F453375

General Info

Members Datasets Scaffolds Average Seq Length
486 312 972 171

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3004334049|3004335055
Length 206
Sequence AMPASDGVLSSGAWQAVHTNVRTRNRIKKGESAMTIRDLMPWSRDTSQSPTLFREGDRDPFMGLHREMSRLVDDMFRGFEARLPSMGRFSSSGTGWPSVEISETDKEIRVTAEIPGMEEKDIEVLLDDGVLTLRGEKHSETDDKERQFSERYYGRFERRIPIGFEVAEDKVAADFRNGVLSVSLPKSEKAQSKAKRIPIGGKSTKH

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
19 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
44 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
139 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
142 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
143 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
144 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
145 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
159 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
160 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
161 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
162 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
163 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
164 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
165 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
166 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
167 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
168 2519899620 Rhizobium sp. Pop5 Isolate Nodule
169 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
170 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
171 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
172 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
173 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
174 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
175 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
176 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
177 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
178 2791355263 Rhizobium chutanense C5 Isolate Nodule
179 2802429633 Rhizobium anhuiense J3 Isolate Nodule
180 2802429634 Rhizobium anhuiense S10 Isolate Nodule
181 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
182 2802429637 Rhizobium anhuiense C15 Isolate Nodule
183 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
184 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
185 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
186 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
187 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
188 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
189 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
190 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
191 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
192 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
193 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
194 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
195 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
196 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
197 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
198 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
199 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
200 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
201 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
202 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
203 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
204 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
205 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
206 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
207 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
208 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
209 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
210 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
211 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
212 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
213 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
214 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
215 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
216 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
217 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
218 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
219 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
220 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
221 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
222 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
223 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
224 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
225 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
226 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
227 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
228 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
229 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
230 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
231 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
232 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
233 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
234 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
235 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
236 2909042592 Labrys sp. LIt4 Isolate Nodule
237 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
238 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
239 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
240 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
241 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
242 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
243 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
244 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
245 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
246 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
247 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
248 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
249 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
250 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
251 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
252 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
253 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
254 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
255 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
256 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
257 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
258 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
259 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
260 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
261 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
262 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
263 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
264 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
265 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
266 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
267 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
268 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
269 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
270 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
271 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
272 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
273 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
274 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
275 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
276 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
277 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
278 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
279 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
280 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
281 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
282 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
283 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
284 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
285 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
286 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
287 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
288 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
289 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
290 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
291 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
292 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
293 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
294 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
295 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
296 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
297 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
298 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
299 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
300 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
301 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
302 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
303 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
304 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
305 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
306 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
307 8005395548 Rhizobium sp. R339 Isolate Nodule
308 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
309 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
310 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
311 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
312 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.08
Metatranscriptomes 7.41
Isolates 32.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.37
Nodule 26.75
Rhizoplane 0.41
Rhizosphere 46.71
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10028615 3300002067 Bacteria 1663
2 JGI25158J39367_1000042 3300002739 Bacteria 28727
3 JGI25152J39213_1000013 3300002773 Bacteria 123999
4 JGI25152J39213_1003597 3300002773 Bacteria 5244
5 JGI25150J39212_1011548 3300002774 Bacteria 1595
6 JGI25159J45721_1000085 3300002987 Bacteria 44498
7 JGI25159J45721_1002356 3300002987 Bacteria 7217
8 JGI25151J46595_10007708 3300003187 Bacteria 5244
9 JGI25153J46596_10000431 3300003215 Bacteria 27175
10 JGI25153J46596_10002198 3300003215 Bacteria 11387
11 JGI25153J46596_10006583 3300003215 Bacteria 5855
12 rootH2_10033906 3300003320 Bacteria 3133
13 rootL2_10030665 3300003322 Bacteria 7946
14 JGI25160J50197_1000338 3300003354 Bacteria 31837
15 JGI25160J50197_1003170 3300003354 Bacteria 7467
16 JGI25161J50226_1000127 3300003374 Bacteria 54223
17 JGI25161J50226_1002971 3300003374 Bacteria 4085
18 Ga0055526_1001025 3300003771 Bacteria 20443
19 Ga0055526_1001148 3300003771 Bacteria 19198
20 Ga0055526_1001318 3300003771 Bacteria 17768
21 Ga0055524_1006004 3300003775 Bacteria 5333
22 Ga0055524_1015078 3300003775 Bacteria 2834
23 Ga0055528_1000419 3300003790 Bacteria 34106
24 Ga0055528_1002004 3300003790 Bacteria 11424
25 Ga0055528_1003175 3300003790 Bacteria 8405
26 Ga0055528_1006419 3300003790 Bacteria 5333
27 Ga0055540_1000157 3300003792 Bacteria 67204
28 Ga0055540_1005466 3300003792 Bacteria 5333
29 Ga0055531_10041535 3300003794 Bacteria 1330
30 Ga0055543_1000042 3300004625 Bacteria 117438
31 Ga0055543_1001729 3300004625 Bacteria 8187
32 Ga0058859_10021766 3300004798 Bacteria 887
33 Ga0058860_12142944 3300004801 Unclassified 645
34 Ga0065165_1001760 3300005262 Bacteria 21503
35 Ga0065165_1012898 3300005262 Bacteria 3362
36 Ga0070658_10256381 3300005327 Bacteria 1484
37 Ga0070658_11374603 3300005327 Bacteria 613
38 Ga0068867_100059064 3300005459 Bacteria 2843
39 Ga0070665_100061081 3300005548 Bacteria 3778
40 Ga0068855_100168024 3300005563 Bacteria 2485
41 Ga0070664_102040966 3300005564 Bacteria 544
42 Ga0068857_100727485 3300005577 Bacteria 944
43 Ga0068852_100498158 3300005616 Bacteria 1213
44 Ga0075365_10002802 3300006038 Bacteria 8728
45 Ga0075365_10058731 3300006038 Bacteria 2562
46 Ga0075365_10629597 3300006038 Bacteria 758
47 Ga0075364_10028240 3300006051 Bacteria 3591
48 Ga0075362_10040207 3300006177 Bacteria 2058
49 Ga0075362_10042875 3300006177 Bacteria 2002
50 Ga0075367_10042991 3300006178 Bacteria 2646
51 Ga0075367_10121985 3300006178 Bacteria 1606
52 Ga0075367_10231712 3300006178 Bacteria 1156
53 Ga0075369_10108873 3300006186 Bacteria 1248
54 Ga0075369_10308403 3300006186 Bacteria 739
55 Ga0097621_100714182 3300006237 Bacteria 924
56 Ga0075370_10008584 3300006353 Bacteria 5265
57 Ga0105240_10463426 3300009093 Bacteria 1415
58 Ga0105237_10539010 3300009545 Bacteria 1174
59 Ga0105237_11268034 3300009545 Bacteria 743
60 Ga0105239_10010184 3300010375 Bacteria 10531
61 Ga0157369_10822255 3300013105 Bacteria 954
62 Ga0157372_10296464 3300013307 Bacteria 1881
63 Ga0182006_1113832 3300015261 Bacteria 947
64 Ga0197907_10330925 3300020069 Bacteria 853
65 Ga0197907_10494340 3300020069 Bacteria 884
66 Ga0197907_10956647 3300020069 Bacteria 1230
67 Ga0206349_1012539 3300020075 Bacteria 1207
68 Ga0206349_1502532 3300020075 Bacteria 1358
69 Ga0206355_1087905 3300020076 Bacteria 975
70 Ga0206355_1361766 3300020076 Bacteria 1060
71 Ga0206351_10210669 3300020077 Bacteria 2056
72 Ga0206351_10260865 3300020077 Bacteria 1379
73 Ga0206351_10459078 3300020077 Bacteria 1475
74 Ga0206351_10684472 3300020077 Bacteria 860
75 Ga0206350_10007103 3300020080 Bacteria 2516
76 Ga0206350_10281620 3300020080 Bacteria 1337
77 Ga0206350_10460937 3300020080 Bacteria 1088
78 Ga0206350_10746107 3300020080 Bacteria 768
79 Ga0206350_11455520 3300020080 Bacteria 1176
80 Ga0206354_10583857 3300020081 Bacteria 1266
81 Ga0154015_1135587 3300020610 Bacteria 1512
82 Ga0224712_10021017 3300022467 Bacteria 2227
83 Ga0224712_10059381 3300022467 Bacteria 1518
84 Ga0224712_10081317 3300022467 Bacteria 1338
85 Ga0224712_10090354 3300022467 Bacteria 1281
86 Ga0224712_10206508 3300022467 Bacteria 894
87 Ga0224712_10219139 3300022467 Bacteria 870
88 Ga0224712_10270309 3300022467 Bacteria 789
89 Ga0209436_100036 3300025208 Bacteria 78433
90 Ga0207425_1000740 3300025245 Bacteria 17135
91 Ga0207425_1001994 3300025245 Bacteria 7630
92 Ga0209148_1000037 3300025254 Bacteria 494767
93 Ga0209129_1000092 3300025258 Bacteria 173874
94 Ga0209129_1000375 3300025258 Bacteria 36282
95 Ga0209233_1053530 3300025261 Bacteria 809
96 Ga0209565_1020926 3300025263 Bacteria 1374
97 Ga0209455_1000036 3300025272 Bacteria 473309
98 Ga0209455_1038991 3300025272 Bacteria 737
99 Ga0209673_1000162 3300025273 Bacteria 139078
100 Ga0209673_1000202 3300025273 Bacteria 119738
101 Ga0209673_1002833 3300025273 Bacteria 11145
102 Ga0209673_1026691 3300025273 Bacteria 1891
103 Ga0209130_1000073 3300025284 Bacteria 174439
104 Ga0209675_1018550 3300025291 Bacteria 1944
105 Ga0209676_1061472 3300025292 Bacteria 932
106 Ga0209025_1011419 3300025294 Bacteria 5856
107 Ga0209564_1000234 3300025295 Bacteria 121532
108 Ga0209564_1001033 3300025295 Bacteria 34144
109 Ga0209564_1002168 3300025295 Bacteria 16551
110 Ga0209758_1000201 3300025297 Bacteria 132855
111 Ga0209758_1003900 3300025297 Bacteria 13033
112 Ga0209758_1009820 3300025297 Bacteria 5855
113 Ga0209050_1001019 3300025298 Bacteria 34942
114 Ga0209256_1000937 3300025299 Bacteria 35428
115 Ga0209256_1005565 3300025299 Bacteria 7186
116 Ga0209256_1006568 3300025299 Bacteria 6101
117 Ga0209256_1027959 3300025299 Bacteria 1599
118 Ga0207426_1000140 3300025302 Bacteria 195664
119 Ga0207426_1000764 3300025302 Bacteria 35763
120 Ga0209051_1000032 3300025303 Bacteria 383445
121 Ga0209051_1001485 3300025303 Bacteria 19706
122 Ga0209051_1006744 3300025303 Bacteria 6410
123 Ga0209257_1016191 3300025304 Bacteria 3036
124 Ga0209257_1018782 3300025304 Bacteria 2639
125 Ga0209257_1033689 3300025304 Bacteria 1608
126 Ga0207647_10004677 3300025904 Bacteria 10141
127 Ga0207647_10122139 3300025904 Bacteria 1535
128 Ga0207705_10579428 3300025909 Bacteria 872
129 Ga0207695_10116757 3300025913 Bacteria 2642
130 Ga0207671_10415975 3300025914 Bacteria 1070
131 Ga0207639_10150955 3300026041 Bacteria 1946
132 Ga0207639_10369092 3300026041 Bacteria 1286
133 Ga0207678_10051352 3300026067 Bacteria 3560
134 Ga0207648_10109194 3300026089 Bacteria 2428
135 Ga0207698_10295239 3300026142 Bacteria 1506
136 Ga0209371_1002146 3300027312 Bacteria 11613
137 Ga0209813_10205309 3300027866 Bacteria 731
138 Ga0268266_10053251 3300028379 Bacteria 3476
139 Ga0268266_10066738 3300028379 Bacteria 3112
140 Ga0268266_10529179 3300028379 Bacteria 1128
141 Ga0268256_1002051 3300030500 Bacteria 10871
142 Ga0307516_10156762 3300031730 Bacteria 2031
143 Ga0307405_10905648 3300031731 Unclassified 746
144 Ga0307410_11230476 3300031852 Unclassified 653
145 Ga0307406_10396950 3300031901 Bacteria 1092
146 Ga0307409_100302381 3300031995 Bacteria 1489
147 Ga0307409_100464636 3300031995 Bacteria 1224
148 Ga0307409_100750403 3300031995 Bacteria 980
149 Ga0307414_10777115 3300032004 Bacteria 872
150 Ga0307414_11025185 3300032004 Unclassified 760
151 Ga0307414_11111067 3300032004 Bacteria 730
152 Ga0373935_0568113 3300035692 Bacteria 828
153 Ga0395900_0000101 3300037418 Bacteria 153550
154 Ga0395900_0671243 3300037418 Bacteria 972
155 Ga0395898_0000043 3300037466 Bacteria 301783
156 Ga0395905_0000101 3300037471 Bacteria 144115
157 Ga0395905_0147363 3300037471 Bacteria 2214
158 Ga0395905_0275366 3300037471 Bacteria 1569
159 Ga0395901_0000068 3300038443 Bacteria 144095
160 Ga0395901_0125530 3300038443 Bacteria 2697
161 Ga0395901_0911195 3300038443 Bacteria 860
162 Ga0439465_0002628 3300041413 Bacteria 5866
163 Ga0439465_0011685 3300041413 Bacteria 2754
164 Ga0451837_0389381 3300041494 Bacteria 1314
165 Ga0451853_1324418 3300041512 Bacteria 6314
166 Ga0466972_0000819 3300044658 Bacteria 14870
167 Ga0466967_0143609 3300045976 Bacteria 2225
168 Ga0495638_0000151 3300046460 Bacteria 109795
169 Ga0495610_0023702 3300046512 Bacteria 3328
170 Ga0495632_0038487 3300046519 Bacteria 2421
171 Ga0495597_0032902 3300046542 Bacteria 2351
172 Ga0495668_0023153 3300046616 Bacteria 3545
173 Ga0495625_0043077 3300046660 Bacteria 3276
174 Ga0495625_0129469 3300046660 Bacteria 1710
175 Ga0495661_0110860 3300046665 Bacteria 1530
176 Ga0495649_0031038 3300046694 Bacteria 2948
177 Ga0495636_0545992 3300047318 Bacteria 563
178 Ga0495686_0075504 3300047472 Bacteria 2066
179 Ga0495686_0195143 3300047472 Bacteria 1165
180 Ga0496112_0240550 3300048915 Bacteria 1763
181 Ga0496124_0271032 3300048927 Bacteria 1243
182 Ga0496124_0526847 3300048927 Bacteria 786
183 Ga0501031_0000068 3300049568 Bacteria 56283
184 Ga0501031_0000264 3300049568 Bacteria 29616
185 Ga0501031_0230827 3300049568 Bacteria 1204
186 Ga0501032_0000043 3300049569 Bacteria 111758
187 Ga0501032_0000103 3300049569 Bacteria 72143
188 Ga0501032_0008984 3300049569 Bacteria 7269
189 Ga0501032_0010278 3300049569 Bacteria 6752
190 Ga0501032_0026629 3300049569 Bacteria 3975
191 Ga0501032_0137782 3300049569 Bacteria 1608
192 Ga0501032_0227868 3300049569 Bacteria 1212
193 Ga0501033_0000865 3300049570 Bacteria 27668
194 Ga0501033_0006120 3300049570 Bacteria 9440
195 Ga0501033_0008141 3300049570 Bacteria 8117
196 Ga0501033_0010229 3300049570 Bacteria 7199
197 Ga0501033_0038878 3300049570 Bacteria 3554
198 Ga0501033_0086693 3300049570 Bacteria 2292
199 Ga0501034_0000204 3300049571 Bacteria 112606
200 Ga0501034_0000365 3300049571 Bacteria 77224
201 Ga0501034_0094106 3300049571 Bacteria 2993
202 Ga0501034_0106776 3300049571 Bacteria 2792
203 Ga0501034_0322236 3300049571 Bacteria 1478
204 Ga0501034_0564023 3300049571 Bacteria 1047
205 Ga0501034_0617192 3300049571 Bacteria 988
206 Ga0501036_0000017 3300049572 Bacteria 125802
207 Ga0501036_0000058 3300049572 Bacteria 72516
208 Ga0501036_0018095 3300049572 Bacteria 5898
209 Ga0501036_0072606 3300049572 Bacteria 2909
210 Ga0501036_0308378 3300049572 Bacteria 1323
211 Ga0501037_0000028 3300049573 Bacteria 139838
212 Ga0501037_0000157 3300049573 Bacteria 63800
213 Ga0501037_0006743 3300049573 Bacteria 8400
214 Ga0501037_0012889 3300049573 Bacteria 6162
215 Ga0501037_0015189 3300049573 Bacteria 5666
216 Ga0501037_0057158 3300049573 Bacteria 2848
217 Ga0501037_0077194 3300049573 Bacteria 2417
218 Ga0501037_0293419 3300049573 Bacteria 1130
219 Ga0501038_0000035 3300049574 Bacteria 125802
220 Ga0501038_0000091 3300049574 Bacteria 77224
221 Ga0501038_0001470 3300049574 Bacteria 21665
222 Ga0501038_0010007 3300049574 Bacteria 8684
223 Ga0501038_0014600 3300049574 Bacteria 7158
224 Ga0501038_0022721 3300049574 Bacteria 5615
225 Ga0501038_0126134 3300049574 Bacteria 2106
226 Ga0501038_0324623 3300049574 Bacteria 1203
227 Ga0501039_0000039 3300049575 Bacteria 117306
228 Ga0501039_0000071 3300049575 Bacteria 77224
229 Ga0501039_0041880 3300049575 Bacteria 3538
230 Ga0501039_0314287 3300049575 Bacteria 1231
231 Ga0501042_0885935 3300049578 Bacteria 650
232 Ga0501043_0000028 3300049579 Bacteria 144125
233 Ga0501043_0000541 3300049579 Bacteria 34086
234 Ga0501043_0001914 3300049579 Bacteria 17825
235 Ga0501043_0010065 3300049579 Bacteria 7413
236 Ga0501043_0036669 3300049579 Bacteria 3858
237 Ga0501043_0083106 3300049579 Bacteria 2517
238 Ga0501043_0345015 3300049579 Bacteria 1132
239 Ga0501046_0018664 3300049580 Bacteria 5764
240 Ga0501046_0180554 3300049580 Bacteria 1578
241 Ga0501046_0236640 3300049580 Bacteria 1348
242 Ga0501047_0000797 3300049581 Bacteria 32944
243 Ga0501047_0001709 3300049581 Bacteria 21343
244 Ga0501047_0007886 3300049581 Bacteria 10039
245 Ga0501047_0040165 3300049581 Bacteria 4525
246 Ga0501048_0014403 3300049582 Bacteria 5855
247 Ga0501048_0373378 3300049582 Bacteria 1018
248 Ga0501067_0035549 3300049583 Bacteria 2767
249 Ga0501068_0015192 3300049584 Bacteria 4419
250 Ga0501068_0031738 3300049584 Bacteria 3138
251 Ga0501069_0000014 3300049585 Bacteria 146321
252 Ga0501069_0000219 3300049585 Bacteria 25569
253 Ga0501069_0004377 3300049585 Bacteria 7290
254 Ga0501070_0000406 3300049586 Bacteria 39138
255 Ga0501070_0001318 3300049586 Bacteria 22187
256 Ga0501070_0026255 3300049586 Bacteria 4889
257 Ga0501070_0076267 3300049586 Bacteria 2775
258 Ga0501070_0252695 3300049586 Bacteria 1442
259 Ga0501070_0558058 3300049586 Bacteria 916
260 Ga0501071_0343585 3300049587 Bacteria 1135
261 Ga0501073_0045654 3300049589 Bacteria 3085
262 Ga0501073_0088517 3300049589 Bacteria 2153
263 Ga0501073_0188375 3300049589 Bacteria 1427
264 Ga0501074_0000004 3300049590 Bacteria 114255
265 Ga0501074_0000091 3300049590 Bacteria 43600
266 Ga0501074_0063794 3300049590 Bacteria 2653
267 Ga0501074_0270046 3300049590 Bacteria 1209
268 Ga0501074_0559751 3300049590 Bacteria 809
269 Ga0501080_0000027 3300049742 Bacteria 89243
270 Ga0501080_0017479 3300049742 Bacteria 6632
271 Ga0501080_0049895 3300049742 Bacteria 3895
272 Ga0501080_0169640 3300049742 Bacteria 2013
273 Ga0501080_0202814 3300049742 Bacteria 1820
274 Ga0501080_0367205 3300049742 Bacteria 1298
275 Ga0501081_0137972 3300049743 Bacteria 1747
276 Ga0501083_0000025 3300049744 Bacteria 121349
277 Ga0501083_0000163 3300049744 Bacteria 43606
278 Ga0501083_0294773 3300049744 Bacteria 1055
279 Ga0501268_023095 3300049765 Bacteria 1078
280 Ga0501035_0000129 3300049822 Bacteria 92221
281 Ga0501035_0000503 3300049822 Bacteria 44064
282 Ga0501035_0008686 3300049822 Bacteria 9457
283 Ga0501035_0014960 3300049822 Bacteria 7159
284 Ga0501035_0021270 3300049822 Bacteria 5963
285 Ga0501035_0071342 3300049822 Bacteria 3075
286 Ga0501035_0302197 3300049822 Bacteria 1348
287 Ga0501044_0000052 3300049823 Bacteria 143626
288 Ga0501044_0000225 3300049823 Bacteria 71586
289 Ga0501044_0003390 3300049823 Bacteria 17953
290 Ga0501044_0020644 3300049823 Bacteria 7033
291 Ga0501044_0022321 3300049823 Bacteria 6745
292 Ga0501044_0023314 3300049823 Bacteria 6584
293 Ga0501044_0033565 3300049823 Bacteria 5392
294 Ga0501044_0072082 3300049823 Bacteria 3512
295 Ga0501044_0171771 3300049823 Bacteria 2139
296 Ga0501045_0010128 3300049824 Bacteria 6597
297 Ga0501045_0463589 3300049824 Bacteria 942
298 nmdc:mga03683_129125_c1 3300050489 Bacteria 1129
299 nmdc:mga03683_46953_c1 3300050489 Bacteria 1791
300 nmdc:mga03n38_310676_c1 3300050490 Bacteria 849
301 nmdc:mga0yw44_337756_c1 3300050492 Bacteria 1013
302 nmdc:mga0yw44_45434_c1 3300050492 Bacteria 2633
303 nmdc:mga0yw44_75299_c1 3300050492 Bacteria 2104
304 nmdc:mga06z11_112371_c1 3300050494 Bacteria 1510
305 nmdc:mga06z11_303130_c1 3300050494 Bacteria 950
306 nmdc:mga06z11_30812_c1 3300050494 Bacteria 2599
307 nmdc:mga04h51_234615_c1 3300050495 Bacteria 731
308 nmdc:mga07m45_57123_c1 3300050496 Bacteria 2206
309 nmdc:mga0sz30_4290_c1 3300050516 Bacteria 5143
310 nmdc:mga0sz30_63467_c1 3300050516 Bacteria 1581
311 Ga0500610_0222798 3300053079 Bacteria 891
312 Ga0500578_0018929 3300053086 Bacteria 4420
313 Ga0500658_0005008 3300053134 Bacteria 4936
314 Ga0500604_0061783 3300053151 Bacteria 1178
315 Ga0500616_0026619 3300053153 Bacteria 3199
316 Ga0500627_0040650 3300053158 Bacteria 1996
317 Ga0501084_1455180 3300054114 Bacteria 574
318 Ga0587073_0083541 3300059492 Bacteria 798
319 Ga0587088_033238 3300059508 Bacteria 934
320 Ga0587088_044532 3300059508 Bacteria 848
321 Ga0587089_034100 3300059509 Bacteria 763
322 Ga0587106_029019 3300059605 Bacteria 876
323 Ga0587128_044341 3300059630 Bacteria 790
324 Ga0587075_026417 3300059644 Bacteria 898
325 Ga0587107_042279 3300059652 Bacteria 741
326 Ga0587114_019581 3300059655 Bacteria 940
327 Ga0501082_0087812 3300060353 Bacteria 2683
328 Ga0501082_0391944 3300060353 Bacteria 1212
329 3004335055 3004334049 Bacteria 8449246
330 2503201115 2503198000 Bacteria 6884444
331 2509143918 2508501127 Bacteria 7037543
332 2510131870 2510065019 Bacteria 6903379
333 2510137138 2510065019 Bacteria 6903379
334 2512931995 2512875016 Bacteria 6529530
335 2513600426 2513237088 Bacteria 6927906
336 2513871862 2513237138 Bacteria 7368160
337 2513924776 2513237146 Bacteria 7166346
338 2517099915 2517093000 Bacteria 7412387
339 2517405431 2517287029 Bacteria 6905599
340 2520377831 2519899620 Bacteria 6499161
341 2588517871 2588253730 Bacteria 6881675
342 2597813066 2597489875 Bacteria 7010078
343 2599416335 2599185170 Bacteria 7295545
344 2616296817 2615840624 Bacteria 6557588
345 2671116694 2667528174 Bacteria 6435400
346 2688598035 2687453392 Bacteria 6880454
347 2694631452 2693429783 Bacteria 7019804
348 2694640130 2693429784 Bacteria 7241525
349 2739033432 2738541333 Bacteria 7106503
350 2793343666 2791355263 Bacteria 6872478
351 2806049829 2802429633 Bacteria 7341974
352 2806049838 2802429633 Bacteria 7341974
353 2806051218 2802429634 Bacteria 7083200
354 2806057609 2802429635 Bacteria 7650140
355 2806078049 2802429637 Bacteria 7067217
356 2819612346 2818991448 Bacteria 6772224
357 2838036453 2838035591 Bacteria 7166484
358 2838693842 2838686498 Bacteria 7807632
359 2838736234 2838729681 Bacteria 7400765
360 2838749053 2838742623 Bacteria 7396178
361 2841738926 2841734538 Bacteria 6784580
362 2841858967 2841851746 Bacteria 7532261
363 2842236587 2842229732 Bacteria 7475766
364 2842250184 2842243621 Bacteria 7421798
365 2842263982 2842257432 Bacteria 7401195
366 2842278174 2842271015 Bacteria 7807131
367 2842311035 2842304105 Bacteria 7023636
368 2842342361 2842341865 Bacteria 7003929
369 2844460010 2844454524 Bacteria 7952546
370 2856333744 2856328259 Bacteria 6528202
371 2856338134 2856334872 Bacteria 7037011
372 2857356033 2857349434 Bacteria 7926032
373 2857369002 2857367948 Bacteria 6965560
374 2857524132 2857516855 Bacteria 7787325
375 2857524524 2857516855 Bacteria 7787325
376 2869275114 2869271264 Bacteria 6908218
377 2869292908 2869285874 Bacteria 6901219
378 2871429721 2871429161 Bacteria 6547891
379 2871481132 2871474448 Bacteria 6806570
380 2871497144 2871495908 Bacteria 6935695
381 2874128293 2874123672 Bacteria 7238285
382 2874147185 2874146452 Bacteria 7533118
383 2874156775 2874155637 Bacteria 6724144
384 2876368984 2876363079 Bacteria 6544991
385 2876383421 2876377896 Bacteria 6565995
386 2876404933 2876399893 Bacteria 6927900
387 2876414275 2876413966 Bacteria 6831344
388 2878746107 2878745973 Bacteria 6867388
389 2878761365 2878760144 Bacteria 6823465
390 2878768332 2878767105 Bacteria 6898628
391 2878779093 2878774303 Bacteria 6108671
392 2878782203 2878781027 Bacteria 6834456
393 2878790687 2878788777 Bacteria 6567085
394 2881153231 2881147464 Bacteria 7779814
395 2885311234 2885305155 Bacteria 7348390
396 2885326406 2885326080 Bacteria 7134805
397 2885334133 2885334103 Bacteria 7216818
398 2888345652 2888343758 Bacteria 6611049
399 2889012761 2889010040 Bacteria 6749192
400 2889022328 2889016732 Bacteria 6700763
401 2891374018 2891373044 Bacteria 5202277
402 2903502016 2903492973 Bacteria 13473544
403 2903527982 2903521522 Bacteria 6525694
404 2903529706 2903528002 Bacteria 6586099
405 2903541939 2903540706 Bacteria 7062119
406 2906308620 2906308376 Bacteria 6841989
407 2906321788 2906321335 Bacteria 6579571
408 2906380962 2906378014 Bacteria 6911440
409 2906413609 2906408224 Bacteria 6162342
410 2909048505 2909042592 Bacteria 6499737
411 2919107406 2919100787 Bacteria 7710546
412 2919173805 2919171160 Bacteria 6499771
413 2922157862 2922151315 Bacteria 6902399
414 2922180365 2922178524 Bacteria 6025201
415 2923561798 2923556063 Bacteria 6793593
416 2924761044 2924754689 Bacteria 6774424
417 2933577539 2933570622 Bacteria 7023390
418 2936371279 2936367885 Bacteria 7324495
419 2936375518 2936375103 Bacteria 6652732
420 2937815224 2937813078 Bacteria 7783518
421 2937842983 2937836603 Bacteria 6811263
422 2937854115 2937848649 Bacteria 6983481
423 2937995795 2937994558 Bacteria 7036190
424 2938021336 2938014810 Bacteria 6700592
425 2958049164 2958041894 Bacteria 13082850
426 2958072199 2958071322 Bacteria 6815895
427 2958101761 2958100919 Bacteria 6800575
428 2958124151 2958122699 Bacteria 7280457
429 2958137199 2958130278 Bacteria 6897202
430 2958141363 2958137437 Bacteria 6050276
431 2958159126 2958158011 Bacteria 6058449
432 2958166267 2958165035 Bacteria 6906348
433 2958174230 2958172287 Bacteria 6716688
434 2958180424 2958179912 Bacteria 6874908
435 2961078256 2961077736 Bacteria 7079850
436 2961142597 2961136820 Bacteria 6775228
437 2961164729 2961163497 Bacteria 6901077
438 2963647213 2963644680 Bacteria 6530403
439 2965019555 2965018300 Bacteria 6883036
440 2965026037 2965025482 Bacteria 6532201
441 2965036075 2965032056 Bacteria 6887443
442 2965054973 2965047637 Bacteria 6623551
443 2965109734 2965102966 Bacteria 6800987
444 2965115896 2965110997 Bacteria 6693150
445 2965121064 2965119406 Bacteria 6956431
446 2968087952 2968083720 Bacteria 7351627
447 2968118107 2968117919 Bacteria 6536078
448 2968173131 2968171901 Bacteria 6894245
449 2970543186 2970540015 Bacteria 6977556
450 2970551731 2970547951 Bacteria 6931819
451 2970556221 2970554993 Bacteria 6814252
452 2977844691 2977843712 Bacteria 6753583
453 2977872191 2977864932 Bacteria 7534097
454 2977874877 2977872689 Bacteria 7270173
455 2977927471 2977922695 Bacteria 6956781
456 2977936621 2977935797 Bacteria 6252826
457 2977944091 2977942078 Bacteria 7570577
458 2977958075 2977957713 Bacteria 6877875
459 2979710875 2979710463 Bacteria 6785254
460 2979794812 2979793036 Bacteria 6808957
461 2987639847 2987636660 Bacteria 8088555
462 2987647861 2987645492 Bacteria 6117018
463 2987654461 2987652177 Bacteria 6969023
464 2987660738 2987659509 Bacteria 6966464
465 2987678701 2987673487 Bacteria 6884027
466 2996339969 2996336353 Bacteria 5511628
467 3004189786 3004188549 Bacteria 6952365
468 3004207420 3004203850 Bacteria 7307914
469 3004215783 3004211236 Bacteria 7417683
470 3004224560 3004218560 Bacteria 7421728
471 3004241308 3004239961 Bacteria 6892290
472 3005417985 3005416602 Bacteria 7064308
473 637075090 637000159 Bacteria 7596297
474 649872567 649633066 Bacteria 6690028
475 8004302976 8004300914 Bacteria 6132239
476 8004389199 8004387939 Bacteria 7049250
477 8004403305 8004395343 Bacteria 6620908
478 8004634383 8004633249 Bacteria 6723080
479 8004714876 8004714634 Bacteria 6776161
480 8005319954 8005314921 Bacteria 7072929
481 8005398056 8005395548 Bacteria 6806915
482 8005487838 8005484373 Bacteria 6297373
483 8005645611 8005645114 Bacteria 6950293
484 8005686157 8005682033 Bacteria 6726518
485 8018131125 8018127388 Bacteria 7351159
486 8023684827 8023680758 Bacteria 7729763
487 JGI24735J21928_10028615
488 JGI25158J39367_1000042
489 JGI25152J39213_1000013
490 JGI25152J39213_1003597
491 JGI25150J39212_1011548
492 JGI25159J45721_1000085
493 JGI25159J45721_1002356
494 JGI25151J46595_10007708
495 JGI25153J46596_10000431
496 JGI25153J46596_10002198
497 JGI25153J46596_10006583
498 rootH2_10033906
499 rootL2_10030665
500 JGI25160J50197_1000338
501 JGI25160J50197_1003170
502 JGI25161J50226_1000127
503 JGI25161J50226_1002971
504 Ga0055526_1001025
505 Ga0055526_1001148
506 Ga0055526_1001318
507 Ga0055524_1006004
508 Ga0055524_1015078
509 Ga0055528_1000419
510 Ga0055528_1002004
511 Ga0055528_1003175
512 Ga0055528_1006419
513 Ga0055540_1000157
514 Ga0055540_1005466
515 Ga0055531_10041535
516 Ga0055543_1000042
517 Ga0055543_1001729
518 Ga0058859_10021766
519 Ga0058860_12142944
520 Ga0065165_1001760
521 Ga0065165_1012898
522 Ga0070658_10256381
523 Ga0070658_11374603
524 Ga0068867_100059064
525 Ga0070665_100061081
526 Ga0068855_100168024
527 Ga0070664_102040966
528 Ga0068857_100727485
529 Ga0068852_100498158
530 Ga0075365_10002802
531 Ga0075365_10058731
532 Ga0075365_10629597
533 Ga0075364_10028240
534 Ga0075362_10040207
535 Ga0075362_10042875
536 Ga0075367_10042991
537 Ga0075367_10121985
538 Ga0075367_10231712
539 Ga0075369_10108873
540 Ga0075369_10308403
541 Ga0097621_100714182
542 Ga0075370_10008584
543 Ga0105240_10463426
544 Ga0105237_10539010
545 Ga0105237_11268034
546 Ga0105239_10010184
547 Ga0157369_10822255
548 Ga0157372_10296464
549 Ga0182006_1113832
550 Ga0197907_10330925
551 Ga0197907_10494340
552 Ga0197907_10956647
553 Ga0206349_1012539
554 Ga0206349_1502532
555 Ga0206355_1087905
556 Ga0206355_1361766
557 Ga0206351_10210669
558 Ga0206351_10260865
559 Ga0206351_10459078
560 Ga0206351_10684472
561 Ga0206350_10007103
562 Ga0206350_10281620
563 Ga0206350_10460937
564 Ga0206350_10746107
565 Ga0206350_11455520
566 Ga0206354_10583857
567 Ga0154015_1135587
568 Ga0224712_10021017
569 Ga0224712_10059381
570 Ga0224712_10081317
571 Ga0224712_10090354
572 Ga0224712_10206508
573 Ga0224712_10219139
574 Ga0224712_10270309
575 Ga0209436_100036
576 Ga0207425_1000740
577 Ga0207425_1001994
578 Ga0209148_1000037
579 Ga0209129_1000092
580 Ga0209129_1000375
581 Ga0209233_1053530
582 Ga0209565_1020926
583 Ga0209455_1000036
584 Ga0209455_1038991
585 Ga0209673_1000162
586 Ga0209673_1000202
587 Ga0209673_1002833
588 Ga0209673_1026691
589 Ga0209130_1000073
590 Ga0209675_1018550
591 Ga0209676_1061472
592 Ga0209025_1011419
593 Ga0209564_1000234
594 Ga0209564_1001033
595 Ga0209564_1002168
596 Ga0209758_1000201
597 Ga0209758_1003900
598 Ga0209758_1009820
599 Ga0209050_1001019
600 Ga0209256_1000937
601 Ga0209256_1005565
602 Ga0209256_1006568
603 Ga0209256_1027959
604 Ga0207426_1000140
605 Ga0207426_1000764
606 Ga0209051_1000032
607 Ga0209051_1001485
608 Ga0209051_1006744
609 Ga0209257_1016191
610 Ga0209257_1018782
611 Ga0209257_1033689
612 Ga0207647_10004677
613 Ga0207647_10122139
614 Ga0207705_10579428
615 Ga0207695_10116757
616 Ga0207671_10415975
617 Ga0207639_10150955
618 Ga0207639_10369092
619 Ga0207678_10051352
620 Ga0207648_10109194
621 Ga0207698_10295239
622 Ga0209371_1002146
623 Ga0209813_10205309
624 Ga0268266_10053251
625 Ga0268266_10066738
626 Ga0268266_10529179
627 Ga0268256_1002051
628 Ga0307516_10156762
629 Ga0307405_10905648
630 Ga0307410_11230476
631 Ga0307406_10396950
632 Ga0307409_100302381
633 Ga0307409_100464636
634 Ga0307409_100750403
635 Ga0307414_10777115
636 Ga0307414_11025185
637 Ga0307414_11111067
638 Ga0373935_0568113
639 Ga0395900_0000101
640 Ga0395900_0671243
641 Ga0395898_0000043
642 Ga0395905_0000101
643 Ga0395905_0147363
644 Ga0395905_0275366
645 Ga0395901_0000068
646 Ga0395901_0125530
647 Ga0395901_0911195
648 Ga0439465_0002628
649 Ga0439465_0011685
650 Ga0451837_0389381
651 Ga0451853_1324418
652 Ga0466972_0000819
653 Ga0466967_0143609
654 Ga0495638_0000151
655 Ga0495610_0023702
656 Ga0495632_0038487
657 Ga0495597_0032902
658 Ga0495668_0023153
659 Ga0495625_0043077
660 Ga0495625_0129469
661 Ga0495661_0110860
662 Ga0495649_0031038
663 Ga0495636_0545992
664 Ga0495686_0075504
665 Ga0495686_0195143
666 Ga0496112_0240550
667 Ga0496124_0271032
668 Ga0496124_0526847
669 Ga0501031_0000068
670 Ga0501031_0000264
671 Ga0501031_0230827
672 Ga0501032_0000043
673 Ga0501032_0000103
674 Ga0501032_0008984
675 Ga0501032_0010278
676 Ga0501032_0026629
677 Ga0501032_0137782
678 Ga0501032_0227868
679 Ga0501033_0000865
680 Ga0501033_0006120
681 Ga0501033_0008141
682 Ga0501033_0010229
683 Ga0501033_0038878
684 Ga0501033_0086693
685 Ga0501034_0000204
686 Ga0501034_0000365
687 Ga0501034_0094106
688 Ga0501034_0106776
689 Ga0501034_0322236
690 Ga0501034_0564023
691 Ga0501034_0617192
692 Ga0501036_0000017
693 Ga0501036_0000058
694 Ga0501036_0018095
695 Ga0501036_0072606
696 Ga0501036_0308378
697 Ga0501037_0000028
698 Ga0501037_0000157
699 Ga0501037_0006743
700 Ga0501037_0012889
701 Ga0501037_0015189
702 Ga0501037_0057158
703 Ga0501037_0077194
704 Ga0501037_0293419
705 Ga0501038_0000035
706 Ga0501038_0000091
707 Ga0501038_0001470
708 Ga0501038_0010007
709 Ga0501038_0014600
710 Ga0501038_0022721
711 Ga0501038_0126134
712 Ga0501038_0324623
713 Ga0501039_0000039
714 Ga0501039_0000071
715 Ga0501039_0041880
716 Ga0501039_0314287
717 Ga0501042_0885935
718 Ga0501043_0000028
719 Ga0501043_0000541
720 Ga0501043_0001914
721 Ga0501043_0010065
722 Ga0501043_0036669
723 Ga0501043_0083106
724 Ga0501043_0345015
725 Ga0501046_0018664
726 Ga0501046_0180554
727 Ga0501046_0236640
728 Ga0501047_0000797
729 Ga0501047_0001709
730 Ga0501047_0007886
731 Ga0501047_0040165
732 Ga0501048_0014403
733 Ga0501048_0373378
734 Ga0501067_0035549
735 Ga0501068_0015192
736 Ga0501068_0031738
737 Ga0501069_0000014
738 Ga0501069_0000219
739 Ga0501069_0004377
740 Ga0501070_0000406
741 Ga0501070_0001318
742 Ga0501070_0026255
743 Ga0501070_0076267
744 Ga0501070_0252695
745 Ga0501070_0558058
746 Ga0501071_0343585
747 Ga0501073_0045654
748 Ga0501073_0088517
749 Ga0501073_0188375
750 Ga0501074_0000004
751 Ga0501074_0000091
752 Ga0501074_0063794
753 Ga0501074_0270046
754 Ga0501074_0559751
755 Ga0501080_0000027
756 Ga0501080_0017479
757 Ga0501080_0049895
758 Ga0501080_0169640
759 Ga0501080_0202814
760 Ga0501080_0367205
761 Ga0501081_0137972
762 Ga0501083_0000025
763 Ga0501083_0000163
764 Ga0501083_0294773
765 Ga0501268_023095
766 Ga0501035_0000129
767 Ga0501035_0000503
768 Ga0501035_0008686
769 Ga0501035_0014960
770 Ga0501035_0021270
771 Ga0501035_0071342
772 Ga0501035_0302197
773 Ga0501044_0000052
774 Ga0501044_0000225
775 Ga0501044_0003390
776 Ga0501044_0020644
777 Ga0501044_0022321
778 Ga0501044_0023314
779 Ga0501044_0033565
780 Ga0501044_0072082
781 Ga0501044_0171771
782 Ga0501045_0010128
783 Ga0501045_0463589
784 nmdc:mga03683_129125_c1
785 nmdc:mga03683_46953_c1
786 nmdc:mga03n38_310676_c1
787 nmdc:mga0yw44_337756_c1
788 nmdc:mga0yw44_45434_c1
789 nmdc:mga0yw44_75299_c1
790 nmdc:mga06z11_112371_c1
791 nmdc:mga06z11_303130_c1
792 nmdc:mga06z11_30812_c1
793 nmdc:mga04h51_234615_c1
794 nmdc:mga07m45_57123_c1
795 nmdc:mga0sz30_4290_c1
796 nmdc:mga0sz30_63467_c1
797 Ga0500610_0222798
798 Ga0500578_0018929
799 Ga0500658_0005008
800 Ga0500604_0061783
801 Ga0500616_0026619
802 Ga0500627_0040650
803 Ga0501084_1455180
804 Ga0587073_0083541
805 Ga0587088_033238
806 Ga0587088_044532
807 Ga0587089_034100
808 Ga0587106_029019
809 Ga0587128_044341
810 Ga0587075_026417
811 Ga0587107_042279
812 Ga0587114_019581
813 Ga0501082_0087812
814 Ga0501082_0391944
815 3004335055
816 2503201115
817 2509143918
818 2510131870
819 2510137138
820 2512931995
821 2513600426
822 2513871862
823 2513924776
824 2517099915
825 2517405431
826 2520377831
827 2588517871
828 2597813066
829 2599416335
830 2616296817
831 2671116694
832 2688598035
833 2694631452
834 2694640130
835 2739033432
836 2793343666
837 2806049829
838 2806049838
839 2806051218
840 2806057609
841 2806078049
842 2819612346
843 2838036453
844 2838693842
845 2838736234
846 2838749053
847 2841738926
848 2841858967
849 2842236587
850 2842250184
851 2842263982
852 2842278174
853 2842311035
854 2842342361
855 2844460010
856 2856333744
857 2856338134
858 2857356033
859 2857369002
860 2857524132
861 2857524524
862 2869275114
863 2869292908
864 2871429721
865 2871481132
866 2871497144
867 2874128293
868 2874147185
869 2874156775
870 2876368984
871 2876383421
872 2876404933
873 2876414275
874 2878746107
875 2878761365
876 2878768332
877 2878779093
878 2878782203
879 2878790687
880 2881153231
881 2885311234
882 2885326406
883 2885334133
884 2888345652
885 2889012761
886 2889022328
887 2891374018
888 2903502016
889 2903527982
890 2903529706
891 2903541939
892 2906308620
893 2906321788
894 2906380962
895 2906413609
896 2909048505
897 2919107406
898 2919173805
899 2922157862
900 2922180365
901 2923561798
902 2924761044
903 2933577539
904 2936371279
905 2936375518
906 2937815224
907 2937842983
908 2937854115
909 2937995795
910 2938021336
911 2958049164
912 2958072199
913 2958101761
914 2958124151
915 2958137199
916 2958141363
917 2958159126
918 2958166267
919 2958174230
920 2958180424
921 2961078256
922 2961142597
923 2961164729
924 2963647213
925 2965019555
926 2965026037
927 2965036075
928 2965054973
929 2965109734
930 2965115896
931 2965121064
932 2968087952
933 2968118107
934 2968173131
935 2970543186
936 2970551731
937 2970556221
938 2977844691
939 2977872191
940 2977874877
941 2977927471
942 2977936621
943 2977944091
944 2977958075
945 2979710875
946 2979794812
947 2987639847
948 2987647861
949 2987654461
950 2987660738
951 2987678701
952 2996339969
953 3004189786
954 3004207420
955 3004215783
956 3004224560
957 3004241308
958 3005417985
959 637075090
960 649872567
961 8004302976
962 8004389199
963 8004403305
964 8004634383
965 8004714876
966 8005319954
967 8005398056
968 8005487838
969 8005645611
970 8005686157
971 8018131125
972 8023684827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

100

200

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cg9-assembly1.cif.gz_Y crystal structure of an hsp90-sba1 closed chaperone complex 0.8786 65 155
2jki-assembly3.cif.gz_U complex of hsp90 n-terminal and sgt1 cs domain 0.8785 65 156
4rzk-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus hsp20.1 acd 0.8596 65 155
3n3e-assembly1.cif.gz_B zebrafish alphaa crystallin 0.8491 66 156
2y22-assembly1.cif.gz_A human alphab-crystallin domain (residues 67-157) 0.8403 68 156
ID Description Score Start End Superfamily
af_Q8S1F2_1_96_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8827 65 154 2.60.40.790
af_A0A0R4ID80_6_85_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8805 67 154 2.60.40.790
2cg9Y01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8786 65 155 2.60.40.790
af_F1QZY5_45_141_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8687 65 156 2.60.40.790
af_Q9D9A7_3_126_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8675 67 154 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A2N1TAR3-F1-model_v4 Heat-shock protein SP21 0.8052 65 169
AF-A0A4Q3AGF1-F1-model_v4 deleted 0.7999 68 169
AF-A0A3M1KTZ8-F1-model_v4 Hsp20/alpha crystallin family protein 0.7935 60 168 GO:0009408
AF-A0A7C2PFX5-F1-model_v4 Hsp20/alpha crystallin family protein 0.788 65 168
AF-A0A7Y0KMH5-F1-model_v4 Hsp20 family protein 0.7784 66 169

Map