |
| 442 | 3300035691 | Ga0373931_0029217 | Ga0373931_0029217_1847_2530 | 226 |
| 443 | 3300035695 | Ga0373927_0064558 | Ga0373927_0064558_135_818 | 226 |
| 444 | 3300036401 | Ga0373937_0268230 | Ga0373937_0268230_388_1083 | 226 |
| 445 | 3300037068 | Ga0373925_0049441 | Ga0373925_0049441_1635_2330 | 226 |
| 446 | 3300039438 | Ga0436360_0379337 | Ga0436360_0379337_584_1273 | 226 |
| 447 | 3300039447 | Ga0436361_0772461 | Ga0436361_0772461_889_1572 | 226 |
| 448 | 3300039447 | Ga0436361_0819333 | Ga0436361_0819333_452_1141 | 226 |
| 449 | 3300039447 | Ga0436361_0868431 | Ga0436361_0868431_5228_5920 | 226 |
| 450 | 3300042876 | Ga0451577_0544485 | Ga0451577_0544485_135_818 | 226 |
| 451 | 3300045976 | Ga0466967_0157004 | Ga0466967_0157004_21_704 | 226 |
| 452 | 3300046472 | Ga0495580_0000588 | Ga0495580_0000588_7536_8219 | 226 |
| 453 | 3300046473 | Ga0495582_0140409 | Ga0495582_0140409_656_1339 | 226 |
| 454 | 3300046531 | Ga0495665_0019228 | Ga0495665_0019228_260_943 | 226 |
| 455 | 3300046680 | Ga0495646_0210954 | Ga0495646_0210954_137_823 | 226 |
| 456 | 3300046684 | Ga0495669_0248754 | Ga0495669_0248754_66_746 | 226 |
| 457 | 3300048903 | Ga0496100_0342602 | Ga0496100_0342602_150_833 | 226 |
| 458 | 3300048904 | Ga0496101_0033289 | Ga0496101_0033289_2768_3448 | 226 |
| 459 | 3300048905 | Ga0496102_0000641 | Ga0496102_0000641_28286_28969 | 226 |
| 460 | 3300048906 | Ga0496103_0000987 | Ga0496103_0000987_6675_7358 | 226 |
| 461 | 3300048906 | Ga0496103_0223906 | Ga0496103_0223906_427_1107 | 226 |
| 462 | 3300048907 | Ga0496104_0013455 | Ga0496104_0013455_4646_5329 | 226 |
| 463 | 3300048909 | Ga0496106_0255614 | Ga0496106_0255614_452_1135 | 226 |
| 464 | 3300048912 | Ga0496109_0000072 | Ga0496109_0000072_72514_73194 | 226 |
| 465 | 3300048913 | Ga0496110_0002647 | Ga0496110_0002647_12174_12854 | 226 |
| 466 | 3300048915 | Ga0496112_0000043 | Ga0496112_0000043_86589_87269 | 226 |
| 467 | 3300048915 | Ga0496112_0217290 | Ga0496112_0217290_783_1469 | 226 |
| 468 | 3300048915 | Ga0496112_0680202 | Ga0496112_0680202_47_736 | 226 |
| 469 | 3300048916 | Ga0496113_0000698 | Ga0496113_0000698_2288_2968 | 226 |
| 470 | 3300048918 | Ga0496115_0063695 | Ga0496115_0063695_128_808 | 226 |
| 471 | 3300049568 | Ga0501031_0109166 | Ga0501031_0109166_863_1552 | 226 |
| 472 | 3300049575 | Ga0501039_0178506 | Ga0501039_0178506_731_1420 | 226 |
| 473 | 3300049578 | Ga0501042_0055114 | Ga0501042_0055114_372_1061 | 226 |
| 474 | 3300049579 | Ga0501043_0376565 | Ga0501043_0376565_85_774 | 226 |
| 475 | 3300049582 | Ga0501048_0501405 | Ga0501048_0501405_148_837 | 226 |
| 476 | 3300049584 | Ga0501068_0154228 | Ga0501068_0154228_119_808 | 226 |
| 477 | 3300049587 | Ga0501071_0000584 | Ga0501071_0000584_630_1319 | 226 |
| 478 | 3300049588 | Ga0501072_0228570 | Ga0501072_0228570_727_1416 | 226 |
| 479 | 3300049591 | Ga0501075_0042834 | Ga0501075_0042834_2424_3113 | 226 |
| 480 | 3300049592 | Ga0501076_0005793 | Ga0501076_0005793_3145_3834 | 226 |
| 481 | 3300049592 | Ga0501076_0422170 | Ga0501076_0422170_14_700 | 226 |
| 482 | 3300049593 | Ga0501077_0005097 | Ga0501077_0005097_7042_7731 | 226 |
| 483 | 3300049741 | Ga0501079_0037207 | Ga0501079_0037207_1585_2274 | 226 |
| 484 | 3300049742 | Ga0501080_0125306 | Ga0501080_0125306_1483_2172 | 226 |
| 485 | 3300054114 | Ga0501084_0304547 | Ga0501084_0304547_372_1061 | 226 |
| 486 | 3300061734 | Ga0530510_0079883 | Ga0530510_0079883_1675_2364 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wsm-assembly1.cif.gz_A | crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus | 0.9395 | 14 | 217 |
| 2hf9-assembly1.cif.gz_A | crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form | 0.9393 | 12 | 219 |
| 2wsm-assembly1.cif.gz_B | crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus | 0.9356 | 13 | 215 |
| 2wsm-assembly1.cif.gz_A | crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus | 0.9307 | 14 | 217 |
| 2wsm-assembly1.cif.gz_B | crystal structure of hydrogenase maturation factor hypb from archaeoglobus fulgidus | 0.9259 | 13 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wsmA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9395 | 14 | 217 | 3.40.50.300 |
| af_P0AAN3_68_289_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9365 | 1 | 217 | 3.40.50.300 |
| 2wsmA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9307 | 14 | 217 | 3.40.50.300 |
| af_P0AAN3_68_289_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9122 | 1 | 217 | 3.40.50.300 |
| 4lpsB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8996 | 16 | 226 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A178TS71-F1-model_v4 | deleted | 0.9757 | 15 | 221 |
|
| AF-I0I808-F1-model_v4 | Hydrogenase nickel incorporation protein HypB | 0.9715 | 17 | 221 |
GO:0003924
GO:0005525 GO:0008270 GO:0016151 GO:0051604 |
| AF-A0A2V9ZYH2-F1-model_v4 | Uncharacterized protein | 0.9709 | 139 | 219 |
GO:0003924
GO:0005525 GO:0008270 GO:0016151 GO:0051604 |
| AF-A0A7W1KY14-F1-model_v4 | Hydrogenase nickel incorporation protein HypB | 0.9701 | 1 | 223 |
GO:0003924
GO:0005525 GO:0008270 GO:0016151 GO:0051604 |
| AF-A0A7C5E1T3-F1-model_v4 | Hydrogenase accessory protein HypB | 0.9691 | 2 | 220 |
GO:0003924
GO:0005525 GO:0008270 GO:0016151 GO:0051604 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar