F453355

General Info

Members Datasets Scaffolds Average Seq Length
486 209 972 394

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0018656|Ga0501035_0018656_2131_3474
Length 447
Sequence MSRVSLAGMGGFRAERQASVYVLPSQVLRLHTAFAAGAHDGRIRRQWSLVMEHVHDYLIVGAGMAADAAAKAIRELDSAADVAVVGEETSPPYQRPPLSKALWKGDKTVAGIDLGTAASGAKLYTGRRVVVLDRAAHVVRDDQGDSYRYRRLLLATGATPRQLPFEGGDRLIHYRALRDYEALRRFARPGANIAVIGGGFIGAELAASLCGVGCKVCLLFPDAHIGAGRYPDGLARHLDDYYRQRGVDVRSGVRVTGGRPVDGGVELGLSDGSLLRVEAAVAGLGVTPNTALAEQAGLKLDNGIVVDAQLRSSEPDIWAAGDVANFYNPALDRRLRVEHEDAAVGMGRHAGRAMVGKGDSYDTLPFFYSDLFDLGYEAVGLLDTRLDVVEDWREPYREGVVYYLERGRVRGVLLWNTWDQVDAARALIAEAGPFDAASVKGRLPRRA

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
204 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
205 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
206 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
207 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
208 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
209 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 1.65
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.67
Nodule 0
Rhizoplane 1.03
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0018656 3300049822 Bacteria 6389
2 JGI24741J21665_1002358 3300001915 Bacteria 4941
3 JGI24741J21665_1002970 3300001915 Bacteria 4222
4 JGI24741J21665_1004086 3300001915 Bacteria 3312
5 JGI24741J21665_1005944 3300001915 Bacteria 2497
6 JGI24740J21852_10000677 3300001979 Bacteria 14767
7 JGI25162J39368_1001841 3300002737 Bacteria 9875
8 JGI25164J39214_1000345 3300002772 Bacteria 29059
9 JGI25165J46597_1000636 3300003214 Bacteria 29059
10 rootH1_10106141 3300003323 Bacteria 4579
11 Ga0070683_100025535 3300005329 Bacteria 5307
12 Ga0070683_100190536 3300005329 Bacteria 1947
13 Ga0070666_10000314 3300005335 Bacteria 31000
14 Ga0070666_10032672 3300005335 Bacteria 3438
15 Ga0070680_100003177 3300005336 Bacteria 12213
16 Ga0070680_100005972 3300005336 Bacteria 9236
17 Ga0070680_100032940 3300005336 Bacteria 4172
18 Ga0070680_100044483 3300005336 Bacteria 3608
19 Ga0070680_100046977 3300005336 Bacteria 3514
20 Ga0070680_100128893 3300005336 Bacteria 2115
21 Ga0070682_100009003 3300005337 Bacteria 5642
22 Ga0070682_100021469 3300005337 Bacteria 3810
23 Ga0070682_100025773 3300005337 Bacteria 3512
24 Ga0070682_100117220 3300005337 Bacteria 1782
25 Ga0070691_10000501 3300005341 Bacteria 14709
26 Ga0070691_10012554 3300005341 Bacteria 3879
27 Ga0070691_10038582 3300005341 Bacteria 2255
28 Ga0070661_100002498 3300005344 Bacteria 12608
29 Ga0070661_100016265 3300005344 Bacteria 5257
30 Ga0070661_100034251 3300005344 Bacteria 3683
31 Ga0070661_100070024 3300005344 Bacteria 2579
32 Ga0070692_10012680 3300005345 Bacteria 3911
33 Ga0070692_10025553 3300005345 Bacteria 2911
34 Ga0070692_10026966 3300005345 Bacteria 2844
35 Ga0070692_10030842 3300005345 Bacteria 2684
36 Ga0070668_100099571 3300005347 Bacteria 2302
37 Ga0070675_100175431 3300005354 Bacteria 1851
38 Ga0070671_100147169 3300005355 Bacteria 1988
39 Ga0070671_100223929 3300005355 Bacteria 1596
40 Ga0070688_100060976 3300005365 Bacteria 2384
41 Ga0070659_100000943 3300005366 Bacteria 21381
42 Ga0070659_100029031 3300005366 Bacteria 4274
43 Ga0070667_100181857 3300005367 Bacteria 1859
44 Ga0070714_100000235 3300005435 Bacteria 43201
45 Ga0070714_100023648 3300005435 Bacteria 5051
46 Ga0070714_100040369 3300005435 Bacteria 3933
47 Ga0070714_100201792 3300005435 Unclassified 1819
48 Ga0070713_100012199 3300005436 Bacteria 6294
49 Ga0070711_100212023 3300005439 Bacteria 1500
50 Ga0070694_100012961 3300005444 Bacteria 5200
51 Ga0070708_100009016 3300005445 Bacteria 8041
52 Ga0070663_100043583 3300005455 Bacteria 3158
53 Ga0070663_100159647 3300005455 Bacteria 1735
54 Ga0070663_100244994 3300005455 Bacteria 1416
55 Ga0070678_100003924 3300005456 Bacteria 8363
56 Ga0070681_10000114 3300005458 Bacteria 59882
57 Ga0070681_10000622 3300005458 Bacteria 29049
58 Ga0070681_10003311 3300005458 Bacteria 15050
59 Ga0070681_10008167 3300005458 Bacteria 10246
60 Ga0070681_10011291 3300005458 Bacteria 8836
61 Ga0070681_10018381 3300005458 Bacteria 6986
62 Ga0070681_10038146 3300005458 Bacteria 4818
63 Ga0070681_10076025 3300005458 Bacteria 3317
64 Ga0070681_10113265 3300005458 Bacteria 2652
65 Ga0070681_10262462 3300005458 Bacteria 1639
66 Ga0068867_100176634 3300005459 Bacteria 1695
67 Ga0070685_10005373 3300005466 Bacteria 6489
68 Ga0070707_100060403 3300005468 Bacteria 3635
69 Ga0070699_100003602 3300005518 Bacteria 13698
70 Ga0070679_100001274 3300005530 Bacteria 22243
71 Ga0070679_100003588 3300005530 Bacteria 14190
72 Ga0070679_100010031 3300005530 Bacteria 8971
73 Ga0070679_100037481 3300005530 Bacteria 4817
74 Ga0070679_100080658 3300005530 Bacteria 3243
75 Ga0070679_100101906 3300005530 Bacteria 2857
76 Ga0070679_100147877 3300005530 Bacteria 2327
77 Ga0070684_100007483 3300005535 Bacteria 8494
78 Ga0070684_100015884 3300005535 Bacteria 6144
79 Ga0070684_100035992 3300005535 Bacteria 4240
80 Ga0070697_100027728 3300005536 Bacteria 4532
81 Ga0068853_100001081 3300005539 Bacteria 19271
82 Ga0068853_100001246 3300005539 Bacteria 18189
83 Ga0068853_100010352 3300005539 Bacteria 7544
84 Ga0068853_100016049 3300005539 Bacteria 6158
85 Ga0068853_100017180 3300005539 Bacteria 5970
86 Ga0068853_100044105 3300005539 Bacteria 3817
87 Ga0068853_100047360 3300005539 Bacteria 3689
88 Ga0068853_100121615 3300005539 Bacteria 2329
89 Ga0068853_100134358 3300005539 Bacteria 2217
90 Ga0068853_100234394 3300005539 Bacteria 1680
91 Ga0070672_100206037 3300005543 Bacteria 1646
92 Ga0070695_100003582 3300005545 Bacteria 9065
93 Ga0070696_100000684 3300005546 Bacteria 21700
94 Ga0070696_100039363 3300005546 Bacteria 3264
95 Ga0070693_100025356 3300005547 Bacteria 3190
96 Ga0070665_100247293 3300005548 Unclassified 1784
97 Ga0068855_100010127 3300005563 Bacteria 11364
98 Ga0068855_100010542 3300005563 Bacteria 11146
99 Ga0068855_100125914 3300005563 Bacteria 2929
100 Ga0068855_100161939 3300005563 Bacteria 2538
101 Ga0068855_100196391 3300005563 Bacteria 2273
102 Ga0070664_100063198 3300005564 Bacteria 3157
103 Ga0068857_100087646 3300005577 Bacteria 2784
104 Ga0068857_100095746 3300005577 Bacteria 2660
105 Ga0068854_100005877 3300005578 Bacteria 7776
106 Ga0068854_100057723 3300005578 Bacteria 2800
107 Ga0068854_100284553 3300005578 Bacteria 1332
108 Ga0068856_100000167 3300005614 Bacteria 68389
109 Ga0068856_100009313 3300005614 Bacteria 9539
110 Ga0068856_100044051 3300005614 Bacteria 4390
111 Ga0068856_100074184 3300005614 Bacteria 3368
112 Ga0068852_100004807 3300005616 Bacteria 9594
113 Ga0068859_100061466 3300005617 Bacteria 3785
114 Ga0068864_100008439 3300005618 Bacteria 8499
115 Ga0068863_100000945 3300005841 Bacteria 29155
116 Ga0068863_100081455 3300005841 Bacteria 3066
117 Ga0068863_100266817 3300005841 Bacteria 1656
118 Ga0068860_100001333 3300005843 Bacteria 26831
119 Ga0075367_10009366 3300006178 Bacteria 5115
120 Ga0075366_10038867 3300006195 Bacteria 2811
121 Ga0097621_100056805 3300006237 Bacteria 3198
122 Ga0097621_100065221 3300006237 Bacteria 2996
123 Ga0068871_100023696 3300006358 Bacteria 4751
124 Ga0068871_100105598 3300006358 Bacteria 2364
125 Ga0068871_100266878 3300006358 Bacteria 1494
126 Ga0075430_100071093 3300006846 Bacteria 2919
127 Ga0075430_100125736 3300006846 Bacteria 2137
128 Ga0075433_10005046 3300006852 Bacteria 10344
129 Ga0075433_10021343 3300006852 Bacteria 5431
130 Ga0075433_10212672 3300006852 Bacteria 1718
131 Ga0075429_100124332 3300006880 Bacteria 2256
132 Ga0068865_100159803 3300006881 Bacteria 1718
133 Ga0097620_100061464 3300006931 Bacteria 3785
134 Ga0099794_10000153 3300007265 Bacteria 25568
135 Ga0099794_10001771 3300007265 Bacteria 7691
136 Ga0105240_10008680 3300009093 Bacteria 14509
137 Ga0105240_10027270 3300009093 Bacteria 7480
138 Ga0105240_10061107 3300009093 Bacteria 4696
139 Ga0105240_10144206 3300009093 Bacteria 2843
140 Ga0105245_10299161 3300009098 Bacteria 1578
141 Ga0114129_10002469 3300009147 Bacteria 25689
142 Ga0114129_10083385 3300009147 Bacteria 4441
143 Ga0114129_10201486 3300009147 Bacteria 2695
144 Ga0105241_10012344 3300009174 Bacteria 6265
145 Ga0105241_10034464 3300009174 Bacteria 3803
146 Ga0105241_10039664 3300009174 Bacteria 3553
147 Ga0105241_10099362 3300009174 Bacteria 2311
148 Ga0105242_10006028 3300009176 Bacteria 9347
149 Ga0105237_10000911 3300009545 Bacteria 39750
150 Ga0105237_10026586 3300009545 Bacteria 5915
151 Ga0105237_10040329 3300009545 Bacteria 4709
152 Ga0105238_10003052 3300009551 Bacteria 16697
153 Ga0105238_10008148 3300009551 Bacteria 10482
154 Ga0105238_10024346 3300009551 Bacteria 6171
155 Ga0105238_10068657 3300009551 Bacteria 3545
156 Ga0105249_10219654 3300009553 Bacteria 1869
157 Ga0105239_10003634 3300010375 Bacteria 18856
158 Ga0105239_10011857 3300010375 Bacteria 9725
159 Ga0105239_10111133 3300010375 Bacteria 3038
160 Ga0157373_10002887 3300013100 Bacteria 12998
161 Ga0157373_10005630 3300013100 Bacteria 9392
162 Ga0157373_10032430 3300013100 Bacteria 3760
163 Ga0157371_10004067 3300013102 Bacteria 12929
164 Ga0157370_10002710 3300013104 Bacteria 21188
165 Ga0157370_10005919 3300013104 Bacteria 13630
166 Ga0157370_10012502 3300013104 Bacteria 8799
167 Ga0157370_10088164 3300013104 Bacteria 2914
168 Ga0157369_10000027 3300013105 Bacteria 213988
169 Ga0157369_10003642 3300013105 Bacteria 18277
170 Ga0157369_10074930 3300013105 Bacteria 3629
171 Ga0157369_10291982 3300013105 Bacteria 1697
172 Ga0157369_10399940 3300013105 Bacteria 1425
173 Ga0157378_10000016 3300013297 Bacteria 142649
174 Ga0157378_10044097 3300013297 Bacteria 3960
175 Ga0163162_10000030 3300013306 Bacteria 163717
176 Ga0163162_10056252 3300013306 Bacteria 3963
177 Ga0163162_10064190 3300013306 Bacteria 3717
178 Ga0157372_10008164 3300013307 Bacteria 11127
179 Ga0157372_10010937 3300013307 Bacteria 9658
180 Ga0157372_10017426 3300013307 Bacteria 7709
181 Ga0157372_10020238 3300013307 Bacteria 7177
182 Ga0157372_10024454 3300013307 Bacteria 6561
183 Ga0157372_10075360 3300013307 Bacteria 3807
184 Ga0157372_10103213 3300013307 Bacteria 3258
185 Ga0157372_10114721 3300013307 Bacteria 3088
186 Ga0157375_10000997 3300013308 Bacteria 24446
187 Ga0157375_10136783 3300013308 Bacteria 2575
188 Ga0163163_10000117 3300014325 Bacteria 84938
189 Ga0163163_10005615 3300014325 Bacteria 10868
190 Ga0163163_10132175 3300014325 Bacteria 2536
191 Ga0182008_10036906 3300014497 Bacteria 2445
192 Ga0157379_10003292 3300014968 Bacteria 13669
193 Ga0157376_10029825 3300014969 Bacteria 4348
194 Ga0157376_10044436 3300014969 Bacteria 3652
195 Ga0157376_10057009 3300014969 Bacteria 3266
196 Ga0157376_10070088 3300014969 Bacteria 2975
197 Ga0157376_10093529 3300014969 Bacteria 2610
198 Ga0157376_10123199 3300014969 Unclassified 2301
199 Ga0182006_1035942 3300015261 Bacteria 1972
200 Ga0197907_10747498 3300020069 Bacteria 2480
201 Ga0206352_10299377 3300020078 Bacteria 2666
202 Ga0206354_10306429 3300020081 Bacteria 3161
203 Ga0206354_11061739 3300020081 Bacteria 2829
204 Ga0206353_10237724 3300020082 Bacteria 3333
205 Ga0206353_10324570 3300020082 Bacteria 2742
206 Ga0206353_10329599 3300020082 Bacteria 2728
207 Ga0154015_1124833 3300020610 Bacteria 3597
208 Ga0209674_100650 3300025226 Bacteria 12535
209 Ga0207427_100202 3300025231 Bacteria 56322
210 Ga0209437_100121 3300025233 Bacteria 202531
211 Ga0209646_1001762 3300025246 Bacteria 5443
212 Ga0209026_1000119 3300025250 Bacteria 130220
213 Ga0209026_1000123 3300025250 Bacteria 125961
214 Ga0209026_1000206 3300025250 Bacteria 81686
215 Ga0209759_1004055 3300025256 Bacteria 5606
216 Ga0209759_1014949 3300025256 Bacteria 2025
217 Ga0209233_1000112 3300025261 Bacteria 258251
218 Ga0209455_1002011 3300025272 Bacteria 8329
219 Ga0207680_10000560 3300025903 Bacteria 17593
220 Ga0207647_10001624 3300025904 Bacteria 17287
221 Ga0207647_10002695 3300025904 Bacteria 13409
222 Ga0207647_10008025 3300025904 Bacteria 7591
223 Ga0207647_10026944 3300025904 Bacteria 3752
224 Ga0207647_10034311 3300025904 Bacteria 3241
225 Ga0207705_10000527 3300025909 Bacteria 32402
226 Ga0207705_10003628 3300025909 Bacteria 11756
227 Ga0207705_10008299 3300025909 Bacteria 7586
228 Ga0207705_10026947 3300025909 Bacteria 4096
229 Ga0207705_10109556 3300025909 Bacteria 2039
230 Ga0207654_10004946 3300025911 Bacteria 6744
231 Ga0207654_10005653 3300025911 Bacteria 6320
232 Ga0207654_10007610 3300025911 Bacteria 5461
233 Ga0207654_10226780 3300025911 Bacteria 1242
234 Ga0207707_10000039 3300025912 Bacteria 138817
235 Ga0207707_10000095 3300025912 Bacteria 89126
236 Ga0207707_10000512 3300025912 Bacteria 39777
237 Ga0207707_10006690 3300025912 Bacteria 10058
238 Ga0207707_10009965 3300025912 Bacteria 8239
239 Ga0207707_10013463 3300025912 Bacteria 7128
240 Ga0207707_10015033 3300025912 Bacteria 6739
241 Ga0207707_10043317 3300025912 Bacteria 3926
242 Ga0207707_10266858 3300025912 Bacteria 1484
243 Ga0207695_10000094 3300025913 Bacteria 265779
244 Ga0207695_10001815 3300025913 Bacteria 33615
245 Ga0207695_10005969 3300025913 Bacteria 15930
246 Ga0207695_10009808 3300025913 Bacteria 11772
247 Ga0207695_10026976 3300025913 Bacteria 6401
248 Ga0207695_10031161 3300025913 Bacteria 5855
249 Ga0207695_10127299 3300025913 Bacteria 2508
250 Ga0207671_10000192 3300025914 Bacteria 94837
251 Ga0207671_10000870 3300025914 Bacteria 38250
252 Ga0207671_10010932 3300025914 Bacteria 7437
253 Ga0207671_10021019 3300025914 Bacteria 4959
254 Ga0207660_10001442 3300025917 Bacteria 15953
255 Ga0207660_10004915 3300025917 Bacteria 8706
256 Ga0207660_10009918 3300025917 Bacteria 6170
257 Ga0207660_10019094 3300025917 Bacteria 4578
258 Ga0207660_10025791 3300025917 Bacteria 3995
259 Ga0207660_10032393 3300025917 Bacteria 3608
260 Ga0207657_10001700 3300025919 Bacteria 23736
261 Ga0207657_10002396 3300025919 Bacteria 20267
262 Ga0207657_10007441 3300025919 Bacteria 11230
263 Ga0207657_10024977 3300025919 Bacteria 5520
264 Ga0207657_10092278 3300025919 Bacteria 2524
265 Ga0207649_10000364 3300025920 Bacteria 33989
266 Ga0207649_10113661 3300025920 Bacteria 1814
267 Ga0207652_10000376 3300025921 Bacteria 46290
268 Ga0207652_10000490 3300025921 Bacteria 40239
269 Ga0207652_10000534 3300025921 Bacteria 38545
270 Ga0207652_10012622 3300025921 Bacteria 6829
271 Ga0207652_10016722 3300025921 Bacteria 5994
272 Ga0207652_10018242 3300025921 Bacteria 5754
273 Ga0207652_10025013 3300025921 Bacteria 4959
274 Ga0207652_10039434 3300025921 Bacteria 4008
275 Ga0207652_10053357 3300025921 Bacteria 3473
276 Ga0207646_10066410 3300025922 Bacteria 3220
277 Ga0207694_10007466 3300025924 Bacteria 8288
278 Ga0207694_10008757 3300025924 Bacteria 7634
279 Ga0207694_10014462 3300025924 Bacteria 5949
280 Ga0207694_10023645 3300025924 Bacteria 4666
281 Ga0207687_10074387 3300025927 Bacteria 2435
282 Ga0207700_10015517 3300025928 Bacteria 5028
283 Ga0207664_10000072 3300025929 Bacteria 104943
284 Ga0207664_10008047 3300025929 Bacteria 7329
285 Ga0207664_10025303 3300025929 Bacteria 4469
286 Ga0207664_10067876 3300025929 Bacteria 2863
287 Ga0207664_10216933 3300025929 Bacteria 1657
288 Ga0207690_10000414 3300025932 Bacteria 27831
289 Ga0207690_10009191 3300025932 Bacteria 5868
290 Ga0207690_10071140 3300025932 Bacteria 2398
291 Ga0207706_10015774 3300025933 Bacteria 6829
292 Ga0207706_10144028 3300025933 Bacteria 2097
293 Ga0207686_10001904 3300025934 Bacteria 11560
294 Ga0207704_10005114 3300025938 Bacteria 6040
295 Ga0207691_10204636 3300025940 Bacteria 1717
296 Ga0207661_10012492 3300025944 Bacteria 6171
297 Ga0207661_10024684 3300025944 Bacteria 4558
298 Ga0207679_10059348 3300025945 Bacteria 2838
299 Ga0207679_10060138 3300025945 Bacteria 2822
300 Ga0207667_10002892 3300025949 Bacteria 21315
301 Ga0207667_10005838 3300025949 Bacteria 14992
302 Ga0207667_10007134 3300025949 Bacteria 13491
303 Ga0207667_10015807 3300025949 Bacteria 8553
304 Ga0207667_10033012 3300025949 Bacteria 5570
305 Ga0207667_10051297 3300025949 Bacteria 4350
306 Ga0207667_10132316 3300025949 Bacteria 2569
307 Ga0207667_10195487 3300025949 Bacteria 2075
308 Ga0207651_10078286 3300025960 Bacteria 2371
309 Ga0207640_10000493 3300025981 Bacteria 24054
310 Ga0207640_10003121 3300025981 Bacteria 8913
311 Ga0207640_10025900 3300025981 Bacteria 3556
312 Ga0207640_10032380 3300025981 Bacteria 3241
313 Ga0207640_10034709 3300025981 Bacteria 3150
314 Ga0207640_10068646 3300025981 Bacteria 2377
315 Ga0207658_10048892 3300025986 Bacteria 3104
316 Ga0207703_10156013 3300026035 Bacteria 1995
317 Ga0207703_10331483 3300026035 Bacteria 1396
318 Ga0207639_10006624 3300026041 Bacteria 7876
319 Ga0207639_10021886 3300026041 Bacteria 4597
320 Ga0207639_10022517 3300026041 Bacteria 4539
321 Ga0207639_10063116 3300026041 Bacteria 2867
322 Ga0207639_10085076 3300026041 Bacteria 2514
323 Ga0207639_10093433 3300026041 Bacteria 2412
324 Ga0207678_10003195 3300026067 Bacteria 14827
325 Ga0207678_10003677 3300026067 Bacteria 13786
326 Ga0207678_10005009 3300026067 Bacteria 11883
327 Ga0207678_10008398 3300026067 Bacteria 9110
328 Ga0207678_10051033 3300026067 Bacteria 3572
329 Ga0207702_10000130 3300026078 Bacteria 89196
330 Ga0207702_10004060 3300026078 Bacteria 13135
331 Ga0207702_10008849 3300026078 Bacteria 8485
332 Ga0207702_10013728 3300026078 Bacteria 6729
333 Ga0207702_10210089 3300026078 Bacteria 1809
334 Ga0207641_10010187 3300026088 Bacteria 7731
335 Ga0207641_10103547 3300026088 Bacteria 2511
336 Ga0207648_10037081 3300026089 Bacteria 4294
337 Ga0207676_10001910 3300026095 Bacteria 15220
338 Ga0207676_10154694 3300026095 Bacteria 1979
339 Ga0207674_10008275 3300026116 Bacteria 12045
340 Ga0207674_10014107 3300026116 Bacteria 8827
341 Ga0207674_10021910 3300026116 Bacteria 6874
342 Ga0207674_10039504 3300026116 Bacteria 4891
343 Ga0207674_10263644 3300026116 Bacteria 1670
344 Ga0207683_10009019 3300026121 Bacteria 8499
345 Ga0207683_10013960 3300026121 Bacteria 6849
346 Ga0207698_10009234 3300026142 Bacteria 6274
347 Ga0207698_10018057 3300026142 Bacteria 4798
348 Ga0207698_10069250 3300026142 Bacteria 2789
349 Ga0209983_1000350 3300027665 Bacteria 9723
350 Ga0209588_1000350 3300027671 Bacteria 12019
351 Ga0209971_1000188 3300027682 Bacteria 18494
352 Ga0209974_10003346 3300027876 Bacteria 5793
353 Ga0207428_10059106 3300027907 Bacteria 3040
354 Ga0268264_10007864 3300028381 Bacteria 8872
355 Ga0268264_10011202 3300028381 Bacteria 7407
356 Ga0265334_10009841 3300028573 Bacteria 4041
357 Ga0265338_10001925 3300028800 Bacteria 32393
358 Ga0307508_10025508 3300031616 Bacteria 5358
359 Ga0316575_10013413 3300031665 Bacteria 3060
360 Ga0307410_10000331 3300031852 Bacteria 18439
361 Ga0307412_10026749 3300031911 Bacteria 3590
362 Ga0307409_100000209 3300031995 Bacteria 23320
363 Ga0307416_100269887 3300032002 Bacteria 1669
364 Ga0307507_10048158 3300033179 Bacteria 4151
365 Ga0395899_0008746 3300037312 Bacteria 7792
366 Ga0395900_0000013 3300037418 Bacteria 388765
367 Ga0395900_0001703 3300037418 Bacteria 25510
368 Ga0395900_0279075 3300037418 Bacteria 1663
369 Ga0395898_0005907 3300037466 Bacteria 13161
370 Ga0395898_0018550 3300037466 Bacteria 7093
371 Ga0395898_0073592 3300037466 Bacteria 3301
372 Ga0395898_0130008 3300037466 Bacteria 2412
373 Ga0395901_0000979 3300038443 Bacteria 30977
374 Ga0395901_0003351 3300038443 Bacteria 16149
375 Ga0395901_0004434 3300038443 Bacteria 14159
376 Ga0395901_0146000 3300038443 Bacteria 2486
377 Ga0436365_0456226 3300039437 Bacteria 3224
378 Ga0453683_0017718 3300044673 Bacteria 4582
379 Ga0451576_0018373 3300045051 Bacteria 7666
380 Ga0451576_0087084 3300045051 Bacteria 3248
381 Ga0466958_0209422 3300045836 Bacteria 1242
382 Ga0495580_0037292 3300046472 Bacteria 3490
383 Ga0495582_0019897 3300046473 Bacteria 3671
384 Ga0495586_0076528 3300046535 Bacteria 1834
385 Ga0495645_0021596 3300046543 Bacteria 4652
386 Ga0495675_0081249 3300047444 Bacteria 2041
387 Ga0496102_0137515 3300048905 Bacteria 2289
388 Ga0496104_0000022 3300048907 Bacteria 237390
389 Ga0496104_0194031 3300048907 Bacteria 1943
390 Ga0496105_0000028 3300048908 Bacteria 145917
391 Ga0496115_0000113 3300048918 Bacteria 74536
392 Ga0496117_0071162 3300048920 Bacteria 2332
393 Ga0496118_0040830 3300048921 Bacteria 3683
394 Ga0496126_0000226 3300048929 Bacteria 122150
395 Ga0501031_0044632 3300049568 Bacteria 2893
396 Ga0501031_0121984 3300049568 Bacteria 1703
397 Ga0501031_0133829 3300049568 Bacteria 1619
398 Ga0501032_0018484 3300049569 Bacteria 4882
399 Ga0501032_0093247 3300049569 Bacteria 1997
400 Ga0501033_0100320 3300049570 Bacteria 2113
401 Ga0501033_0122839 3300049570 Bacteria 1883
402 Ga0501034_0007072 3300049571 Bacteria 11967
403 Ga0501034_0015338 3300049571 Bacteria 7875
404 Ga0501034_0034669 3300049571 Bacteria 5118
405 Ga0501034_0073783 3300049571 Bacteria 3421
406 Ga0501034_0098089 3300049571 Bacteria 2926
407 Ga0501036_0060427 3300049572 Bacteria 3211
408 Ga0501037_0094967 3300049573 Bacteria 2156
409 Ga0501037_0100291 3300049573 Bacteria 2091
410 Ga0501042_0046004 3300049578 Bacteria 3111
411 Ga0501043_0038793 3300049579 Bacteria 3745
412 Ga0501043_0047515 3300049579 Bacteria 3375
413 Ga0501046_0048253 3300049580 Bacteria 3373
414 Ga0501046_0183511 3300049580 Bacteria 1563
415 Ga0501047_0008107 3300049581 Bacteria 9912
416 Ga0501047_0010756 3300049581 Bacteria 8650
417 Ga0501047_0037164 3300049581 Bacteria 4708
418 Ga0501047_0061527 3300049581 Bacteria 3622
419 Ga0501047_0066792 3300049581 Bacteria 3467
420 Ga0501048_0133819 3300049582 Bacteria 1751
421 Ga0501067_0006567 3300049583 Bacteria 6447
422 Ga0501069_0002008 3300049585 Bacteria 10187
423 Ga0501069_0002381 3300049585 Bacteria 9539
424 Ga0501069_0053282 3300049585 Bacteria 2253
425 Ga0501069_0101629 3300049585 Bacteria 1632
426 Ga0501070_0001169 3300049586 Bacteria 23464
427 Ga0501070_0006768 3300049586 Bacteria 9756
428 Ga0501070_0035558 3300049586 Bacteria 4162
429 Ga0501070_0094312 3300049586 Bacteria 2476
430 Ga0501070_0095794 3300049586 Bacteria 2455
431 Ga0501070_0233623 3300049586 Bacteria 1506
432 Ga0501070_0238031 3300049586 Bacteria 1490
433 Ga0501070_0287184 3300049586 Bacteria 1341
434 Ga0501070_0330678 3300049586 Bacteria 1238
435 Ga0501070_0404239 3300049586 Bacteria 1104
436 Ga0501073_0016566 3300049589 Bacteria 5342
437 Ga0501073_0112494 3300049589 Bacteria 1888
438 Ga0501074_0006133 3300049590 Bacteria 8680
439 Ga0501074_0019796 3300049590 Bacteria 4888
440 Ga0501075_0025514 3300049591 Unclassified 4342
441 Ga0501077_0009583 3300049593 Bacteria 6021
442 Ga0501077_0029245 3300049593 Unclassified 3503
443 Ga0501077_0057569 3300049593 Bacteria 2468
444 Ga0501079_0004845 3300049741 Bacteria 9972
445 Ga0501079_0027829 3300049741 Bacteria 4336
446 Ga0501079_0207009 3300049741 Bacteria 1532
447 Ga0501080_0022069 3300049742 Bacteria 5898
448 Ga0501080_0029759 3300049742 Bacteria 5083
449 Ga0501080_0044506 3300049742 Bacteria 4132
450 Ga0501080_0102792 3300049742 Bacteria 2650
451 Ga0501081_0105009 3300049743 Bacteria 2001
452 Ga0501081_0141691 3300049743 Bacteria 1723
453 Ga0501035_0003974 3300049822 Bacteria 14091
454 Ga0501035_0048981 3300049822 Bacteria 3787
455 Ga0501035_0149627 3300049822 Bacteria 2026
456 Ga0501035_0228235 3300049822 Bacteria 1587
457 Ga0501044_0013308 3300049823 Bacteria 8905
458 Ga0501044_0025524 3300049823 Bacteria 6264
459 Ga0501044_0045093 3300049823 Bacteria 4572
460 Ga0501044_0113116 3300049823 Bacteria 2721
461 Ga0501044_0114234 3300049823 Bacteria 2706
462 Ga0501044_0186497 3300049823 Bacteria 2039
463 nmdc:mga00v17_47230_c1 3300050491 Bacteria 2607
464 nmdc:mga05p37_113832_c1 3300050507 Bacteria 3326
465 nmdc:mga05p37_291409_c1 3300050507 Bacteria 1943
466 nmdc:mga0qj67_25161_c1 3300050509 Bacteria 4596
467 nmdc:mga08y16_125488_c1 3300050511 Bacteria 2670
468 nmdc:mga0n895_10275_c1 3300050512 Bacteria 8251
469 nmdc:mga0n895_3695_c1 3300050512 Bacteria 12372
470 nmdc:mga0a205_10403_c1 3300050515 Bacteria 8550
471 nmdc:mga0a205_10950_c1 3300050515 Bacteria 8344
472 nmdc:mga0a205_234393_c1 3300050515 Bacteria 1718
473 nmdc:mga0a205_7123_c1 3300050515 Bacteria 7127
474 Ga0500566_0068356 3300053094 Bacteria 1998
475 Ga0500614_017070 3300053123 Unclassified 1636
476 Ga0501084_0140081 3300054114 Bacteria 2037
477 Ga0590071_000533 3300059421 Bacteria 11128
478 Ga0590074_000858 3300059423 Bacteria 4714
479 Ga0590077_005393 3300059426 Bacteria 2619
480 Ga0530510_0004208 3300061734 Bacteria 9948
481 2538833304 2537561836 Bacteria 3910579
482 2643831958 2643221562 Bacteria 4048635
483 2643895786 2643221577 Bacteria 3710843
484 2644477978 2643221685 Bacteria 3673288
485 2895396101 2895395659 Bacteria 3983269
486 2939613977 2939611941 Bacteria 3892017
487 Ga0501035_0018656
488 JGI24741J21665_1002358
489 JGI24741J21665_1002970
490 JGI24741J21665_1004086
491 JGI24741J21665_1005944
492 JGI24740J21852_10000677
493 JGI25162J39368_1001841
494 JGI25164J39214_1000345
495 JGI25165J46597_1000636
496 rootH1_10106141
497 Ga0070683_100025535
498 Ga0070683_100190536
499 Ga0070666_10000314
500 Ga0070666_10032672
501 Ga0070680_100003177
502 Ga0070680_100005972
503 Ga0070680_100032940
504 Ga0070680_100044483
505 Ga0070680_100046977
506 Ga0070680_100128893
507 Ga0070682_100009003
508 Ga0070682_100021469
509 Ga0070682_100025773
510 Ga0070682_100117220
511 Ga0070691_10000501
512 Ga0070691_10012554
513 Ga0070691_10038582
514 Ga0070661_100002498
515 Ga0070661_100016265
516 Ga0070661_100034251
517 Ga0070661_100070024
518 Ga0070692_10012680
519 Ga0070692_10025553
520 Ga0070692_10026966
521 Ga0070692_10030842
522 Ga0070668_100099571
523 Ga0070675_100175431
524 Ga0070671_100147169
525 Ga0070671_100223929
526 Ga0070688_100060976
527 Ga0070659_100000943
528 Ga0070659_100029031
529 Ga0070667_100181857
530 Ga0070714_100000235
531 Ga0070714_100023648
532 Ga0070714_100040369
533 Ga0070714_100201792
534 Ga0070713_100012199
535 Ga0070711_100212023
536 Ga0070694_100012961
537 Ga0070708_100009016
538 Ga0070663_100043583
539 Ga0070663_100159647
540 Ga0070663_100244994
541 Ga0070678_100003924
542 Ga0070681_10000114
543 Ga0070681_10000622
544 Ga0070681_10003311
545 Ga0070681_10008167
546 Ga0070681_10011291
547 Ga0070681_10018381
548 Ga0070681_10038146
549 Ga0070681_10076025
550 Ga0070681_10113265
551 Ga0070681_10262462
552 Ga0068867_100176634
553 Ga0070685_10005373
554 Ga0070707_100060403
555 Ga0070699_100003602
556 Ga0070679_100001274
557 Ga0070679_100003588
558 Ga0070679_100010031
559 Ga0070679_100037481
560 Ga0070679_100080658
561 Ga0070679_100101906
562 Ga0070679_100147877
563 Ga0070684_100007483
564 Ga0070684_100015884
565 Ga0070684_100035992
566 Ga0070697_100027728
567 Ga0068853_100001081
568 Ga0068853_100001246
569 Ga0068853_100010352
570 Ga0068853_100016049
571 Ga0068853_100017180
572 Ga0068853_100044105
573 Ga0068853_100047360
574 Ga0068853_100121615
575 Ga0068853_100134358
576 Ga0068853_100234394
577 Ga0070672_100206037
578 Ga0070695_100003582
579 Ga0070696_100000684
580 Ga0070696_100039363
581 Ga0070693_100025356
582 Ga0070665_100247293
583 Ga0068855_100010127
584 Ga0068855_100010542
585 Ga0068855_100125914
586 Ga0068855_100161939
587 Ga0068855_100196391
588 Ga0070664_100063198
589 Ga0068857_100087646
590 Ga0068857_100095746
591 Ga0068854_100005877
592 Ga0068854_100057723
593 Ga0068854_100284553
594 Ga0068856_100000167
595 Ga0068856_100009313
596 Ga0068856_100044051
597 Ga0068856_100074184
598 Ga0068852_100004807
599 Ga0068859_100061466
600 Ga0068864_100008439
601 Ga0068863_100000945
602 Ga0068863_100081455
603 Ga0068863_100266817
604 Ga0068860_100001333
605 Ga0075367_10009366
606 Ga0075366_10038867
607 Ga0097621_100056805
608 Ga0097621_100065221
609 Ga0068871_100023696
610 Ga0068871_100105598
611 Ga0068871_100266878
612 Ga0075430_100071093
613 Ga0075430_100125736
614 Ga0075433_10005046
615 Ga0075433_10021343
616 Ga0075433_10212672
617 Ga0075429_100124332
618 Ga0068865_100159803
619 Ga0097620_100061464
620 Ga0099794_10000153
621 Ga0099794_10001771
622 Ga0105240_10008680
623 Ga0105240_10027270
624 Ga0105240_10061107
625 Ga0105240_10144206
626 Ga0105245_10299161
627 Ga0114129_10002469
628 Ga0114129_10083385
629 Ga0114129_10201486
630 Ga0105241_10012344
631 Ga0105241_10034464
632 Ga0105241_10039664
633 Ga0105241_10099362
634 Ga0105242_10006028
635 Ga0105237_10000911
636 Ga0105237_10026586
637 Ga0105237_10040329
638 Ga0105238_10003052
639 Ga0105238_10008148
640 Ga0105238_10024346
641 Ga0105238_10068657
642 Ga0105249_10219654
643 Ga0105239_10003634
644 Ga0105239_10011857
645 Ga0105239_10111133
646 Ga0157373_10002887
647 Ga0157373_10005630
648 Ga0157373_10032430
649 Ga0157371_10004067
650 Ga0157370_10002710
651 Ga0157370_10005919
652 Ga0157370_10012502
653 Ga0157370_10088164
654 Ga0157369_10000027
655 Ga0157369_10003642
656 Ga0157369_10074930
657 Ga0157369_10291982
658 Ga0157369_10399940
659 Ga0157378_10000016
660 Ga0157378_10044097
661 Ga0163162_10000030
662 Ga0163162_10056252
663 Ga0163162_10064190
664 Ga0157372_10008164
665 Ga0157372_10010937
666 Ga0157372_10017426
667 Ga0157372_10020238
668 Ga0157372_10024454
669 Ga0157372_10075360
670 Ga0157372_10103213
671 Ga0157372_10114721
672 Ga0157375_10000997
673 Ga0157375_10136783
674 Ga0163163_10000117
675 Ga0163163_10005615
676 Ga0163163_10132175
677 Ga0182008_10036906
678 Ga0157379_10003292
679 Ga0157376_10029825
680 Ga0157376_10044436
681 Ga0157376_10057009
682 Ga0157376_10070088
683 Ga0157376_10093529
684 Ga0157376_10123199
685 Ga0182006_1035942
686 Ga0197907_10747498
687 Ga0206352_10299377
688 Ga0206354_10306429
689 Ga0206354_11061739
690 Ga0206353_10237724
691 Ga0206353_10324570
692 Ga0206353_10329599
693 Ga0154015_1124833
694 Ga0209674_100650
695 Ga0207427_100202
696 Ga0209437_100121
697 Ga0209646_1001762
698 Ga0209026_1000119
699 Ga0209026_1000123
700 Ga0209026_1000206
701 Ga0209759_1004055
702 Ga0209759_1014949
703 Ga0209233_1000112
704 Ga0209455_1002011
705 Ga0207680_10000560
706 Ga0207647_10001624
707 Ga0207647_10002695
708 Ga0207647_10008025
709 Ga0207647_10026944
710 Ga0207647_10034311
711 Ga0207705_10000527
712 Ga0207705_10003628
713 Ga0207705_10008299
714 Ga0207705_10026947
715 Ga0207705_10109556
716 Ga0207654_10004946
717 Ga0207654_10005653
718 Ga0207654_10007610
719 Ga0207654_10226780
720 Ga0207707_10000039
721 Ga0207707_10000095
722 Ga0207707_10000512
723 Ga0207707_10006690
724 Ga0207707_10009965
725 Ga0207707_10013463
726 Ga0207707_10015033
727 Ga0207707_10043317
728 Ga0207707_10266858
729 Ga0207695_10000094
730 Ga0207695_10001815
731 Ga0207695_10005969
732 Ga0207695_10009808
733 Ga0207695_10026976
734 Ga0207695_10031161
735 Ga0207695_10127299
736 Ga0207671_10000192
737 Ga0207671_10000870
738 Ga0207671_10010932
739 Ga0207671_10021019
740 Ga0207660_10001442
741 Ga0207660_10004915
742 Ga0207660_10009918
743 Ga0207660_10019094
744 Ga0207660_10025791
745 Ga0207660_10032393
746 Ga0207657_10001700
747 Ga0207657_10002396
748 Ga0207657_10007441
749 Ga0207657_10024977
750 Ga0207657_10092278
751 Ga0207649_10000364
752 Ga0207649_10113661
753 Ga0207652_10000376
754 Ga0207652_10000490
755 Ga0207652_10000534
756 Ga0207652_10012622
757 Ga0207652_10016722
758 Ga0207652_10018242
759 Ga0207652_10025013
760 Ga0207652_10039434
761 Ga0207652_10053357
762 Ga0207646_10066410
763 Ga0207694_10007466
764 Ga0207694_10008757
765 Ga0207694_10014462
766 Ga0207694_10023645
767 Ga0207687_10074387
768 Ga0207700_10015517
769 Ga0207664_10000072
770 Ga0207664_10008047
771 Ga0207664_10025303
772 Ga0207664_10067876
773 Ga0207664_10216933
774 Ga0207690_10000414
775 Ga0207690_10009191
776 Ga0207690_10071140
777 Ga0207706_10015774
778 Ga0207706_10144028
779 Ga0207686_10001904
780 Ga0207704_10005114
781 Ga0207691_10204636
782 Ga0207661_10012492
783 Ga0207661_10024684
784 Ga0207679_10059348
785 Ga0207679_10060138
786 Ga0207667_10002892
787 Ga0207667_10005838
788 Ga0207667_10007134
789 Ga0207667_10015807
790 Ga0207667_10033012
791 Ga0207667_10051297
792 Ga0207667_10132316
793 Ga0207667_10195487
794 Ga0207651_10078286
795 Ga0207640_10000493
796 Ga0207640_10003121
797 Ga0207640_10025900
798 Ga0207640_10032380
799 Ga0207640_10034709
800 Ga0207640_10068646
801 Ga0207658_10048892
802 Ga0207703_10156013
803 Ga0207703_10331483
804 Ga0207639_10006624
805 Ga0207639_10021886
806 Ga0207639_10022517
807 Ga0207639_10063116
808 Ga0207639_10085076
809 Ga0207639_10093433
810 Ga0207678_10003195
811 Ga0207678_10003677
812 Ga0207678_10005009
813 Ga0207678_10008398
814 Ga0207678_10051033
815 Ga0207702_10000130
816 Ga0207702_10004060
817 Ga0207702_10008849
818 Ga0207702_10013728
819 Ga0207702_10210089
820 Ga0207641_10010187
821 Ga0207641_10103547
822 Ga0207648_10037081
823 Ga0207676_10001910
824 Ga0207676_10154694
825 Ga0207674_10008275
826 Ga0207674_10014107
827 Ga0207674_10021910
828 Ga0207674_10039504
829 Ga0207674_10263644
830 Ga0207683_10009019
831 Ga0207683_10013960
832 Ga0207698_10009234
833 Ga0207698_10018057
834 Ga0207698_10069250
835 Ga0209983_1000350
836 Ga0209588_1000350
837 Ga0209971_1000188
838 Ga0209974_10003346
839 Ga0207428_10059106
840 Ga0268264_10007864
841 Ga0268264_10011202
842 Ga0265334_10009841
843 Ga0265338_10001925
844 Ga0307508_10025508
845 Ga0316575_10013413
846 Ga0307410_10000331
847 Ga0307412_10026749
848 Ga0307409_100000209
849 Ga0307416_100269887
850 Ga0307507_10048158
851 Ga0395899_0008746
852 Ga0395900_0000013
853 Ga0395900_0001703
854 Ga0395900_0279075
855 Ga0395898_0005907
856 Ga0395898_0018550
857 Ga0395898_0073592
858 Ga0395898_0130008
859 Ga0395901_0000979
860 Ga0395901_0003351
861 Ga0395901_0004434
862 Ga0395901_0146000
863 Ga0436365_0456226
864 Ga0453683_0017718
865 Ga0451576_0018373
866 Ga0451576_0087084
867 Ga0466958_0209422
868 Ga0495580_0037292
869 Ga0495582_0019897
870 Ga0495586_0076528
871 Ga0495645_0021596
872 Ga0495675_0081249
873 Ga0496102_0137515
874 Ga0496104_0000022
875 Ga0496104_0194031
876 Ga0496105_0000028
877 Ga0496115_0000113
878 Ga0496117_0071162
879 Ga0496118_0040830
880 Ga0496126_0000226
881 Ga0501031_0044632
882 Ga0501031_0121984
883 Ga0501031_0133829
884 Ga0501032_0018484
885 Ga0501032_0093247
886 Ga0501033_0100320
887 Ga0501033_0122839
888 Ga0501034_0007072
889 Ga0501034_0015338
890 Ga0501034_0034669
891 Ga0501034_0073783
892 Ga0501034_0098089
893 Ga0501036_0060427
894 Ga0501037_0094967
895 Ga0501037_0100291
896 Ga0501042_0046004
897 Ga0501043_0038793
898 Ga0501043_0047515
899 Ga0501046_0048253
900 Ga0501046_0183511
901 Ga0501047_0008107
902 Ga0501047_0010756
903 Ga0501047_0037164
904 Ga0501047_0061527
905 Ga0501047_0066792
906 Ga0501048_0133819
907 Ga0501067_0006567
908 Ga0501069_0002008
909 Ga0501069_0002381
910 Ga0501069_0053282
911 Ga0501069_0101629
912 Ga0501070_0001169
913 Ga0501070_0006768
914 Ga0501070_0035558
915 Ga0501070_0094312
916 Ga0501070_0095794
917 Ga0501070_0233623
918 Ga0501070_0238031
919 Ga0501070_0287184
920 Ga0501070_0330678
921 Ga0501070_0404239
922 Ga0501073_0016566
923 Ga0501073_0112494
924 Ga0501074_0006133
925 Ga0501074_0019796
926 Ga0501075_0025514
927 Ga0501077_0009583
928 Ga0501077_0029245
929 Ga0501077_0057569
930 Ga0501079_0004845
931 Ga0501079_0027829
932 Ga0501079_0207009
933 Ga0501080_0022069
934 Ga0501080_0029759
935 Ga0501080_0044506
936 Ga0501080_0102792
937 Ga0501081_0105009
938 Ga0501081_0141691
939 Ga0501035_0003974
940 Ga0501035_0048981
941 Ga0501035_0149627
942 Ga0501035_0228235
943 Ga0501044_0013308
944 Ga0501044_0025524
945 Ga0501044_0045093
946 Ga0501044_0113116
947 Ga0501044_0114234
948 Ga0501044_0186497
949 nmdc:mga00v17_47230_c1
950 nmdc:mga05p37_113832_c1
951 nmdc:mga05p37_291409_c1
952 nmdc:mga0qj67_25161_c1
953 nmdc:mga08y16_125488_c1
954 nmdc:mga0n895_10275_c1
955 nmdc:mga0n895_3695_c1
956 nmdc:mga0a205_10403_c1
957 nmdc:mga0a205_10950_c1
958 nmdc:mga0a205_234393_c1
959 nmdc:mga0a205_7123_c1
960 Ga0500566_0068356
961 Ga0500614_017070
962 Ga0501084_0140081
963 Ga0590071_000533
964 Ga0590074_000858
965 Ga0590077_005393
966 Ga0530510_0004208
967 2538833304
968 2643831958
969 2643895786
970 2644477978
971 2895396101
972 2939613977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

55

347

0.93

PF14721

AIF_C

Apoptosis-inducing factor, mitochondrion-associated, C-term

389

430

0.93

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

192

272

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zxn-assembly1.cif.gz_B crystal structure of cura from vibrio vulnificus 0.9674 135 168
4b7x-assembly3.cif.gz_K crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9633 135 167
4bur-assembly3.cif.gz_C crystal structure of the reduced human apoptosis inducing factor complexed with nad 0.9408 4 387
5fmh-assembly1.cif.gz_A crystal structure of the e405k mutant of human apoptosis inducing factor 0.937 3 386
5fs6-assembly2.cif.gz_B crystal structure of the v243l mutant of human apoptosis inducing factor 0.9298 4 376
ID Description Score Start End Superfamily
af_A0A1D6HP35_184_301_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9582 139 237 3.50.50.60
5vg6D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9508 139 166 3.40.50.720
af_Q54LY2_135_306_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9505 135 166 3.40.50.720
af_Q55GI5_4_227_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9465 5 41 3.50.50.60
af_A0A0R0JZ96_141_231_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9442 121 198 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6H9HWF7-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9934 1 395 GO:0005737
GO:0012501
GO:0016174
GO:0033108
GO:0046983
GO:0071949
AF-A0A1G3FVJ0-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9866 1 391 GO:0005737
GO:0012501
GO:0016174
GO:0033108
GO:0071949
AF-A0A1G3FVJ0-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9791 1 391 GO:0005737
GO:0012501
GO:0016174
GO:0033108
GO:0071949
AF-A0A5C1A0J1-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.973 1 390 GO:0005737
GO:0012501
GO:0016174
GO:0033108
GO:0046983
GO:0071949
AF-A0A2T2X3W4-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9714 66 392 GO:0005737
GO:0012501
GO:0016174
GO:0033108
GO:0046983
GO:0071949

Map