F453339

General Info

Members Datasets Scaffolds Average Seq Length
486 267 972 241

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0039354|Ga0496102_0039354_1975_2730
Length 251
Sequence VSTTPTDLELDATPWTEEEFTAALREQGERYHDQHPFHQRMNAGDLSAEELRRWVANRYYYQRSIPIKDAAILSNCPEVEIRREWISRIFDHDGKEGESSGGIESWLRLGESLGVDRDEIRSERLVLPGVRYSVDAYVNFCRQEPWVFAVASSLTELFGPGAIKVRLAAMEEHYPWIDPAGLEYFRARLTLAPRDAQYALGVTLERCRTRADQQRAVAALAFKTDLLWAQLDAIDRGDTRPEAARPAAAGD

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
253 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
259 2582580736 Prauserella sp. Am3 Isolate Unclassified
260 2671180694 Paenibacillus sp. A3 Isolate Unclassified
261 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
262 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
263 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
264 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
265 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
266 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
267 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0.41
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 9.26
Rhizosphere 79.84
Stem 0
Stem Tuber 0.21
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0039354 3300048905 Bacteria 4272
2 JGI25406J46586_10001748 3300003203 Bacteria 10218
3 JGI25406J46586_10035784 3300003203 Bacteria 1809
4 JGI25406J46586_10074691 3300003203 Bacteria 1054
5 rootH1_10077203 3300003316 Bacteria 1190
6 JGI25407J50210_10001042 3300003373 Bacteria 6088
7 JGI25407J50210_10024896 3300003373 Bacteria 1552
8 JGI25407J50210_10038035 3300003373 Bacteria 1235
9 Ga0070683_100028290 3300005329 Bacteria 5065
10 Ga0068869_100110593 3300005334 Bacteria 2090
11 Ga0070666_10007862 3300005335 Bacteria 6587
12 Ga0070682_100052910 3300005337 Bacteria 2542
13 Ga0068868_100087584 3300005338 Bacteria 2504
14 Ga0068868_100282354 3300005338 Bacteria 1405
15 Ga0070660_100166831 3300005339 Bacteria 1777
16 Ga0070687_100021371 3300005343 Bacteria 3041
17 Ga0070675_100580376 3300005354 Bacteria 1016
18 Ga0070671_100144175 3300005355 Bacteria 2010
19 Ga0070674_100140805 3300005356 Bacteria 1810
20 Ga0070688_100247622 3300005365 Bacteria 1268
21 Ga0070659_100035081 3300005366 Bacteria 3904
22 Ga0070659_100272472 3300005366 Bacteria 1407
23 Ga0070714_100005711 3300005435 Bacteria 9533
24 Ga0070714_100616578 3300005435 Bacteria 1043
25 Ga0070714_100771011 3300005435 Bacteria 930
26 Ga0070713_100033486 3300005436 Bacteria 4117
27 Ga0070713_100104095 3300005436 Bacteria 2464
28 Ga0070713_100192528 3300005436 Bacteria 1838
29 Ga0070713_100451669 3300005436 Bacteria 1207
30 Ga0070710_10016341 3300005437 Bacteria 3774
31 Ga0070701_10021262 3300005438 Bacteria 3093
32 Ga0070711_100110623 3300005439 Bacteria 2016
33 Ga0070700_100024644 3300005441 Bacteria 3535
34 Ga0070700_100154752 3300005441 Bacteria 1572
35 Ga0070708_100493396 3300005445 Bacteria 1155
36 Ga0070663_100040522 3300005455 Bacteria 3261
37 Ga0070663_100076184 3300005455 Bacteria 2453
38 Ga0068867_100055740 3300005459 Bacteria 2923
39 Ga0070685_10025538 3300005466 Bacteria 3252
40 Ga0070706_100109455 3300005467 Bacteria 2571
41 Ga0070707_100370359 3300005468 Bacteria 1392
42 Ga0070698_100484690 3300005471 Bacteria 1174
43 Ga0070684_100363235 3300005535 Bacteria 1332
44 Ga0070684_100395437 3300005535 Bacteria 1274
45 Ga0070697_100240750 3300005536 Bacteria 1545
46 Ga0068853_100158017 3300005539 Bacteria 2044
47 Ga0070686_100036481 3300005544 Bacteria 3044
48 Ga0070686_100214775 3300005544 Bacteria 1387
49 Ga0070665_100004766 3300005548 Bacteria 14124
50 Ga0070665_100093531 3300005548 Bacteria 3011
51 Ga0070664_100347970 3300005564 Bacteria 1347
52 Ga0068854_100077163 3300005578 Bacteria 2451
53 Ga0068854_100115286 3300005578 Bacteria 2032
54 Ga0068856_100570460 3300005614 Bacteria 1153
55 Ga0070702_100002852 3300005615 Bacteria 7584
56 Ga0070702_100016670 3300005615 Bacteria 3774
57 Ga0070702_100045980 3300005615 Bacteria 2472
58 Ga0068859_100075146 3300005617 Bacteria 3419
59 Ga0068859_100481317 3300005617 Bacteria 1337
60 Ga0068861_100012298 3300005719 Bacteria 5970
61 Ga0068861_100066224 3300005719 Bacteria 2784
62 Ga0068870_10094575 3300005840 Bacteria 1677
63 Ga0068863_100482944 3300005841 Bacteria 1219
64 Ga0068858_100182228 3300005842 Bacteria 1983
65 Ga0068860_100180282 3300005843 Bacteria 2041
66 Ga0068862_100184617 3300005844 Bacteria 1873
67 Ga0081455_10019046 3300005937 Bacteria 6510
68 Ga0081455_10062532 3300005937 Bacteria 3128
69 Ga0081455_10208785 3300005937 Bacteria 1456
70 Ga0081455_10282815 3300005937 Bacteria 1198
71 Ga0081538_10000166 3300005981 Bacteria 70452
72 Ga0081538_10000397 3300005981 Bacteria 49637
73 Ga0081538_10003581 3300005981 Bacteria 14605
74 Ga0081538_10012197 3300005981 Bacteria 6905
75 Ga0081538_10022436 3300005981 Bacteria 4573
76 Ga0081538_10030133 3300005981 Bacteria 3690
77 Ga0081538_10031615 3300005981 Bacteria 3565
78 Ga0081538_10041441 3300005981 Bacteria 2922
79 Ga0081538_10053997 3300005981 Bacteria 2381
80 Ga0081538_10064082 3300005981 Bacteria 2081
81 Ga0081538_10082590 3300005981 Bacteria 1702
82 Ga0081540_1000312 3300005983 Bacteria 50256
83 Ga0081539_10000834 3300005985 Bacteria 59270
84 Ga0081539_10001410 3300005985 Bacteria 41377
85 Ga0081539_10004305 3300005985 Bacteria 15916
86 Ga0081539_10141782 3300005985 Bacteria 1167
87 Ga0070717_10006583 3300006028 Bacteria 8560
88 Ga0070712_100003261 3300006175 Bacteria 9990
89 Ga0070712_100451075 3300006175 Bacteria 1071
90 Ga0075428_100026618 3300006844 Bacteria 6404
91 Ga0075428_100049486 3300006844 Bacteria 4611
92 Ga0075430_100005761 3300006846 Bacteria 10452
93 Ga0075431_100004111 3300006847 Bacteria 14211
94 Ga0075431_100500262 3300006847 Bacteria 1207
95 Ga0075429_100199539 3300006880 Bacteria 1753
96 Ga0068865_100016112 3300006881 Bacteria 4775
97 Ga0068865_100807493 3300006881 Bacteria 810
98 Ga0097620_100046102 3300006931 Bacteria 4379
99 Ga0097620_100075152 3300006931 Bacteria 3419
100 Ga0097620_100481353 3300006931 Bacteria 1337
101 Ga0111539_10019012 3300009094 Bacteria 8493
102 Ga0105245_10052777 3300009098 Bacteria 3647
103 Ga0105247_10316240 3300009101 Bacteria 1088
104 Ga0114129_10640487 3300009147 Bacteria 1373
105 Ga0105243_10006281 3300009148 Bacteria 9183
106 Ga0105243_10225864 3300009148 Bacteria 1658
107 Ga0105243_10597402 3300009148 Bacteria 1062
108 Ga0105241_10484737 3300009174 Bacteria 1100
109 Ga0105241_10972255 3300009174 Bacteria 793
110 Ga0105242_10097095 3300009176 Bacteria 2491
111 Ga0105242_10283960 3300009176 Bacteria 1504
112 Ga0105238_10163838 3300009551 Bacteria 2199
113 Ga0105238_10386910 3300009551 Bacteria 1391
114 Ga0105238_10827767 3300009551 Bacteria 942
115 Ga0105249_10078315 3300009553 Bacteria 3067
116 Ga0105249_10153954 3300009553 Bacteria 2216
117 Ga0105239_10166547 3300010375 Bacteria 2465
118 Ga0105239_10180397 3300010375 Bacteria 2362
119 Ga0105239_10376494 3300010375 Bacteria 1605
120 Ga0105246_10137645 3300011119 Bacteria 1832
121 Ga0157369_10938269 3300013105 Bacteria 887
122 Ga0163162_10323887 3300013306 Bacteria 1673
123 Ga0163162_11587974 3300013306 Bacteria 746
124 Ga0157372_10530502 3300013307 Bacteria 1372
125 Ga0157372_11218851 3300013307 Bacteria 869
126 Ga0157375_10477825 3300013308 Bacteria 1411
127 Ga0157380_10466586 3300014326 Bacteria 1217
128 Ga0157380_10926269 3300014326 Bacteria 899
129 Ga0157377_10065038 3300014745 Bacteria 2094
130 Ga0157379_10660523 3300014968 Bacteria 979
131 Ga0197907_11205223 3300020069 Bacteria 1465
132 Ga0213874_10002835 3300021377 Bacteria 3778
133 Ga0213874_10010278 3300021377 Bacteria 2339
134 Ga0213874_10021603 3300021377 Bacteria 1777
135 Ga0213874_10023558 3300021377 Bacteria 1719
136 Ga0213876_10004253 3300021384 Bacteria 8027
137 Ga0213876_10070429 3300021384 Bacteria 1848
138 Ga0213875_10000286 3300021388 Bacteria 49191
139 Ga0213875_10008974 3300021388 Bacteria 5090
140 Ga0213875_10076403 3300021388 Bacteria 1563
141 Ga0209676_1043232 3300025292 Bacteria 1245
142 Ga0207656_10064886 3300025321 Bacteria 1611
143 Ga0207692_10092463 3300025898 Bacteria 1643
144 Ga0207710_10058561 3300025900 Bacteria 1742
145 Ga0207688_10025786 3300025901 Bacteria 3231
146 Ga0207688_10116009 3300025901 Bacteria 1559
147 Ga0207680_10002409 3300025903 Bacteria 8717
148 Ga0207647_10038807 3300025904 Bacteria 3009
149 Ga0207699_10011056 3300025906 Bacteria 4548
150 Ga0207699_10247429 3300025906 Bacteria 1227
151 Ga0207645_10226121 3300025907 Bacteria 1234
152 Ga0207643_10041113 3300025908 Bacteria 2604
153 Ga0207684_10034978 3300025910 Bacteria 4267
154 Ga0207695_10234383 3300025913 Bacteria 1738
155 Ga0207693_10000657 3300025915 Bacteria 31001
156 Ga0207663_10098044 3300025916 Bacteria 1962
157 Ga0207662_10054196 3300025918 Bacteria 2391
158 Ga0207646_10827661 3300025922 Bacteria 823
159 Ga0207694_10108998 3300025924 Bacteria 2201
160 Ga0207650_10285781 3300025925 Bacteria 1344
161 Ga0207650_10514119 3300025925 Bacteria 1002
162 Ga0207687_10187795 3300025927 Bacteria 1606
163 Ga0207687_10303016 3300025927 Bacteria 1288
164 Ga0207700_10025022 3300025928 Bacteria 4140
165 Ga0207700_10037215 3300025928 Bacteria 3522
166 Ga0207700_10361315 3300025928 Bacteria 1266
167 Ga0207664_10028156 3300025929 Bacteria 4267
168 Ga0207664_10028223 3300025929 Bacteria 4263
169 Ga0207644_10489382 3300025931 Bacteria 1014
170 Ga0207690_10020818 3300025932 Bacteria 4059
171 Ga0207706_10243442 3300025933 Bacteria 1572
172 Ga0207709_10006789 3300025935 Bacteria 6403
173 Ga0207709_10017149 3300025935 Bacteria 4037
174 Ga0207709_10086294 3300025935 Bacteria 2037
175 Ga0207709_10251978 3300025935 Bacteria 1290
176 Ga0207704_10497968 3300025938 Bacteria 981
177 Ga0207665_10054955 3300025939 Bacteria 2685
178 Ga0207691_10365712 3300025940 Bacteria 1233
179 Ga0207689_10046785 3300025942 Bacteria 3574
180 Ga0207661_10013518 3300025944 Bacteria 5961
181 Ga0207661_10040193 3300025944 Bacteria 3675
182 Ga0207661_10427932 3300025944 Bacteria 1203
183 Ga0207667_10655526 3300025949 Bacteria 1055
184 Ga0207712_10166567 3300025961 Bacteria 1718
185 Ga0207712_10214252 3300025961 Bacteria 1536
186 Ga0207712_10358452 3300025961 Bacteria 1214
187 Ga0207668_10166513 3300025972 Bacteria 1724
188 Ga0207668_10415953 3300025972 Bacteria 1140
189 Ga0207640_10044438 3300025981 Bacteria 2846
190 Ga0207640_10180096 3300025981 Bacteria 1584
191 Ga0207640_10320561 3300025981 Bacteria 1234
192 Ga0207640_10427549 3300025981 Bacteria 1085
193 Ga0207658_10005109 3300025986 Bacteria 9034
194 Ga0207677_10009211 3300026023 Bacteria 5545
195 Ga0207703_10032908 3300026035 Bacteria 4107
196 Ga0207639_10080440 3300026041 Bacteria 2577
197 Ga0207678_10058378 3300026067 Bacteria 3320
198 Ga0207678_10098259 3300026067 Bacteria 2501
199 Ga0207708_10005637 3300026075 Bacteria 9244
200 Ga0207708_10030416 3300026075 Bacteria 4093
201 Ga0207708_10165305 3300026075 Bacteria 1749
202 Ga0207702_10230256 3300026078 Bacteria 1731
203 Ga0207648_10111110 3300026089 Bacteria 2406
204 Ga0207674_10341047 3300026116 Bacteria 1449
205 Ga0207675_100005705 3300026118 Bacteria 11914
206 Ga0207675_100524583 3300026118 Bacteria 1181
207 Ga0207683_10257368 3300026121 Bacteria 1593
208 Ga0207683_10327935 3300026121 Bacteria 1403
209 Ga0207698_10050583 3300026142 Bacteria 3171
210 Ga0207698_10335161 3300026142 Bacteria 1423
211 Ga0207428_10079210 3300027907 Bacteria 2569
212 Ga0207428_10202117 3300027907 Bacteria 1495
213 Ga0268266_10000233 3300028379 Bacteria 95854
214 Ga0307515_10400518 3300028794 Bacteria 998
215 Ga0265760_10044344 3300031090 Bacteria 1331
216 Ga0265320_10001568 3300031240 Bacteria 16431
217 Ga0265314_10005431 3300031711 Bacteria 11508
218 Ga0307405_10191261 3300031731 Bacteria 1478
219 Ga0307413_10028402 3300031824 Bacteria 3115
220 Ga0307413_10069549 3300031824 Bacteria 2210
221 Ga0307413_10235060 3300031824 Bacteria 1349
222 Ga0307413_10384120 3300031824 Bacteria 1095
223 Ga0307518_10046638 3300031838 Bacteria 3151
224 Ga0307410_10012908 3300031852 Bacteria 4852
225 Ga0307410_10020084 3300031852 Bacteria 4079
226 Ga0307410_10598625 3300031852 Bacteria 919
227 Ga0307406_10022258 3300031901 Bacteria 3758
228 Ga0307406_10507361 3300031901 Bacteria 979
229 Ga0307407_10018455 3300031903 Bacteria 3529
230 Ga0307407_10088423 3300031903 Bacteria 1893
231 Ga0307412_10023054 3300031911 Bacteria 3826
232 Ga0307409_100091796 3300031995 Bacteria 2490
233 Ga0307409_100096959 3300031995 Bacteria 2434
234 Ga0307409_100097501 3300031995 Bacteria 2428
235 Ga0307409_100366810 3300031995 Bacteria 1364
236 Ga0307409_100583473 3300031995 Bacteria 1102
237 Ga0307416_100002309 3300032002 Bacteria 10896
238 Ga0307416_100110753 3300032002 Bacteria 2418
239 Ga0307416_100112035 3300032002 Bacteria 2407
240 Ga0307416_100136855 3300032002 Bacteria 2218
241 Ga0307416_100179234 3300032002 Bacteria 1984
242 Ga0307416_100537657 3300032002 Bacteria 1240
243 Ga0307416_100670020 3300032002 Bacteria 1124
244 Ga0307411_10098991 3300032005 Bacteria 2057
245 Ga0307411_10693078 3300032005 Bacteria 886
246 Ga0307415_100025921 3300032126 Bacteria 3689
247 Ga0307415_100538523 3300032126 Bacteria 1028
248 Ga0307415_100724981 3300032126 Bacteria 900
249 Ga0373956_0179430 3300035119 Bacteria 1001
250 Ga0316574_0059813 3300035398 Bacteria 2390
251 Ga0373937_0544466 3300036401 Bacteria 1102
252 Ga0373925_0360085 3300037068 Bacteria 1182
253 Ga0395900_0520797 3300037418 Bacteria 1137
254 Ga0436364_0233629 3300037853 Bacteria 2404
255 Ga0436364_0276493 3300037853 Bacteria 6210
256 Ga0436364_0426354 3300037853 Bacteria 7347
257 Ga0436364_0751774 3300037853 Bacteria 12115
258 Ga0436364_1027295 3300037853 Bacteria 21751
259 Ga0436364_1299740 3300037853 Bacteria 98238
260 Ga0436364_1542327 3300037853 Bacteria 2575
261 Ga0395901_0848052 3300038443 Bacteria 899
262 Ga0436365_0250149 3300039437 Bacteria 12865
263 Ga0436365_0556685 3300039437 Bacteria 7702
264 Ga0436365_0936576 3300039437 Bacteria 1487
265 Ga0436365_0973958 3300039437 Bacteria 767
266 Ga0436365_1608073 3300039437 Bacteria 6656
267 Ga0436365_1674624 3300039437 Bacteria 2789
268 Ga0436360_0545149 3300039438 Bacteria 6092
269 Ga0436361_1110418 3300039447 Bacteria 1749
270 Ga0436363_0045363 3300039450 Bacteria 1753
271 Ga0436363_0182670 3300039450 Bacteria 8848
272 Ga0436363_0228184 3300039450 Bacteria 55094
273 Ga0436363_1353363 3300039450 Bacteria 927
274 Ga0436363_1625349 3300039450 Bacteria 1861
275 Ga0439448_0019599 3300042005 Bacteria 2085
276 Ga0439456_026564 3300042013 Bacteria 1232
277 Ga0453683_0014756 3300044673 Bacteria 5069
278 Ga0466963_0023452 3300044694 Bacteria 3920
279 Ga0466963_0052137 3300044694 Bacteria 2714
280 Ga0453684_0164944 3300044712 Bacteria 2616
281 Ga0466968_0150351 3300044735 Bacteria 1070
282 Ga0466957_0176887 3300044842 Bacteria 1392
283 Ga0466957_0330645 3300044842 Bacteria 1030
284 Ga0466960_0158566 3300044901 Bacteria 1214
285 Ga0466959_0022264 3300045049 Bacteria 4683
286 Ga0466959_0156961 3300045049 Bacteria 1601
287 Ga0466959_0487068 3300045049 Bacteria 834
288 Ga0466958_0052115 3300045836 Bacteria 2479
289 Ga0466958_0070986 3300045836 Bacteria 2132
290 Ga0466958_0077205 3300045836 Bacteria 2045
291 Ga0466967_0000787 3300045976 Bacteria 16532
292 Ga0466967_0006114 3300045976 Bacteria 8468
293 Ga0466967_0261790 3300045976 Bacteria 1655
294 Ga0466967_0688282 3300045976 Bacteria 1012
295 Ga0495592_0040145 3300046454 Bacteria 3513
296 Ga0495603_0058795 3300046455 Bacteria 2273
297 Ga0495651_0014890 3300046462 Bacteria 6013
298 Ga0495653_0018924 3300046463 Bacteria 5588
299 Ga0495580_0020876 3300046472 Bacteria 4839
300 Ga0495605_0048258 3300046474 Bacteria 2085
301 Ga0495608_0013575 3300046511 Bacteria 5649
302 Ga0495618_0102172 3300046514 Bacteria 1835
303 Ga0495631_0091107 3300046518 Bacteria 1313
304 Ga0495644_0059903 3300046523 Bacteria 1431
305 Ga0495652_0330537 3300046529 Bacteria 1098
306 Ga0495587_0095132 3300046536 Bacteria 1719
307 Ga0495633_0148991 3300046558 Bacteria 1081
308 Ga0495667_0325328 3300046559 Bacteria 973
309 Ga0495599_0107648 3300046678 Bacteria 1737
310 Ga0495646_0074987 3300046680 Bacteria 1984
311 Ga0495669_0046354 3300046684 Bacteria 1940
312 Ga0495613_0216160 3300046689 Unclassified 1347
313 Ga0495670_0206126 3300046691 Bacteria 1042
314 Ga0495671_0140071 3300046692 Bacteria 1179
315 Ga0495600_0174963 3300046809 Bacteria 1384
316 Ga0495581_0532584 3300047315 Unclassified 682
317 Ga0495604_0012032 3300047317 Bacteria 6877
318 Ga0495674_0161520 3300047319 Bacteria 1874
319 Ga0495680_0015779 3300047322 Bacteria 6504
320 Ga0495680_0200262 3300047322 Bacteria 1433
321 Ga0495675_0058149 3300047444 Bacteria 2452
322 Ga0495679_057041 3300047446 Bacteria 1156
323 Ga0495681_0040312 3300047470 Bacteria 2275
324 Ga0495684_0022936 3300047471 Bacteria 4802
325 Ga0495684_0263575 3300047471 Unclassified 1249
326 Ga0496100_0007786 3300048903 Bacteria 5940
327 Ga0496100_0205724 3300048903 Bacteria 1437
328 Ga0496100_0279034 3300048903 Bacteria 1245
329 Ga0496100_0338452 3300048903 Bacteria 1134
330 Ga0496101_0003564 3300048904 Bacteria 9713
331 Ga0496101_0245290 3300048904 Bacteria 1395
332 Ga0496102_0120387 3300048905 Bacteria 2451
333 Ga0496102_0445494 3300048905 Bacteria 1215
334 Ga0496104_0020980 3300048907 Bacteria 5994
335 Ga0496104_0021543 3300048907 Bacteria 5919
336 Ga0496104_0021967 3300048907 Bacteria 5862
337 Ga0496104_0130087 3300048907 Bacteria 2418
338 Ga0496104_0242331 3300048907 Bacteria 1715
339 Ga0496105_0002955 3300048908 Bacteria 12481
340 Ga0496105_0114724 3300048908 Bacteria 2222
341 Ga0496105_0195694 3300048908 Bacteria 1652
342 Ga0496105_0197398 3300048908 Bacteria 1643
343 Ga0496106_0017398 3300048909 Bacteria 5319
344 Ga0496106_0091361 3300048909 Bacteria 2350
345 Ga0496106_0310297 3300048909 Bacteria 1266
346 Ga0496106_0317607 3300048909 Bacteria 1250
347 Ga0496107_0035699 3300048910 Bacteria 3564
348 Ga0496107_0199029 3300048910 Bacteria 1489
349 Ga0496107_0231620 3300048910 Bacteria 1375
350 Ga0496108_0011234 3300048911 Bacteria 7274
351 Ga0496108_0117563 3300048911 Bacteria 2278
352 Ga0496108_0137674 3300048911 Bacteria 2102
353 Ga0496108_0143642 3300048911 Bacteria 2056
354 Ga0496108_0453050 3300048911 Bacteria 1121
355 Ga0496109_0043441 3300048912 Bacteria 4073
356 Ga0496109_0056720 3300048912 Bacteria 3574
357 Ga0496109_0092927 3300048912 Bacteria 2790
358 Ga0496109_0517699 3300048912 Bacteria 1126
359 Ga0496110_0053440 3300048913 Bacteria 3551
360 Ga0496110_0115370 3300048913 Bacteria 2417
361 Ga0496110_0583123 3300048913 Bacteria 1015
362 Ga0496111_0037084 3300048914 Bacteria 3489
363 Ga0496112_0008357 3300048915 Bacteria 9269
364 Ga0496112_0064500 3300048915 Bacteria 3614
365 Ga0496112_0188510 3300048915 Bacteria 2025
366 Ga0496113_0076684 3300048916 Bacteria 2554
367 Ga0496113_0084190 3300048916 Bacteria 2441
368 Ga0496113_0252688 3300048916 Bacteria 1407
369 Ga0496115_0405783 3300048918 Bacteria 1105
370 Ga0496116_0000740 3300048919 Bacteria 41619
371 Ga0496117_0003550 3300048920 Bacteria 17997
372 Ga0496118_0002323 3300048921 Bacteria 25815
373 Ga0496118_0120300 3300048921 Bacteria 1714
374 Ga0496119_0002710 3300048922 Bacteria 19123
375 Ga0496119_0009674 3300048922 Bacteria 8213
376 Ga0496119_0034756 3300048922 Bacteria 3311
377 Ga0496121_0025058 3300048924 Bacteria 5678
378 Ga0496122_0349699 3300048925 Bacteria 772
379 Ga0496124_0020461 3300048927 Bacteria 6112
380 Ga0496126_0010109 3300048929 Bacteria 9949
381 Ga0496126_0013546 3300048929 Bacteria 8286
382 Ga0501031_0000389 3300049568 Bacteria 25791
383 Ga0501031_0251264 3300049568 Bacteria 1149
384 Ga0501031_0276186 3300049568 Bacteria 1090
385 Ga0501031_0353393 3300049568 Bacteria 951
386 Ga0501032_0000149 3300049569 Bacteria 57163
387 Ga0501033_0005234 3300049570 Bacteria 10299
388 Ga0501033_0065300 3300049570 Bacteria 2678
389 Ga0501033_0507132 3300049570 Bacteria 834
390 Ga0501034_0012892 3300049571 Bacteria 8621
391 Ga0501034_0062093 3300049571 Bacteria 3752
392 Ga0501036_0000219 3300049572 Bacteria 38401
393 Ga0501036_0123533 3300049572 Bacteria 2186
394 Ga0501036_0172137 3300049572 Bacteria 1824
395 Ga0501036_0192007 3300049572 Bacteria 1718
396 Ga0501037_0007019 3300049573 Bacteria 8224
397 Ga0501038_0010684 3300049574 Bacteria 8396
398 Ga0501038_0171013 3300049574 Bacteria 1759
399 Ga0501039_0014028 3300049575 Bacteria 6132
400 Ga0501039_0026598 3300049575 Bacteria 4446
401 Ga0501039_0317387 3300049575 Bacteria 1225
402 Ga0501040_0007461 3300049576 Bacteria 7083
403 Ga0501040_0009217 3300049576 Bacteria 6428
404 Ga0501040_0073008 3300049576 Bacteria 2370
405 Ga0501040_0131330 3300049576 Bacteria 1761
406 Ga0501041_0206246 3300049577 Bacteria 1233
407 Ga0501042_0019601 3300049578 Bacteria 4700
408 Ga0501042_0025693 3300049578 Bacteria 4139
409 Ga0501043_0007801 3300049579 Bacteria 8459
410 Ga0501043_0455989 3300049579 Bacteria 960
411 Ga0501046_0001036 3300049580 Bacteria 27166
412 Ga0501047_0000293 3300049581 Bacteria 57464
413 Ga0501047_0008344 3300049581 Bacteria 9776
414 Ga0501048_0000004 3300049582 Bacteria 100672
415 Ga0501048_0072997 3300049582 Bacteria 2422
416 Ga0501067_0305035 3300049583 Bacteria 887
417 Ga0501068_0006982 3300049584 Bacteria 6246
418 Ga0501068_0186212 3300049584 Bacteria 1314
419 Ga0501069_0001388 3300049585 Bacteria 11888
420 Ga0501070_0000086 3300049586 Bacteria 78615
421 Ga0501070_0025971 3300049586 Bacteria 4913
422 Ga0501070_0744275 3300049586 Bacteria 773
423 Ga0501071_0013434 3300049587 Bacteria 5580
424 Ga0501071_0070292 3300049587 Bacteria 2550
425 Ga0501071_0161214 3300049587 Bacteria 1676
426 Ga0501071_0161762 3300049587 Bacteria 1673
427 Ga0501072_0019446 3300049588 Bacteria 5250
428 Ga0501072_0058893 3300049588 Bacteria 3028
429 Ga0501072_0209760 3300049588 Bacteria 1552
430 Ga0501073_0006875 3300049589 Bacteria 8463
431 Ga0501073_0148421 3300049589 Bacteria 1625
432 Ga0501074_0020321 3300049590 Bacteria 4826
433 Ga0501074_0078252 3300049590 Bacteria 2373
434 Ga0501075_0064749 3300049591 Bacteria 2757
435 Ga0501075_0126209 3300049591 Bacteria 1948
436 Ga0501075_0480845 3300049591 Bacteria 947
437 Ga0501076_0007008 3300049592 Bacteria 8188
438 Ga0501076_0104017 3300049592 Bacteria 2290
439 Ga0501076_0151622 3300049592 Bacteria 1886
440 Ga0501077_0173848 3300049593 Bacteria 1368
441 Ga0501077_0177888 3300049593 Bacteria 1352
442 Ga0501079_0014089 3300049741 Bacteria 6095
443 Ga0501079_0014375 3300049741 Bacteria 6033
444 Ga0501079_0037190 3300049741 Bacteria 3751
445 Ga0501079_0244174 3300049741 Bacteria 1403
446 Ga0501080_0010599 3300049742 Bacteria 8437
447 Ga0501080_0089831 3300049742 Bacteria 2854
448 Ga0501081_0310777 3300049743 Bacteria 1157
449 Ga0501083_0005686 3300049744 Bacteria 8826
450 Ga0501083_0088028 3300049744 Bacteria 2053
451 Ga0501035_0000572 3300049822 Bacteria 40727
452 Ga0501035_0337554 3300049822 Bacteria 1263
453 Ga0501044_0000229 3300049823 Bacteria 70563
454 Ga0501045_0018561 3300049824 Bacteria 4949
455 Ga0501045_0144953 3300049824 Bacteria 1766
456 Ga0501045_0314880 3300049824 Bacteria 1164
457 nmdc:mga09592_46788_c1 3300050508 Bacteria 3644
458 nmdc:mga09592_74762_c1 3300050508 Bacteria 2879
459 nmdc:mga0qj67_85984_c1 3300050509 Bacteria 2523
460 nmdc:mga06r32_188316_c1 3300050510 Bacteria 2051
461 nmdc:mga06r32_404527_c1 3300050510 Bacteria 1347
462 nmdc:mga08y16_139235_c1 3300050511 Bacteria 2523
463 nmdc:mga08y16_284910_c1 3300050511 Bacteria 1704
464 nmdc:mga08y16_329657_c1 3300050511 Bacteria 1570
465 Ga0500556_0001247 3300053104 Bacteria 11759
466 Ga0500595_027443 3300053119 Bacteria 1950
467 Ga0500616_0010045 3300053153 Bacteria 5687
468 Ga0500599_001284 3300053736 Bacteria 2864
469 Ga0501084_0055833 3300054114 Bacteria 3304
470 Ga0501084_0094694 3300054114 Bacteria 2508
471 Ga0501084_0106344 3300054114 Bacteria 2357
472 Ga0501082_0017140 3300060353 Bacteria 6239
473 Ga0501082_0121170 3300060353 Bacteria 2267
474 Ga0501082_0173121 3300060353 Bacteria 1877
475 Ga0530510_0020997 3300061734 Bacteria 4644
476 Ga0530510_0054874 3300061734 Bacteria 2879
477 Ga0530510_0171047 3300061734 Bacteria 1609
478 2583153456 2582580736 Bacteria 5325865
479 2673819851 2671180694 Bacteria 7506943
480 2819739776 2818991472 Bacteria 10089953
481 2866556631 2866552031 Bacteria 5824618
482 2889049459 2889049205 Bacteria 7524325
483 2899375952 2899370129 Bacteria 6781179
484 2917741920 2917736166 Bacteria 9690793
485 2980188250 2980182181 Bacteria 9454109
486 8054473809 8054472261 Bacteria 7464355
487 Ga0496102_0039354
488 JGI25406J46586_10001748
489 JGI25406J46586_10035784
490 JGI25406J46586_10074691
491 rootH1_10077203
492 JGI25407J50210_10001042
493 JGI25407J50210_10024896
494 JGI25407J50210_10038035
495 Ga0070683_100028290
496 Ga0068869_100110593
497 Ga0070666_10007862
498 Ga0070682_100052910
499 Ga0068868_100087584
500 Ga0068868_100282354
501 Ga0070660_100166831
502 Ga0070687_100021371
503 Ga0070675_100580376
504 Ga0070671_100144175
505 Ga0070674_100140805
506 Ga0070688_100247622
507 Ga0070659_100035081
508 Ga0070659_100272472
509 Ga0070714_100005711
510 Ga0070714_100616578
511 Ga0070714_100771011
512 Ga0070713_100033486
513 Ga0070713_100104095
514 Ga0070713_100192528
515 Ga0070713_100451669
516 Ga0070710_10016341
517 Ga0070701_10021262
518 Ga0070711_100110623
519 Ga0070700_100024644
520 Ga0070700_100154752
521 Ga0070708_100493396
522 Ga0070663_100040522
523 Ga0070663_100076184
524 Ga0068867_100055740
525 Ga0070685_10025538
526 Ga0070706_100109455
527 Ga0070707_100370359
528 Ga0070698_100484690
529 Ga0070684_100363235
530 Ga0070684_100395437
531 Ga0070697_100240750
532 Ga0068853_100158017
533 Ga0070686_100036481
534 Ga0070686_100214775
535 Ga0070665_100004766
536 Ga0070665_100093531
537 Ga0070664_100347970
538 Ga0068854_100077163
539 Ga0068854_100115286
540 Ga0068856_100570460
541 Ga0070702_100002852
542 Ga0070702_100016670
543 Ga0070702_100045980
544 Ga0068859_100075146
545 Ga0068859_100481317
546 Ga0068861_100012298
547 Ga0068861_100066224
548 Ga0068870_10094575
549 Ga0068863_100482944
550 Ga0068858_100182228
551 Ga0068860_100180282
552 Ga0068862_100184617
553 Ga0081455_10019046
554 Ga0081455_10062532
555 Ga0081455_10208785
556 Ga0081455_10282815
557 Ga0081538_10000166
558 Ga0081538_10000397
559 Ga0081538_10003581
560 Ga0081538_10012197
561 Ga0081538_10022436
562 Ga0081538_10030133
563 Ga0081538_10031615
564 Ga0081538_10041441
565 Ga0081538_10053997
566 Ga0081538_10064082
567 Ga0081538_10082590
568 Ga0081540_1000312
569 Ga0081539_10000834
570 Ga0081539_10001410
571 Ga0081539_10004305
572 Ga0081539_10141782
573 Ga0070717_10006583
574 Ga0070712_100003261
575 Ga0070712_100451075
576 Ga0075428_100026618
577 Ga0075428_100049486
578 Ga0075430_100005761
579 Ga0075431_100004111
580 Ga0075431_100500262
581 Ga0075429_100199539
582 Ga0068865_100016112
583 Ga0068865_100807493
584 Ga0097620_100046102
585 Ga0097620_100075152
586 Ga0097620_100481353
587 Ga0111539_10019012
588 Ga0105245_10052777
589 Ga0105247_10316240
590 Ga0114129_10640487
591 Ga0105243_10006281
592 Ga0105243_10225864
593 Ga0105243_10597402
594 Ga0105241_10484737
595 Ga0105241_10972255
596 Ga0105242_10097095
597 Ga0105242_10283960
598 Ga0105238_10163838
599 Ga0105238_10386910
600 Ga0105238_10827767
601 Ga0105249_10078315
602 Ga0105249_10153954
603 Ga0105239_10166547
604 Ga0105239_10180397
605 Ga0105239_10376494
606 Ga0105246_10137645
607 Ga0157369_10938269
608 Ga0163162_10323887
609 Ga0163162_11587974
610 Ga0157372_10530502
611 Ga0157372_11218851
612 Ga0157375_10477825
613 Ga0157380_10466586
614 Ga0157380_10926269
615 Ga0157377_10065038
616 Ga0157379_10660523
617 Ga0197907_11205223
618 Ga0213874_10002835
619 Ga0213874_10010278
620 Ga0213874_10021603
621 Ga0213874_10023558
622 Ga0213876_10004253
623 Ga0213876_10070429
624 Ga0213875_10000286
625 Ga0213875_10008974
626 Ga0213875_10076403
627 Ga0209676_1043232
628 Ga0207656_10064886
629 Ga0207692_10092463
630 Ga0207710_10058561
631 Ga0207688_10025786
632 Ga0207688_10116009
633 Ga0207680_10002409
634 Ga0207647_10038807
635 Ga0207699_10011056
636 Ga0207699_10247429
637 Ga0207645_10226121
638 Ga0207643_10041113
639 Ga0207684_10034978
640 Ga0207695_10234383
641 Ga0207693_10000657
642 Ga0207663_10098044
643 Ga0207662_10054196
644 Ga0207646_10827661
645 Ga0207694_10108998
646 Ga0207650_10285781
647 Ga0207650_10514119
648 Ga0207687_10187795
649 Ga0207687_10303016
650 Ga0207700_10025022
651 Ga0207700_10037215
652 Ga0207700_10361315
653 Ga0207664_10028156
654 Ga0207664_10028223
655 Ga0207644_10489382
656 Ga0207690_10020818
657 Ga0207706_10243442
658 Ga0207709_10006789
659 Ga0207709_10017149
660 Ga0207709_10086294
661 Ga0207709_10251978
662 Ga0207704_10497968
663 Ga0207665_10054955
664 Ga0207691_10365712
665 Ga0207689_10046785
666 Ga0207661_10013518
667 Ga0207661_10040193
668 Ga0207661_10427932
669 Ga0207667_10655526
670 Ga0207712_10166567
671 Ga0207712_10214252
672 Ga0207712_10358452
673 Ga0207668_10166513
674 Ga0207668_10415953
675 Ga0207640_10044438
676 Ga0207640_10180096
677 Ga0207640_10320561
678 Ga0207640_10427549
679 Ga0207658_10005109
680 Ga0207677_10009211
681 Ga0207703_10032908
682 Ga0207639_10080440
683 Ga0207678_10058378
684 Ga0207678_10098259
685 Ga0207708_10005637
686 Ga0207708_10030416
687 Ga0207708_10165305
688 Ga0207702_10230256
689 Ga0207648_10111110
690 Ga0207674_10341047
691 Ga0207675_100005705
692 Ga0207675_100524583
693 Ga0207683_10257368
694 Ga0207683_10327935
695 Ga0207698_10050583
696 Ga0207698_10335161
697 Ga0207428_10079210
698 Ga0207428_10202117
699 Ga0268266_10000233
700 Ga0307515_10400518
701 Ga0265760_10044344
702 Ga0265320_10001568
703 Ga0265314_10005431
704 Ga0307405_10191261
705 Ga0307413_10028402
706 Ga0307413_10069549
707 Ga0307413_10235060
708 Ga0307413_10384120
709 Ga0307518_10046638
710 Ga0307410_10012908
711 Ga0307410_10020084
712 Ga0307410_10598625
713 Ga0307406_10022258
714 Ga0307406_10507361
715 Ga0307407_10018455
716 Ga0307407_10088423
717 Ga0307412_10023054
718 Ga0307409_100091796
719 Ga0307409_100096959
720 Ga0307409_100097501
721 Ga0307409_100366810
722 Ga0307409_100583473
723 Ga0307416_100002309
724 Ga0307416_100110753
725 Ga0307416_100112035
726 Ga0307416_100136855
727 Ga0307416_100179234
728 Ga0307416_100537657
729 Ga0307416_100670020
730 Ga0307411_10098991
731 Ga0307411_10693078
732 Ga0307415_100025921
733 Ga0307415_100538523
734 Ga0307415_100724981
735 Ga0373956_0179430
736 Ga0316574_0059813
737 Ga0373937_0544466
738 Ga0373925_0360085
739 Ga0395900_0520797
740 Ga0436364_0233629
741 Ga0436364_0276493
742 Ga0436364_0426354
743 Ga0436364_0751774
744 Ga0436364_1027295
745 Ga0436364_1299740
746 Ga0436364_1542327
747 Ga0395901_0848052
748 Ga0436365_0250149
749 Ga0436365_0556685
750 Ga0436365_0936576
751 Ga0436365_0973958
752 Ga0436365_1608073
753 Ga0436365_1674624
754 Ga0436360_0545149
755 Ga0436361_1110418
756 Ga0436363_0045363
757 Ga0436363_0182670
758 Ga0436363_0228184
759 Ga0436363_1353363
760 Ga0436363_1625349
761 Ga0439448_0019599
762 Ga0439456_026564
763 Ga0453683_0014756
764 Ga0466963_0023452
765 Ga0466963_0052137
766 Ga0453684_0164944
767 Ga0466968_0150351
768 Ga0466957_0176887
769 Ga0466957_0330645
770 Ga0466960_0158566
771 Ga0466959_0022264
772 Ga0466959_0156961
773 Ga0466959_0487068
774 Ga0466958_0052115
775 Ga0466958_0070986
776 Ga0466958_0077205
777 Ga0466967_0000787
778 Ga0466967_0006114
779 Ga0466967_0261790
780 Ga0466967_0688282
781 Ga0495592_0040145
782 Ga0495603_0058795
783 Ga0495651_0014890
784 Ga0495653_0018924
785 Ga0495580_0020876
786 Ga0495605_0048258
787 Ga0495608_0013575
788 Ga0495618_0102172
789 Ga0495631_0091107
790 Ga0495644_0059903
791 Ga0495652_0330537
792 Ga0495587_0095132
793 Ga0495633_0148991
794 Ga0495667_0325328
795 Ga0495599_0107648
796 Ga0495646_0074987
797 Ga0495669_0046354
798 Ga0495613_0216160
799 Ga0495670_0206126
800 Ga0495671_0140071
801 Ga0495600_0174963
802 Ga0495581_0532584
803 Ga0495604_0012032
804 Ga0495674_0161520
805 Ga0495680_0015779
806 Ga0495680_0200262
807 Ga0495675_0058149
808 Ga0495679_057041
809 Ga0495681_0040312
810 Ga0495684_0022936
811 Ga0495684_0263575
812 Ga0496100_0007786
813 Ga0496100_0205724
814 Ga0496100_0279034
815 Ga0496100_0338452
816 Ga0496101_0003564
817 Ga0496101_0245290
818 Ga0496102_0120387
819 Ga0496102_0445494
820 Ga0496104_0020980
821 Ga0496104_0021543
822 Ga0496104_0021967
823 Ga0496104_0130087
824 Ga0496104_0242331
825 Ga0496105_0002955
826 Ga0496105_0114724
827 Ga0496105_0195694
828 Ga0496105_0197398
829 Ga0496106_0017398
830 Ga0496106_0091361
831 Ga0496106_0310297
832 Ga0496106_0317607
833 Ga0496107_0035699
834 Ga0496107_0199029
835 Ga0496107_0231620
836 Ga0496108_0011234
837 Ga0496108_0117563
838 Ga0496108_0137674
839 Ga0496108_0143642
840 Ga0496108_0453050
841 Ga0496109_0043441
842 Ga0496109_0056720
843 Ga0496109_0092927
844 Ga0496109_0517699
845 Ga0496110_0053440
846 Ga0496110_0115370
847 Ga0496110_0583123
848 Ga0496111_0037084
849 Ga0496112_0008357
850 Ga0496112_0064500
851 Ga0496112_0188510
852 Ga0496113_0076684
853 Ga0496113_0084190
854 Ga0496113_0252688
855 Ga0496115_0405783
856 Ga0496116_0000740
857 Ga0496117_0003550
858 Ga0496118_0002323
859 Ga0496118_0120300
860 Ga0496119_0002710
861 Ga0496119_0009674
862 Ga0496119_0034756
863 Ga0496121_0025058
864 Ga0496122_0349699
865 Ga0496124_0020461
866 Ga0496126_0010109
867 Ga0496126_0013546
868 Ga0501031_0000389
869 Ga0501031_0251264
870 Ga0501031_0276186
871 Ga0501031_0353393
872 Ga0501032_0000149
873 Ga0501033_0005234
874 Ga0501033_0065300
875 Ga0501033_0507132
876 Ga0501034_0012892
877 Ga0501034_0062093
878 Ga0501036_0000219
879 Ga0501036_0123533
880 Ga0501036_0172137
881 Ga0501036_0192007
882 Ga0501037_0007019
883 Ga0501038_0010684
884 Ga0501038_0171013
885 Ga0501039_0014028
886 Ga0501039_0026598
887 Ga0501039_0317387
888 Ga0501040_0007461
889 Ga0501040_0009217
890 Ga0501040_0073008
891 Ga0501040_0131330
892 Ga0501041_0206246
893 Ga0501042_0019601
894 Ga0501042_0025693
895 Ga0501043_0007801
896 Ga0501043_0455989
897 Ga0501046_0001036
898 Ga0501047_0000293
899 Ga0501047_0008344
900 Ga0501048_0000004
901 Ga0501048_0072997
902 Ga0501067_0305035
903 Ga0501068_0006982
904 Ga0501068_0186212
905 Ga0501069_0001388
906 Ga0501070_0000086
907 Ga0501070_0025971
908 Ga0501070_0744275
909 Ga0501071_0013434
910 Ga0501071_0070292
911 Ga0501071_0161214
912 Ga0501071_0161762
913 Ga0501072_0019446
914 Ga0501072_0058893
915 Ga0501072_0209760
916 Ga0501073_0006875
917 Ga0501073_0148421
918 Ga0501074_0020321
919 Ga0501074_0078252
920 Ga0501075_0064749
921 Ga0501075_0126209
922 Ga0501075_0480845
923 Ga0501076_0007008
924 Ga0501076_0104017
925 Ga0501076_0151622
926 Ga0501077_0173848
927 Ga0501077_0177888
928 Ga0501079_0014089
929 Ga0501079_0014375
930 Ga0501079_0037190
931 Ga0501079_0244174
932 Ga0501080_0010599
933 Ga0501080_0089831
934 Ga0501081_0310777
935 Ga0501083_0005686
936 Ga0501083_0088028
937 Ga0501035_0000572
938 Ga0501035_0337554
939 Ga0501044_0000229
940 Ga0501045_0018561
941 Ga0501045_0144953
942 Ga0501045_0314880
943 nmdc:mga09592_46788_c1
944 nmdc:mga09592_74762_c1
945 nmdc:mga0qj67_85984_c1
946 nmdc:mga06r32_188316_c1
947 nmdc:mga06r32_404527_c1
948 nmdc:mga08y16_139235_c1
949 nmdc:mga08y16_284910_c1
950 nmdc:mga08y16_329657_c1
951 Ga0500556_0001247
952 Ga0500595_027443
953 Ga0500616_0010045
954 Ga0500599_001284
955 Ga0501084_0055833
956 Ga0501084_0094694
957 Ga0501084_0106344
958 Ga0501082_0017140
959 Ga0501082_0121170
960 Ga0501082_0173121
961 Ga0530510_0020997
962 Ga0530510_0054874
963 Ga0530510_0171047
964 2583153456
965 2673819851
966 2819739776
967 2866556631
968 2889049459
969 2899375952
970 2917741920
971 2980188250
972 8054473809

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03070

TENA_THI-4

TENA/THI-4/PQQC family

21

233

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ny7-assembly1.cif.gz_B bond length analysis of the pqqc y175f mutant structure shows evidence for bound pqq in the reduced form 0.9835 1 218
1otw-assembly1.cif.gz_A crystal structure of pqqc in complex with pqq and a putative h2o2 0.9801 1 218
5vrd-assembly1.cif.gz_B crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9679 1 225
3hml-assembly1.cif.gz_B crystal structure of pqqc active site mutant h154s in complex with pqq 0.9555 1 218
5vrd-assembly2.cif.gz_A crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9494 1 225
ID Description Score Start End Superfamily
3hmlA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9499 1 218 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9128 5 218 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9004 5 218 1.20.910.10
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8711 3 219 1.20.910.10
3hmlA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8557 1 218 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A7V9PMQ8-F1-model_v4 Pyrroloquinoline-quinone synthase PqqC 1.001 1 123 GO:0006790
GO:0016491
GO:0044281
GO:0072527
GO:1901615
AF-A0A2V7INH4-F1-model_v4 Pyrroloquinoline quinone biosynthesis protein C 0.9974 111 222 GO:0006790
GO:0016491
GO:0044281
GO:0072527
GO:1901615
AF-A0A2W6CNJ5-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9971 2 219 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615
AF-A0A557Z972-F1-model_v4 deleted 0.9966 1 219
AF-A0A421B157-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9962 1 219 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615

Map